BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF048P04

Length=312
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008450608.1|  PREDICTED: 60S ribosomal protein L18-2           73.2    1e-13   Cucumis melo [Oriental melon]
ref|XP_004144773.1|  PREDICTED: 60S ribosomal protein L18-3-like      72.8    2e-13   Cucumis sativus [cucumbers]
ref|XP_008454015.1|  PREDICTED: 60S ribosomal protein L18-3           72.8    2e-13   Cucumis melo [Oriental melon]
ref|XP_010914484.1|  PREDICTED: 60S ribosomal protein L18-3           72.8    2e-13   Elaeis guineensis
gb|KGN66048.1|  hypothetical protein Csa_1G569250                     72.8    2e-13   Cucumis sativus [cucumbers]
ref|XP_010528904.1|  PREDICTED: 60S ribosomal protein L18-2           72.4    2e-13   Tarenaya hassleriana [spider flower]
gb|KHN20393.1|  60S ribosomal protein L18-2                           72.8    2e-13   Glycine soja [wild soybean]
ref|NP_001236071.1|  uncharacterized protein LOC100499789             72.4    3e-13   Glycine max [soybeans]
ref|XP_006344694.1|  PREDICTED: 60S ribosomal protein L18-2-like      72.4    3e-13   Solanum tuberosum [potatoes]
ref|XP_006359857.1|  PREDICTED: 60S ribosomal protein L18-2-like      72.0    4e-13   Solanum tuberosum [potatoes]
ref|XP_006444385.1|  hypothetical protein CICLE_v10022435mg           71.6    4e-13   Citrus clementina [clementine]
ref|XP_004135776.1|  PREDICTED: uncharacterized protein LOC101207642  73.9    4e-13   
ref|XP_002523106.1|  60S ribosomal protein L18, putative              71.6    5e-13   Ricinus communis
ref|XP_010088293.1|  60S ribosomal protein L18-3                      71.6    5e-13   
ref|XP_007163123.1|  hypothetical protein PHAVU_001G208200g           71.6    5e-13   Phaseolus vulgaris [French bean]
ref|XP_010104147.1|  60S ribosomal protein L18-2                      71.6    5e-13   
ref|XP_010094463.1|  60S ribosomal protein L18-2                      71.6    6e-13   
ref|NP_001235897.1|  uncharacterized protein LOC100527681             71.2    6e-13   
ref|XP_003554636.2|  PREDICTED: 60S ribosomal protein L18-2-like      71.6    6e-13   Glycine max [soybeans]
gb|KHN20252.1|  60S ribosomal protein L18-3                           71.2    6e-13   Glycine soja [wild soybean]
gb|KHN43503.1|  60S ribosomal protein L18-2                           71.2    6e-13   Glycine soja [wild soybean]
ref|XP_004984437.1|  PREDICTED: 60S ribosomal protein L18-2-like      71.2    6e-13   
ref|XP_003556523.1|  PREDICTED: 60S ribosomal protein L18-2-like      71.2    6e-13   Glycine max [soybeans]
ref|NP_001237789.1|  uncharacterized protein LOC100500164             71.2    7e-13   Glycine max [soybeans]
gb|KHN03962.1|  60S ribosomal protein L18-2                           71.2    7e-13   Glycine soja [wild soybean]
ref|XP_004495692.1|  PREDICTED: 60S ribosomal protein L18-like        71.2    7e-13   Cicer arietinum [garbanzo]
gb|KCW85063.1|  hypothetical protein EUGRSUZ_B01908                   70.5    8e-13   Eucalyptus grandis [rose gum]
gb|KJB41866.1|  hypothetical protein B456_007G127300                  70.9    1e-12   Gossypium raimondii
gb|KDP23459.1|  hypothetical protein JCGZ_23292                       70.5    1e-12   Jatropha curcas
ref|XP_010043043.1|  PREDICTED: 60S ribosomal protein L18-2           70.5    1e-12   Eucalyptus grandis [rose gum]
ref|XP_006433453.1|  hypothetical protein CICLE_v10002597mg           70.5    1e-12   Citrus clementina [clementine]
gb|KDP28183.1|  hypothetical protein JCGZ_13954                       70.5    1e-12   Jatropha curcas
ref|XP_010025256.1|  PREDICTED: 60S ribosomal protein L18-2           70.5    1e-12   Eucalyptus grandis [rose gum]
ref|XP_010313195.1|  PREDICTED: 60S ribosomal protein L18-2-like      70.5    1e-12   Solanum lycopersicum
ref|XP_002461201.1|  hypothetical protein SORBIDRAFT_02g042750        70.5    1e-12   Sorghum bicolor [broomcorn]
ref|XP_002319502.1|  60S ribosomal protein L18                        70.5    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_004290808.1|  PREDICTED: 60S ribosomal protein L18-2           70.5    1e-12   Fragaria vesca subsp. vesca
ref|XP_002465302.1|  hypothetical protein SORBIDRAFT_01g035860        70.5    1e-12   Sorghum bicolor [broomcorn]
ref|XP_009151179.1|  PREDICTED: 60S ribosomal protein L18-2           70.5    1e-12   Brassica rapa
emb|CDY36892.1|  BnaC07g01080D                                        67.8    1e-12   Brassica napus [oilseed rape]
ref|XP_011036896.1|  PREDICTED: 60S ribosomal protein L18-2           70.1    1e-12   Populus euphratica
ref|NP_187210.1|  60S ribosomal protein L18-2                         70.1    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011079633.1|  PREDICTED: 60S ribosomal protein L18-2-like      70.1    1e-12   Sesamum indicum [beniseed]
ref|XP_004958675.1|  PREDICTED: 60S ribosomal protein L18-3-like      70.1    1e-12   Setaria italica
gb|AAA69928.1|  cytoplasmic ribosomal protein L18                     70.1    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382454.1|  60S ribosomal protein L18                        70.1    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011079632.1|  PREDICTED: 60S ribosomal protein L18-2           70.1    1e-12   Sesamum indicum [beniseed]
ref|XP_009796134.1|  PREDICTED: 60S ribosomal protein L18-2-like      70.1    1e-12   Nicotiana sylvestris
gb|KJB41867.1|  hypothetical protein B456_007G127300                  70.1    2e-12   Gossypium raimondii
ref|XP_009625475.1|  PREDICTED: 60S ribosomal protein L18-2-like      70.1    2e-12   Nicotiana tomentosiformis
ref|XP_009772706.1|  PREDICTED: 60S ribosomal protein L18-2-like      70.1    2e-12   Nicotiana sylvestris
emb|CDY66803.1|  BnaAnng22990D                                        70.1    2e-12   Brassica napus [oilseed rape]
gb|ACF79980.1|  unknown                                               68.6    2e-12   Zea mays [maize]
ref|NP_001236701.1|  uncharacterized protein LOC100306301             70.1    2e-12   
gb|KIZ05100.1|  60S ribosomal protein L18-3                           70.1    2e-12   Monoraphidium neglectum
ref|XP_004247404.1|  PREDICTED: 60S ribosomal protein L18-2           70.1    2e-12   Solanum lycopersicum
ref|XP_009129884.1|  PREDICTED: 60S ribosomal protein L18-2-like      70.1    2e-12   Brassica rapa
emb|CDO98841.1|  unnamed protein product                              70.1    2e-12   Coffea canephora [robusta coffee]
gb|ACR35483.1|  unknown                                               68.9    2e-12   Zea mays [maize]
ref|XP_009629074.1|  PREDICTED: 60S ribosomal protein L18-2           69.7    2e-12   Nicotiana tomentosiformis
gb|KJB23305.1|  hypothetical protein B456_004G091200                  68.9    2e-12   Gossypium raimondii
ref|XP_011015181.1|  PREDICTED: 60S ribosomal protein L18-2-like      68.9    2e-12   Populus euphratica
ref|XP_007144959.1|  hypothetical protein PHAVU_007G197900g           69.7    2e-12   Phaseolus vulgaris [French bean]
emb|CDX74138.1|  BnaA03g29090D                                        69.7    3e-12   
gb|AGV54741.1|  60S ribosomal protein L18-3-like protein              69.7    3e-12   Phaseolus vulgaris [French bean]
ref|XP_002976425.1|  hypothetical protein SELMODRAFT_267976           69.3    3e-12   Selaginella moellendorffii
ref|XP_009124870.1|  PREDICTED: 60S ribosomal protein L18-2-like      69.3    3e-12   Brassica rapa
ref|NP_001050069.1|  Os03g0341100                                     69.3    3e-12   
gb|EPS67068.1|  hypothetical protein M569_07709                       69.3    3e-12   Genlisea aurea
ref|XP_002985888.1|  hypothetical protein SELMODRAFT_181978           69.3    3e-12   Selaginella moellendorffii
ref|XP_007147006.1|  hypothetical protein PHAVU_006G088800g           69.3    3e-12   Phaseolus vulgaris [French bean]
ref|XP_007050975.1|  Ribosomal protein L18 isoform 2                  69.3    3e-12   
ref|XP_009134833.1|  PREDICTED: 60S ribosomal protein L18-2           69.3    3e-12   Brassica rapa
ref|XP_007050976.1|  Ribosomal protein L18 isoform 3                  69.3    3e-12   
ref|XP_008370417.1|  PREDICTED: 60S ribosomal protein L18-2           69.3    3e-12   Malus domestica [apple tree]
ref|XP_009338229.1|  PREDICTED: 60S ribosomal protein L18-2-like      69.3    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_006288739.1|  hypothetical protein CARUB_v10002048mg           69.3    3e-12   Capsella rubella
emb|CDP17112.1|  unnamed protein product                              69.7    3e-12   Coffea canephora [robusta coffee]
ref|XP_009335702.1|  PREDICTED: 60S ribosomal protein L18-2           69.3    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_008388515.1|  PREDICTED: 60S ribosomal protein L18-2-like      69.3    3e-12   Malus domestica [apple tree]
ref|XP_006658116.1|  PREDICTED: 60S ribosomal protein L18-3-like      69.3    3e-12   Oryza brachyantha
ref|XP_006650060.1|  PREDICTED: 60S ribosomal protein L18-3-like      69.3    3e-12   Oryza brachyantha
ref|XP_007050974.1|  Ribosomal protein L18 isoform 1                  69.3    3e-12   Theobroma cacao [chocolate]
ref|XP_008369026.1|  PREDICTED: 60S ribosomal protein L18-2           69.3    3e-12   
gb|KJB23303.1|  hypothetical protein B456_004G091200                  69.3    3e-12   Gossypium raimondii
ref|XP_008386678.1|  PREDICTED: 60S ribosomal protein L18-2-like      69.3    3e-12   
gb|ADD54595.1|  putative ribosomal protein L18                        68.9    3e-12   Linum usitatissimum
ref|XP_007031040.1|  Ribosomal protein L18                            69.3    3e-12   Theobroma cacao [chocolate]
ref|NP_001131538.1|  uncharacterized protein LOC100192878             69.3    4e-12   Zea mays [maize]
ref|NP_001060617.1|  Os07g0674700                                     69.3    4e-12   
ref|XP_007205962.1|  hypothetical protein PRUPE_ppa012012mg           69.3    4e-12   Prunus persica
ref|XP_007201344.1|  hypothetical protein PRUPE_ppa012001mg           68.9    4e-12   Prunus persica
ref|XP_002512455.1|  60S ribosomal protein L18, putative              71.2    4e-12   
ref|XP_008775991.1|  PREDICTED: 60S ribosomal protein L18-2           68.9    4e-12   Phoenix dactylifera
ref|XP_006386732.1|  hypothetical protein POPTR_0002s20400g           68.9    4e-12   
ref|XP_010497850.1|  PREDICTED: 60S ribosomal protein L18-2-like      67.0    4e-12   
ref|XP_002301485.1|  60S ribosomal protein L18                        68.9    4e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009630920.1|  PREDICTED: 60S ribosomal protein L18-2-like      68.9    4e-12   Nicotiana tomentosiformis
ref|XP_010931680.1|  PREDICTED: 60S ribosomal protein L18-2           68.9    4e-12   Elaeis guineensis
ref|XP_011042004.1|  PREDICTED: 60S ribosomal protein L18-2-like      68.9    4e-12   Populus euphratica
ref|XP_002320999.1|  60S ribosomal protein L18                        68.9    4e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009783807.1|  PREDICTED: 60S ribosomal protein L18-2-like      68.9    4e-12   Nicotiana sylvestris
ref|XP_010546736.1|  PREDICTED: 60S ribosomal protein L18-3           68.9    5e-12   Tarenaya hassleriana [spider flower]
ref|NP_001266634.1|  uncharacterized protein LOC101027163             67.4    5e-12   
emb|CDY18813.1|  BnaAnng02780D                                        68.9    5e-12   Brassica napus [oilseed rape]
ref|XP_010544997.1|  PREDICTED: 60S ribosomal protein L18-2-like      68.6    5e-12   Tarenaya hassleriana [spider flower]
ref|XP_010524859.1|  PREDICTED: 60S ribosomal protein L18-3           68.6    5e-12   Tarenaya hassleriana [spider flower]
ref|XP_010523956.1|  PREDICTED: 60S ribosomal protein L18-2-like      68.6    5e-12   Tarenaya hassleriana [spider flower]
ref|XP_010559185.1|  PREDICTED: 60S ribosomal protein L18-2-like      68.6    6e-12   Tarenaya hassleriana [spider flower]
emb|CDY05183.1|  BnaC05g46200D                                        68.9    6e-12   
gb|KJB82633.1|  hypothetical protein B456_013G206100                  67.8    6e-12   Gossypium raimondii
gb|ABK92688.1|  unknown                                               68.6    6e-12   Populus trichocarpa [western balsam poplar]
gb|AFK49563.1|  unknown                                               68.2    7e-12   Lotus japonicus
gb|KJB22517.1|  hypothetical protein B456_004G052100                  67.4    9e-12   Gossypium raimondii
gb|EYU21621.1|  hypothetical protein MIMGU_mgv1a014504mg              68.2    9e-12   Erythranthe guttata [common monkey flower]
gb|KFK26512.1|  hypothetical protein AALP_AA8G258600                  68.2    9e-12   Arabis alpina [alpine rockcress]
gb|KFK37967.1|  hypothetical protein AALP_AA3G053100                  68.2    9e-12   Arabis alpina [alpine rockcress]
gb|KJB82634.1|  hypothetical protein B456_013G206100                  67.8    9e-12   Gossypium raimondii
gb|KJB82632.1|  hypothetical protein B456_013G206100                  67.8    9e-12   Gossypium raimondii
ref|NP_198137.1|  60S ribosomal protein L18-3                         67.8    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010674074.1|  PREDICTED: 60S ribosomal protein L18-2           67.8    1e-11   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB45330.1|  hypothetical protein B456_007G301700                  67.8    1e-11   Gossypium raimondii
ref|XP_010684349.1|  PREDICTED: 60S ribosomal protein L18-2-like      67.8    1e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002874343.1|  60S ribosomal protein L18                        67.8    1e-11   Arabidopsis lyrata subsp. lyrata
gb|KHF98574.1|  60S ribosomal L18-2 -like protein                     67.8    1e-11   Gossypium arboreum [tree cotton]
ref|XP_006408052.1|  hypothetical protein EUTSA_v10021598mg           67.8    1e-11   Eutrema salsugineum [saltwater cress]
ref|XP_010421566.1|  PREDICTED: 60S ribosomal protein L18-2-like      67.4    1e-11   Camelina sativa [gold-of-pleasure]
gb|AFK45456.1|  unknown                                               67.4    1e-11   Lotus japonicus
ref|XP_002882427.1|  hypothetical protein ARALYDRAFT_477850           67.4    1e-11   Arabidopsis lyrata subsp. lyrata
emb|CDY05559.1|  BnaA02g31320D                                        70.1    1e-11   
ref|XP_009411663.1|  PREDICTED: 60S ribosomal protein L18-3-like      67.4    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010259492.1|  PREDICTED: 60S ribosomal protein L18-3           67.4    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_005843726.1|  hypothetical protein CHLNCDRAFT_37334            67.0    2e-11   Chlorella variabilis
ref|XP_006828669.1|  hypothetical protein AMTR_s00129p00125840        64.7    2e-11   
ref|XP_010269589.1|  PREDICTED: 60S ribosomal protein L18-3           67.0    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_002270635.1|  PREDICTED: 60S ribosomal protein L18-2           67.0    2e-11   Vitis vinifera
emb|CDY19736.1|  BnaA09g03890D                                        67.4    2e-11   Brassica napus [oilseed rape]
gb|KHG07157.1|  60S ribosomal L18-2 -like protein                     67.0    2e-11   Gossypium arboreum [tree cotton]
ref|XP_009381102.1|  PREDICTED: 60S ribosomal protein L18-2-like      67.0    2e-11   
ref|XP_009629121.1|  PREDICTED: 60S ribosomal protein L18-2           67.0    2e-11   Nicotiana tomentosiformis
ref|XP_009611670.1|  PREDICTED: 60S ribosomal protein L18-2-like      67.0    2e-11   Nicotiana tomentosiformis
ref|XP_008810211.1|  PREDICTED: 60S ribosomal protein L18-2-like      67.0    2e-11   Phoenix dactylifera
ref|XP_002271179.1|  PREDICTED: 60S ribosomal protein L18-2           67.0    2e-11   Vitis vinifera
ref|XP_010659657.1|  PREDICTED: 60S ribosomal protein L18-2-like      67.0    2e-11   Vitis vinifera
ref|XP_006855263.1|  hypothetical protein AMTR_s00183p00048560        66.6    3e-11   Amborella trichopoda
ref|XP_009111741.1|  PREDICTED: 60S ribosomal protein L18-2-like      66.6    3e-11   Brassica rapa
emb|CDX99969.1|  BnaC09g03320D                                        66.6    3e-11   
sp|O65729.1|RL18_CICAR  RecName: Full=60S ribosomal protein L18       66.6    3e-11   Cicer arietinum [garbanzo]
emb|CBI39539.3|  unnamed protein product                              67.0    3e-11   Vitis vinifera
ref|XP_010455078.1|  PREDICTED: 60S ribosomal protein L18-2-like ...  65.9    3e-11   Camelina sativa [gold-of-pleasure]
gb|ACF81873.1|  unknown                                               65.1    3e-11   Zea mays [maize]
gb|ABD36585.1|  putative 60S ribosomal protein L18                    65.1    3e-11   Saccharum hybrid cultivar [sugarcane]
ref|XP_004494578.1|  PREDICTED: 60S ribosomal protein L18-like        66.2    4e-11   
ref|XP_011023716.1|  PREDICTED: 60S ribosomal protein L18-2           66.2    4e-11   Populus euphratica
ref|XP_004494383.1|  PREDICTED: 60S ribosomal protein L18-like        66.2    4e-11   Cicer arietinum [garbanzo]
emb|CBI36879.3|  unnamed protein product                              67.4    4e-11   Vitis vinifera
ref|XP_010550998.1|  PREDICTED: 60S ribosomal protein L18-2-like ...  65.9    4e-11   Tarenaya hassleriana [spider flower]
emb|CBI22977.3|  unnamed protein product                              66.6    4e-11   Vitis vinifera
gb|ACF83096.1|  unknown                                               65.5    4e-11   Zea mays [maize]
ref|XP_010455077.1|  PREDICTED: 60S ribosomal protein L18-3-like ...  66.2    4e-11   Camelina sativa [gold-of-pleasure]
emb|CDY25018.1|  BnaC02g39900D                                        66.2    5e-11   Brassica napus [oilseed rape]
ref|XP_003568896.1|  PREDICTED: 60S ribosomal protein L18-2-like      65.9    5e-11   Brachypodium distachyon [annual false brome]
gb|EMT18368.1|  60S ribosomal protein L18-2                           65.9    5e-11   
dbj|BAJ90421.1|  predicted protein                                    65.9    5e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX80616.1|  BnaC07g28280D                                        66.2    5e-11   
ref|NP_001054688.1|  Os05g0155100                                     65.9    5e-11   
ref|XP_003562459.1|  PREDICTED: 60S ribosomal protein L18-3-like      65.9    5e-11   
ref|NP_001132852.1|  uncharacterized protein LOC100194344             65.9    5e-11   Zea mays [maize]
ref|XP_004977069.1|  PREDICTED: 60S ribosomal protein L18-2-like      65.9    5e-11   Setaria italica
gb|AFC88838.1|  60S ribosomal protein L18-like protein                65.9    5e-11   Miscanthus sinensis
ref|XP_002439318.1|  hypothetical protein SORBIDRAFT_09g004290        65.9    5e-11   Sorghum bicolor [broomcorn]
gb|EMS45435.1|  60S ribosomal protein L18-2                           65.9    5e-11   Triticum urartu
ref|XP_008656150.1|  PREDICTED: 60S ribosomal protein L18-3-like      65.9    5e-11   
ref|XP_006654064.1|  PREDICTED: 60S ribosomal protein L18-2-like      65.9    6e-11   Oryza brachyantha
ref|XP_008784768.1|  PREDICTED: 60S ribosomal protein L18-2-like      65.9    6e-11   Phoenix dactylifera
gb|EMT12638.1|  60S ribosomal protein L18-2                           65.9    6e-11   
gb|AFC88843.1|  60S ribosomal protein L18-3-like protein              65.5    6e-11   Miscanthus sinensis
ref|XP_009630742.1|  PREDICTED: 60S ribosomal protein L18-2-like      65.9    6e-11   Nicotiana tomentosiformis
ref|XP_010550997.1|  PREDICTED: 60S ribosomal protein L18-3-like ...  65.9    6e-11   Tarenaya hassleriana [spider flower]
ref|XP_010228645.1|  PREDICTED: 60S ribosomal protein L18-2-like      65.5    6e-11   Brachypodium distachyon [annual false brome]
ref|XP_010938374.1|  PREDICTED: 60S ribosomal protein L18-2-like      65.5    7e-11   Elaeis guineensis
ref|XP_009384409.1|  PREDICTED: 60S ribosomal protein L18-2           65.5    7e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009402513.1|  PREDICTED: 60S ribosomal protein L18-2-like      65.5    7e-11   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY40718.1|  BnaC03g34340D                                        65.5    7e-11   Brassica napus [oilseed rape]
gb|ABR23470.1|  60s ribosomal protein L18                             65.1    9e-11   Ornithodoros parkeri
dbj|BAJ93091.1|  predicted protein                                    65.5    9e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAX48850.1|  L18                                                   65.1    1e-10   Suberites domuncula
ref|XP_002948325.1|  component of cytosolic 80S ribosome and 60S ...  65.1    1e-10   Volvox carteri f. nagariensis
ref|XP_010273829.1|  PREDICTED: 60S ribosomal protein L18-2-like      64.7    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_002400316.1|  ribosomal protein L18, putative                  64.7    1e-10   Ixodes scapularis [blacklegged tick]
emb|CAJ17292.1|  ribosomal protein L18e                               63.9    1e-10   Cicindela campestris
ref|XP_006394935.1|  hypothetical protein EUTSA_v10004865mg           65.1    1e-10   
ref|XP_006298641.1|  hypothetical protein CARUB_v10014730mg           63.9    1e-10   
ref|XP_009775352.1|  PREDICTED: 60S ribosomal protein L18-2           64.3    2e-10   Nicotiana sylvestris
pdb|3J61|Q  Chain Q, Localization Of The Large Subunit Ribosomal ...  64.3    2e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006298640.1|  hypothetical protein CARUB_v10014730mg           64.3    2e-10   Capsella rubella
ref|XP_010464086.1|  PREDICTED: 60S ribosomal protein L18-3-like      64.3    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010429374.1|  PREDICTED: 60S ribosomal protein L18-3-like      64.3    2e-10   Camelina sativa [gold-of-pleasure]
gb|ACN41161.1|  unknown                                               63.9    2e-10   Picea sitchensis
ref|XP_010486014.1|  PREDICTED: 60S ribosomal protein L18-3           64.3    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_011351685.1|  PREDICTED: 60S ribosomal protein L18             64.3    2e-10   Ooceraea biroi
ref|XP_009417724.1|  PREDICTED: 60S ribosomal protein L18-2           63.9    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK21809.1|  unknown                                               63.9    2e-10   Picea sitchensis
gb|ABK22247.1|  unknown                                               63.9    2e-10   Picea sitchensis
ref|XP_011255380.1|  PREDICTED: 60S ribosomal protein L18             63.9    2e-10   Camponotus floridanus
gb|ABK26318.1|  unknown                                               63.9    2e-10   Picea sitchensis
gb|EMS65848.1|  60S ribosomal protein L18-2                           64.3    2e-10   Triticum urartu
ref|XP_010921627.1|  PREDICTED: uncharacterized protein LOC105045157  65.9    3e-10   
ref|XP_008789961.1|  PREDICTED: uncharacterized protein LOC103707302  67.0    3e-10   
sp|Q4GXG7.1|RL18_TIMBA  RecName: Full=60S ribosomal protein L18       63.9    3e-10   Timarcha balearica
ref|XP_001690885.1|  ribosomal protein L18, component of cytosoli...  63.9    3e-10   Chlamydomonas reinhardtii
emb|CAJ17294.1|  ribosomal protein L18e                               63.9    3e-10   Hister sp. APV-2005
gb|AGI03919.1|  60S ribosomal protein L18-like protein                62.4    3e-10   Leptinotarsa decemlineata
ref|XP_968042.1|  PREDICTED: 60S ribosomal protein L18                63.2    4e-10   Tribolium castaneum [rust-red flour beetle]
ref|XP_008547226.1|  PREDICTED: 60S ribosomal protein L18-like        63.2    4e-10   Microplitis demolitor
emb|CDJ38394.1|  60S ribosomal protein L18, putative                  62.0    5e-10   Eimeria tenella
sp|Q56FG8.1|RL18_LYSTE  RecName: Full=60S ribosomal protein L18       62.8    6e-10   Lysiphlebus testaceipes
ref|XP_008546759.1|  PREDICTED: 60S ribosomal protein L18             62.4    8e-10   Microplitis demolitor
gb|ADV03044.1|  ribosomal protein L18                                 62.4    8e-10   Amphidinium carterae
ref|XP_009012591.1|  hypothetical protein HELRODRAFT_156470           62.4    8e-10   Helobdella robusta
ref|XP_008201914.1|  PREDICTED: 60S ribosomal protein L18             62.4    8e-10   Nasonia vitripennis
ref|XP_011313252.1|  PREDICTED: 60S ribosomal protein L18             62.4    9e-10   Fopius arisanus
ref|XP_001781485.1|  predicted protein                                62.4    9e-10   
ref|XP_011497333.1|  PREDICTED: 60S ribosomal protein L18             62.4    9e-10   Ceratosolen solmsi marchali
ref|XP_006561192.1|  PREDICTED: 60S ribosomal protein L18-like        62.4    1e-09   Apis mellifera [bee]
ref|XP_003691391.1|  PREDICTED: 60S ribosomal protein L18-like        62.4    1e-09   Apis florea [dwarf honeybee]
ref|XP_001760902.1|  predicted protein                                62.4    1e-09   
gb|KJE95959.1|  ribosomal protein L18e                                62.4    1e-09   Capsaspora owczarzaki ATCC 30864
ref|XP_001751734.1|  predicted protein                                62.0    1e-09   
ref|XP_001785869.1|  predicted protein                                62.0    1e-09   
gb|EYU46738.1|  hypothetical protein MIMGU_mgv1a014520mg              62.0    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_004345091.2|  ribosomal protein L18e                           62.0    1e-09   Capsaspora owczarzaki ATCC 30864
ref|XP_003707499.1|  PREDICTED: 60S ribosomal protein L18-like        62.4    1e-09   
gb|KDR14978.1|  60S ribosomal protein L18                             61.6    1e-09   Zootermopsis nevadensis
emb|CDI82997.1|  60S ribosomal protein L18, putative                  61.6    2e-09   Eimeria acervulina
ref|XP_003485273.1|  PREDICTED: hypothetical protein LOC100746406     63.5    2e-09   
ref|XP_003393579.1|  PREDICTED: hypothetical protein LOC100643724     63.5    2e-09   
ref|XP_001745439.1|  hypothetical protein                             61.6    2e-09   Monosiga brevicollis MX1
emb|CAJ17293.1|  ribosomal protein L18e                               60.5    2e-09   Eucinetus sp. APV-2005
ref|XP_001760959.1|  predicted protein                                61.2    2e-09   
ref|XP_002130217.1|  PREDICTED: 60S ribosomal protein L18 isoform X1  60.8    3e-09   Ciona intestinalis [sea vase]
ref|XP_003081305.1|  ribosomal protein L18 (ISS)                      60.8    3e-09   
emb|CBI40138.3|  unnamed protein product                              60.5    3e-09   Vitis vinifera
emb|CEF99132.1|  Ribosomal protein L18e, conserved site               60.8    3e-09   Ostreococcus tauri
gb|EJW88057.1|  50S ribosomal protein L18                             60.5    4e-09   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|ABC25103.1|  ribosomal protein L18                                 60.1    4e-09   Glossina morsitans morsitans
ref|XP_011351645.1|  PREDICTED: 60S ribosomal protein L18-like        60.5    4e-09   Ooceraea biroi
ref|XP_001897286.1|  60S ribosomal protein L18                        60.5    4e-09   Brugia malayi [agent of lymphatic filariasis]
ref|XP_011062886.1|  PREDICTED: 60S ribosomal protein L18             60.8    4e-09   Acromyrmex echinatior
ref|NP_566104.1|  putative 60S ribosomal protein L18-1                60.1    4e-09   
ref|XP_002083946.1|  GD13082                                          60.5    4e-09   
ref|XP_005190752.1|  PREDICTED: 60S ribosomal protein L18             60.5    4e-09   Musca domestica
gb|EFZ15690.1|  hypothetical protein SINV_04174                       60.5    4e-09   
gb|EJD73862.1|  hypothetical protein, variant                         60.5    4e-09   Loa loa
gb|ABW90395.1|  putative ribosomal protein L18                        60.5    5e-09   Barentsia elongata
ref|XP_002047296.1|  GJ13360                                          60.1    5e-09   Drosophila virilis
ref|NP_648091.1|  ribosomal protein L18, isoform A                    60.1    5e-09   Drosophila melanogaster
sp|O22254.3|RL181_ARATH  RecName: Full=Putative 60S ribosomal pro...  60.1    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002007966.1|  GI12089                                          60.1    5e-09   
ref|XP_011184309.1|  PREDICTED: 60S ribosomal protein L18             60.1    5e-09   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_004526749.1|  PREDICTED: 60S ribosomal protein L18-like        60.1    5e-09   Ceratitis capitata [medfly]
ref|XP_001956062.1|  GF24783                                          60.1    5e-09   Drosophila ananassae
ref|XP_002021263.1|  GL24902                                          60.1    5e-09   
ref|XP_001984175.1|  GH15152                                          60.1    5e-09   Drosophila grimshawi
emb|CDP94036.1|  Protein BM-RPL-18, isoform b                         60.5    5e-09   Brugia malayi [agent of lymphatic filariasis]
ref|XP_011211055.1|  PREDICTED: 60S ribosomal protein L18             60.1    5e-09   Bactrocera dorsalis [papaya fruit fly]
ref|XP_002035667.1|  GM13785                                          60.1    5e-09   Drosophila sechellia
ref|XP_002094010.1|  GE20435                                          60.1    5e-09   Drosophila yakuba
ref|XP_011163555.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...  60.8    5e-09   
ref|XP_011135288.1|  PREDICTED: 60S ribosomal protein L18             60.1    5e-09   Harpegnathos saltator
ref|XP_001971483.1|  GG14989                                          60.1    6e-09   Drosophila erecta
ref|XP_003626232.1|  60S ribosomal protein L18                        59.7    6e-09   Medicago truncatula
gb|EFN87206.1|  60S ribosomal protein L18                             60.1    6e-09   Harpegnathos saltator
ref|XP_003626231.1|  60S ribosomal protein L18                        60.1    6e-09   Medicago truncatula
gb|AEE62646.1|  unknown                                               60.1    6e-09   Dendroctonus ponderosae
ref|XP_003142248.1|  hypothetical protein LOAG_06664                  59.7    8e-09   
ref|XP_002161036.1|  PREDICTED: 60S ribosomal protein L18-like        59.7    9e-09   
gb|ADD38370.1|  60S ribosomal protein L18                             59.3    1e-08   Lepeophtheirus salmonis
ref|XP_002423194.1|  60S ribosomal protein L18, putative              59.3    1e-08   Pediculus humanus corporis [human body lice]
emb|CBN08626.1|  ribosomal protein L18                                59.3    1e-08   
ref|XP_002028499.1|  GL13213                                          58.9    1e-08   
gb|AGH70165.1|  60S ribosomal protein L18                             58.9    2e-08   
ref|XP_002068278.1|  GK13159                                          58.5    2e-08   
gb|AAN73381.1|  ribosomal protein L18                                 58.5    2e-08   
gb|ERG81080.1|  60s ribosomal protein l18                             58.5    2e-08   
gb|KHN77912.1|  60S ribosomal protein L18                             58.5    2e-08   
gb|ABY27360.1|  ribosomal protein L18                                 56.6    2e-08   
ref|XP_002109185.1|  expressed hypothetical protein                   58.2    2e-08   
ref|XP_001419602.1|  Ribosomal protein L18, component of cytosoli...  58.2    2e-08   
ref|XP_009049705.1|  hypothetical protein LOTGIDRAFT_205248           58.2    2e-08   
gb|ERG80123.1|  60s ribosomal protein l18                             58.5    3e-08   
ref|XP_001640445.1|  predicted protein                                58.2    3e-08   
sp|Q0PXY6.1|RL18_DIACI  RecName: Full=60S ribosomal protein L18       58.2    3e-08   
ref|XP_007206177.1|  hypothetical protein PRUPE_ppa013798mg           57.4    3e-08   
ref|XP_008361302.1|  PREDICTED: 60S ribosomal protein L18-2-like      58.2    3e-08   
ref|XP_007510670.1|  predicted protein                                58.5    4e-08   
gb|EKC43150.1|  60S ribosomal protein L18                             57.8    4e-08   
ref|XP_011449585.1|  PREDICTED: 60S ribosomal protein L18-like        57.8    4e-08   
ref|XP_005643635.1|  ribosomal protein L18 component of cytosolic...  57.4    4e-08   
emb|CAD91422.1|  ribosomal protein L18                                57.4    4e-08   
gb|AEE61752.1|  unknown                                               57.4    5e-08   
ref|XP_004991895.1|  ribosomal protein l18                            57.4    5e-08   
dbj|BAN21088.1|  ribosomal protein L18                                57.4    5e-08   
ref|XP_002136374.1|  GA27760                                          57.0    5e-08   
dbj|BAF98665.1|  ribosomal protein L18                                57.0    6e-08   
ref|XP_007143771.1|  hypothetical protein PHAVU_007G100200g           56.6    6e-08   
gb|AFJ91753.1|  ribosomal protein L18                                 56.6    7e-08   
ref|XP_006902892.1|  PREDICTED: ribosomal protein L18-like            55.8    8e-08   
gb|ABZ04231.1|  ribosomal protein rpl18                               56.6    8e-08   
gb|ELW47918.1|  60S ribosomal protein L18                             56.6    1e-07   
ref|XP_005875781.1|  PREDICTED: 60S ribosomal protein L18-like        56.6    1e-07   
gb|EFX65754.1|  hypothetical protein DAPPUDRAFT_303528                56.2    1e-07   
emb|CCF75175.1|  unnamed protein product                              56.2    1e-07   
gb|ETN59846.1|  glycerol kinase                                       58.9    1e-07   
ref|XP_003056676.1|  predicted protein                                55.8    2e-07   
gb|ABX44820.1|  putative 60S ribosomal protein RPL18                  55.8    2e-07   
ref|XP_005879546.1|  PREDICTED: 60S ribosomal protein L18             55.8    2e-07   
ref|XP_003591163.1|  Ribosomal protein L18                            55.8    2e-07   
emb|CAX79064.1|  ribosomal protein L18                                55.5    2e-07   
gb|EPQ15950.1|  60S ribosomal protein L18                             55.8    2e-07   
ref|XP_005787945.1|  hypothetical protein EMIHUDRAFT_433854           55.5    2e-07   
ref|XP_308294.3|  AGAP007580-PB                                       55.5    2e-07   
emb|CAX72134.1|  ribosomal protein L18                                55.5    2e-07   
gb|AAW25981.1|  SJCHGC06655 protein                                   55.5    3e-07   
ref|XP_003604119.1|  Pectinesterase                                   57.8    3e-07   
ref|XP_002371723.1|  60S ribosomal protein L18, putative              55.5    3e-07   
ref|XP_008888411.1|  ribosomal protein RPL18                          55.5    3e-07   
gb|EHH21514.1|  hypothetical protein EGK_04601                        55.1    3e-07   
ref|XP_003886070.1|  Ribosomal protein L18, related                   55.1    3e-07   
gb|ABD77161.1|  ribosomal protein L18                                 55.1    3e-07   
ref|XP_002733428.1|  PREDICTED: 60S ribosomal protein L18-like        55.1    3e-07   
ref|NP_001191501.1|  60S ribosomal protein L18                        54.7    3e-07   
ref|NP_001266392.1|  60S ribosomal protein L18                        55.1    3e-07   
emb|CAF97888.1|  unnamed protein product                              55.1    4e-07   
ref|XP_003977661.1|  PREDICTED: 60S ribosomal protein L18-like        54.7    4e-07   
gb|EUT80095.1|  hypothetical protein PFAG_04739                       53.9    4e-07   
ref|XP_004077973.2|  PREDICTED: 60S ribosomal protein L18             54.7    6e-07   
emb|CAX79061.1|  ribosomal protein L18                                54.3    6e-07   
gb|EUD71725.1|  50S ribosomal protein L18e                            53.9    7e-07   
gb|ADV03016.1|  ribosomal protein L18                                 53.9    7e-07   
gb|ETB62682.1|  hypothetical protein YYC_00383                        53.9    9e-07   
ref|XP_008622469.1|  60S ribosomal protein L18                        53.9    9e-07   
ref|XP_008246284.1|  PREDICTED: uncharacterized protein LOC103344474  53.5    9e-07   
ref|XP_008246214.1|  PREDICTED: uncharacterized protein LOC103344359  54.7    1e-06   
emb|CDS50955.1|  60S ribosomal protein L18-2, putative                53.5    1e-06   
ref|XP_006735598.1|  PREDICTED: ribosomal protein L18-like            54.7    1e-06   
ref|XP_675827.1|  60S ribosomal subunit porotein L18                  53.5    1e-06   
ref|XP_011280797.1|  PREDICTED: ribosomal protein L18-like            53.9    1e-06   
emb|CCD58684.1|  60S ribosomal protein L18, putative                  53.5    1e-06   
ref|XP_001611595.1|  60S ribosomal protein L18                        53.5    1e-06   
emb|CDR16004.1|  60S ribosomal protein L18-2, putative                53.5    1e-06   
ref|XP_002809060.1|  60S ribosomal protein L18-2, putative            53.5    1e-06   
ref|XP_004223602.1|  60S ribosomal protein L18                        53.1    1e-06   
ref|XP_001614193.1|  60S ribosomal protein L18                        53.1    1e-06   
gb|ETW40547.1|  hypothetical protein PFNF135_04853                    53.1    1e-06   
ref|XP_008815721.1|  60S ribosomal protein L18                        53.5    1e-06   
gb|KEH24393.1|  60S ribosomal protein L18-3                           53.1    1e-06   
emb|CDH60299.1|  60s ribosomal protein l18                            53.1    1e-06   
gb|ETW28724.1|  hypothetical protein PFFCH_03853                      53.1    1e-06   
ref|XP_006677675.1|  hypothetical protein BATDEDRAFT_87003            53.1    2e-06   
emb|CDR97119.1|  60S ribosomal protein L18, putative                  53.9    2e-06   
ref|XP_002259941.1|  60S ribosomal subunit porotein L18               53.1    2e-06   
ref|XP_002506220.1|  ribosomal protein L18                            55.1    2e-06   
gb|EHH55004.1|  hypothetical protein EGM_04127                        52.8    2e-06   
ref|XP_729142.1|  eukaryotic ribosomal protein L18                    53.9    2e-06   
emb|CCX32543.1|  Similar to 60S ribosomal protein L18-B; acc. no....  52.8    2e-06   
ref|XP_005366738.1|  PREDICTED: 60S ribosomal protein L18-like        52.8    2e-06   
emb|CBK21900.2|  Ribosomal protein L18e                               52.8    2e-06   
gb|EGV97941.1|  60S ribosomal protein L18                             51.2    2e-06   
ref|XP_005573720.1|  PREDICTED: 60S ribosomal protein L18-like        53.1    2e-06   
emb|CBK22442.2|  unnamed protein product                              52.8    2e-06   
ref|XP_002722941.1|  PREDICTED: 60S ribosomal protein L18             52.8    2e-06   
ref|XP_001209532.1|  60S ribosomal protein L18                        52.4    3e-06   
gb|KFK32338.1|  hypothetical protein AALP_AA6G228700                  52.4    3e-06   
emb|CBK22327.2|  unnamed protein product                              52.4    3e-06   
gb|EIE84680.1|  60S ribosomal protein L18-B                           52.0    3e-06   
gb|EIE90015.1|  60S ribosomal protein L18-B                           52.0    3e-06   
emb|CDS08904.1|  Putative 50S ribosomal protein L18e                  52.4    3e-06   
gb|EAL24345.1|  similar to ribosomal protein L18; 60S ribosomal p...  52.8    3e-06   
ref|XP_001659268.1|  AAEL008481-PA                                    52.4    3e-06   
ref|XP_001841970.1|  60S ribosomal protein L18                        52.4    3e-06   
gb|EIE77872.1|  60S ribosomal protein L18-A                           52.0    3e-06   
gb|EIE89554.1|  60S ribosomal protein L18-A                           52.0    3e-06   
gb|EPB81859.1|  50S ribosomal protein L18e                            52.4    4e-06   
gb|EIE85188.1|  60S ribosomal protein L18-A                           52.0    4e-06   
ref|XP_009176548.1|  hypothetical protein T265_11593                  52.0    4e-06   
gb|EIE90592.1|  60S ribosomal protein L18-B                           52.0    4e-06   
gb|AFK34017.1|  unknown                                               52.0    4e-06   
gb|EPB85693.1|  50S ribosomal protein L18e                            52.4    4e-06   
ref|XP_005317949.1|  PREDICTED: ribosomal protein L18-like            52.0    4e-06   
gb|EYE97298.1|  ribosomal protein L18e                                52.4    4e-06   
emb|CEP17694.1|  hypothetical protein                                 51.6    5e-06   
dbj|GAN04379.1|  60S ribosomal protein L18                            51.6    5e-06   
emb|CEP15166.1|  hypothetical protein                                 52.0    5e-06   
emb|CEP19927.1|  hypothetical protein                                 51.6    5e-06   
dbj|GAN11649.1|  60S ribosomal protein L18                            52.4    5e-06   
gb|EPB87658.1|  60S ribosomal protein L18-A                           51.6    5e-06   
dbj|GAA55611.1|  large subunit ribosomal protein L18e                 52.4    5e-06   
dbj|GAN01748.1|  60S ribosomal protein L18                            52.4    6e-06   
gb|KFB37602.1|  60S ribosomal protein L18                             52.4    7e-06   
emb|CEG65762.1|  Putative 50S ribosomal protein L18e                  50.8    7e-06   
gb|AFW81438.1|  hypothetical protein ZEAMMB73_288952                  50.8    7e-06   
emb|CEJ01696.1|  Putative 50S ribosomal protein L18e                  51.2    8e-06   
emb|CEG79287.1|  Putative 60S ribosomal protein L18-A                 50.8    8e-06   
emb|CEI89354.1|  Putative 60S ribosomal protein L18-A                 51.2    8e-06   
emb|CEG66137.1|  Putative 60S ribosomal protein L18-A                 51.2    8e-06   
emb|CEI93758.1|  Putative 50S ribosomal protein L18e                  50.8    8e-06   
emb|CEG65761.1|  Putative 50S ribosomal protein L18e                  50.8    9e-06   
emb|CEF65151.1|  60S ribosomal protein L18                            51.2    9e-06   
ref|XP_009053775.1|  hypothetical protein LOTGIDRAFT_70408            50.4    9e-06   
gb|ETS62502.1|  hypothetical protein PaG_03132                        51.6    9e-06   
dbj|GAC74605.1|  armadillo                                            51.2    1e-05   
ref|XP_002595537.1|  hypothetical protein BRAFLDRAFT_275280           50.8    1e-05   
gb|KEQ70149.1|  ribosomal protein L18e                                50.8    1e-05   
gb|KIV82136.1|  60S ribosomal protein L18-A                           50.8    1e-05   
gb|EXX78031.1|  ribosomal 60S subunit protein L18A                    50.1    1e-05   
gb|KEP52729.1|  60S ribosomal protein L18                             50.4    1e-05   
gb|EUC57682.1|  60S ribosomal protein L18                             50.4    1e-05   
emb|CCF54530.1|  probable 60S ribosomal protein L18                   50.4    1e-05   
ref|XP_007722189.1|  large subunit ribosomal protein L18e             50.4    2e-05   
ref|XP_011387324.1|  ribosomal 60S subunit protein L18                50.4    2e-05   
emb|CDI57167.1|  probable 60S ribosomal protein L18                   50.4    2e-05   
dbj|GAC96920.1|  60S ribosomal protein L18                            52.0    2e-05   
ref|XP_009834317.1|  hypothetical protein H257_09702                  50.4    2e-05   
ref|XP_007879935.1|  hypothetical protein PFL1_04221                  50.4    2e-05   
ref|XP_008876054.1|  hypothetical protein H310_11242                  50.4    2e-05   
gb|ABD77152.1|  ribosomal protein L18                                 49.7    2e-05   
ref|XP_010786834.1|  PREDICTED: 60S ribosomal protein L18             50.1    2e-05   
gb|KDQ08824.1|  hypothetical protein BOTBODRAFT_37519                 50.1    2e-05   
ref|NP_001003432.1|  60S ribosomal protein L18                        50.1    2e-05   
gb|KIM67674.1|  hypothetical protein SCLCIDRAFT_13851                 50.1    2e-05   
gb|ESA23412.1|  hypothetical protein GLOINDRAFT_342179                50.1    2e-05   
gb|EPS29111.1|  hypothetical protein PDE_04060                        50.1    2e-05   
dbj|GAK64966.1|  60S ribosomal protein L18                            51.6    2e-05   
gb|KIK20716.1|  hypothetical protein PISMIDRAFT_576002                49.7    2e-05   
ref|XP_008055076.1|  PREDICTED: ribosomal protein L18-like            49.7    3e-05   
ref|XP_009543935.1|  hypothetical protein HETIRDRAFT_472767           49.7    3e-05   
ref|XP_008085192.1|  Ribosomal proteins L15p and L18e                 49.7    3e-05   
ref|XP_007268254.1|  60S ribosomal protein L18                        49.7    3e-05   
ref|XP_006157526.1|  PREDICTED: 60S ribosomal protein L18-like        50.4    3e-05   
ref|XP_007862613.1|  60S ribosomal protein L18                        49.7    3e-05   
gb|KIP09821.1|  hypothetical protein PHLGIDRAFT_18483                 49.7    3e-05   
ref|XP_007804599.1|  hypothetical protein EPUS_07572                  51.2    4e-05   
gb|EMD40971.1|  hypothetical protein CERSUDRAFT_80614                 49.3    4e-05   
ref|XP_007779084.1|  60S ribosomal protein L18-B                      49.3    4e-05   
gb|EPQ63217.1|  Protein component of the large (60S) ribosomal su...  48.5    4e-05   
gb|KIJ70376.1|  hypothetical protein HYDPIDRAFT_143674                49.3    4e-05   
gb|EST06100.1|  armadillo                                             49.3    4e-05   
ref|XP_011125411.1|  hypothetical protein AOL_s00112g79               49.3    4e-05   
ref|XP_007315262.1|  hypothetical protein SERLADRAFT_381487           49.3    4e-05   
gb|KJB26287.1|  hypothetical protein B456_004G239000                  49.7    4e-05   
gb|KFK23460.1|  hypothetical protein AALP_AAs61543U000100             48.1    4e-05   
gb|KIO03112.1|  hypothetical protein M404DRAFT_15806                  48.9    5e-05   
emb|CCO26541.1|  60S ribosomal protein L18-B                          48.9    5e-05   
ref|XP_007600381.1|  eukaryotic ribosomal protein L18                 49.7    5e-05   
gb|KIL00482.1|  hypothetical protein PAXRUDRAFT_821678                48.9    5e-05   
emb|CDM26905.1|  60S ribosomal protein L18-A                          48.9    5e-05   
gb|KIK42845.1|  hypothetical protein CY34DRAFT_804509                 48.9    5e-05   
ref|XP_009249236.1|  PREDICTED: 60S ribosomal protein L18             48.9    5e-05   
gb|KIJ19828.1|  hypothetical protein PAXINDRAFT_166053                48.9    5e-05   
ref|XP_004633481.1|  PREDICTED: translation initiation factor IF-...  50.8    5e-05   
gb|KIM25234.1|  hypothetical protein M408DRAFT_10585                  48.9    5e-05   
ref|XP_002901873.1|  60S ribosomal protein L18-2                      48.9    6e-05   
ref|XP_003710973.1|  60S ribosomal protein L18                        48.9    6e-05   
gb|EPZ37075.1|  60S ribosomal protein L18-2                           48.9    6e-05   
emb|CCF40156.1|  eukaryotic ribosomal protein L18                     48.9    6e-05   
ref|XP_007364417.1|  60S ribosomal protein L18                        48.9    6e-05   
emb|CCA75324.1|  probable ribosomal protein L18, cytosolic            48.9    6e-05   
ref|XP_001550924.1|  60S ribosomal protein L18                        48.9    6e-05   
gb|KDN61013.1|  putative eukaryotic ribosomal protein L18             48.9    6e-05   
emb|CDO74156.1|  hypothetical protein BN946_scf185043.g207            48.9    6e-05   
emb|CCU77907.1|  putative 60S ribosomal protein L18                   48.9    6e-05   
gb|KII96054.1|  hypothetical protein PLICRDRAFT_48977                 48.9    6e-05   
gb|EFQ34059.1|  eukaryotic ribosomal protein L18                      48.5    6e-05   
ref|XP_002558988.1|  Pc13g05540                                       48.5    6e-05   
gb|KIN06517.1|  hypothetical protein OIDMADRAFT_24819                 48.5    6e-05   
ref|XP_008891573.1|  hypothetical protein PPTG_02269                  48.9    7e-05   
gb|EMR82472.1|  putative 60s ribosomal protein l18 protein            48.9    7e-05   
ref|XP_009519518.1|  hypothetical protein PHYSODRAFT_284882           48.5    7e-05   
gb|AGG55290.1|  ribosomal protein L18                                 48.5    7e-05   
ref|XP_007392123.1|  hypothetical protein PHACADRAFT_181562           48.5    8e-05   
emb|CCQ18599.1|  60S ribosomal protein L18                            48.5    8e-05   
ref|XP_009158973.1|  50S ribosomal protein L18e                       48.5    8e-05   
ref|XP_007337843.1|  60S ribosomal protein L18-B                      48.5    8e-05   
ref|XP_003385450.1|  PREDICTED: 60S ribosomal protein L18-like        48.5    8e-05   
gb|KHJ35313.1|  putative 60s ribosomal protein l18                    48.1    9e-05   
ref|XP_009225814.1|  60S ribosomal protein L18                        48.1    9e-05   
gb|EKV10688.1|  Ribosomal protein L18                                 49.7    1e-04   
gb|EAW85356.1|  hCG1642440, isoform CRA_b                             47.0    1e-04   
gb|EAW85355.1|  hCG1642440, isoform CRA_a                             47.0    1e-04   
gb|KIL67232.1|  hypothetical protein M378DRAFT_22860                  48.1    1e-04   
ref|XP_005822438.1|  large subunit ribosomal protein L18e, cytopl...  48.1    1e-04   
gb|KIW61527.1|  hypothetical protein PV05_01638                       48.1    1e-04   
gb|KIY45967.1|  ribosomal protein L18e                                47.8    1e-04   
gb|AAS49582.1|  ribosomal protein L18                                 47.8    1e-04   
ref|NP_502655.1|  Protein RPL-18                                      47.8    1e-04   
ref|XP_009036910.1|  hypothetical protein AURANDRAFT_37496            48.1    1e-04   
gb|KFX94797.1|  hypothetical protein V490_04154                       47.0    1e-04   
gb|EPT03125.1|  hypothetical protein FOMPIDRAFT_1022488               47.8    1e-04   
gb|EJU06490.1|  60S ribosomal protein L18                             47.8    1e-04   



>ref|XP_008450608.1| PREDICTED: 60S ribosomal protein L18-2 [Cucumis melo]
Length=187

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+KGRKFERARGKRNSRGY+V
Sbjct  147  AVKHFGPAPGVPHSHSKPYVRSKGRKFERARGKRNSRGYRV  187



>ref|XP_004144773.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 ref|XP_004158733.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 gb|KGN60965.1| hypothetical protein Csa_2G032220 [Cucumis sativus]
Length=187

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARGKRNSRGY+V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRNSRGYRV  187



>ref|XP_008454015.1| PREDICTED: 60S ribosomal protein L18-3 [Cucumis melo]
Length=187

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARGKRNSRGY+V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRNSRGYRV  187



>ref|XP_010914484.1| PREDICTED: 60S ribosomal protein L18-3 [Elaeis guineensis]
Length=187

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHSR KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSRTKPYVRSKGRKFERARGRRNSRGFRV  187



>gb|KGN66048.1| hypothetical protein Csa_1G569250 [Cucumis sativus]
Length=244

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+KGRKFERARGKRNSRGY+V
Sbjct  204  AVKHFGPAPGVPHSHSKPYVRSKGRKFERARGKRNSRGYRV  244



>ref|XP_010528904.1| PREDICTED: 60S ribosomal protein L18-2 [Tarenaya hassleriana]
Length=187

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG+RNSRG+KV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFKV  187



>gb|KHN20393.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=274

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARGKRNSRG++V
Sbjct  234  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGFRV  274



>ref|NP_001236071.1| uncharacterized protein LOC100499789 [Glycine max]
 gb|ACU13660.1| unknown [Glycine max]
Length=187

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARGKRNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRNSRGFRV  187



>ref|XP_006344694.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARGKR SRGYKV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRKSRGYKV  187



>ref|XP_006359857.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVRAKGRKFERARGKRNSRGYKV
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYKV  187



>ref|XP_006444385.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 ref|XP_006479993.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR57625.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 gb|KDO87175.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
 gb|KDO87176.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
Length=187

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARGKRNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRNSRGFRV  187



>ref|XP_004135776.1| PREDICTED: uncharacterized protein LOC101207642 [Cucumis sativus]
 ref|XP_004169487.1| PREDICTED: uncharacterized protein LOC101228164 [Cucumis sativus]
Length=389

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+KGRKFERARGKRNSRGY+V
Sbjct  349  AVKHFGPAPGVPHSHSKPYVRSKGRKFERARGKRNSRGYRV  389



>ref|XP_002523106.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF39291.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=187

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>ref|XP_010088293.1| 60S ribosomal protein L18-3 [Morus notabilis]
 gb|EXB33518.1| 60S ribosomal protein L18-3 [Morus notabilis]
Length=197

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARGKRNSRG++V
Sbjct  157  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRNSRGFRV  197



>ref|XP_007163123.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
 gb|ESW35117.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
Length=187

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVRAKGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHSKPYVRAKGRKFERARGRRNSRGFRV  187



>ref|XP_010104147.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB98712.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=209

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARGKRNSRG++V
Sbjct  169  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRNSRGFRV  209



>ref|XP_010094463.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB56096.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=198

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARGKRNSRG++V
Sbjct  158  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRNSRGFRV  198



>ref|NP_001235897.1| uncharacterized protein LOC100527681 [Glycine max]
 gb|ACU16823.1| unknown [Glycine max]
Length=187

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>ref|XP_003554636.2| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
 gb|KHN43312.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=214

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG+RNSRG++V
Sbjct  174  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  214



>gb|KHN20252.1| 60S ribosomal protein L18-3, partial [Glycine soja]
Length=187

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>gb|KHN43503.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>ref|XP_004984437.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=187

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFE+ARG+RNSRG+KV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFEKARGRRNSRGFKV  187



>ref|XP_003556523.1| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
Length=187

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>ref|NP_001237789.1| uncharacterized protein LOC100500164 [Glycine max]
 gb|ACU15099.1| unknown [Glycine max]
 gb|KHN16096.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>gb|KHN03962.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV  187



>ref|XP_004495692.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFE+ARGKRNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFEKARGKRNSRGFRV  187



>gb|KCW85063.1| hypothetical protein EUGRSUZ_B01908 [Eucalyptus grandis]
Length=144

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  104  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  144



>gb|KJB41866.1| hypothetical protein B456_007G127300, partial [Gossypium raimondii]
Length=227

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG+RNS+G++V
Sbjct  187  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSKGFRV  227



>gb|KDP23459.1| hypothetical protein JCGZ_23292 [Jatropha curcas]
Length=187

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_010043043.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW85064.1| hypothetical protein EUGRSUZ_B01908 [Eucalyptus grandis]
Length=187

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_006433453.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 ref|XP_006472133.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR46693.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
Length=187

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>gb|KDP28183.1| hypothetical protein JCGZ_13954 [Jatropha curcas]
Length=187

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_010025256.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW61872.1| hypothetical protein EUGRSUZ_H04551 [Eucalyptus grandis]
Length=187

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_010313195.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum lycopersicum]
Length=187

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KPYVRAKGRKFERARGKR SRGYK
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGKRKSRGYK  186



>ref|XP_002461201.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
 gb|EER97722.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
Length=187

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|XP_002319502.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE95425.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFEKARGKRNSKGFRV  187



>ref|XP_004290808.1| PREDICTED: 60S ribosomal protein L18-2 [Fragaria vesca subsp. 
vesca]
Length=187

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARGKRNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSRGFRV  187



>ref|XP_002465302.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
 gb|EER92300.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
Length=187

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|XP_009151179.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  187



>emb|CDY36892.1| BnaC07g01080D [Brassica napus]
 emb|CDY05185.1| BnaC05g46180D [Brassica napus]
Length=60

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  20   AVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  60



>ref|XP_011036896.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KP+VRAKGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPFVRAKGRKFERARGRRNSRGFRV  187



>ref|NP_187210.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
 sp|P42791.2|RL182_ARATH RecName: Full=60S ribosomal protein L18-2 [Arabidopsis thaliana]
 gb|AAF26138.1|AC011620_14 putative 60S ribosomal protein L18 [Arabidopsis thaliana]
 gb|AAK59824.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AAL31164.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AEE74263.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
Length=187

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  187



>ref|XP_011079633.1| PREDICTED: 60S ribosomal protein L18-2-like [Sesamum indicum]
Length=187

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG+RNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSKGFRV  187



>ref|XP_004958675.1| PREDICTED: 60S ribosomal protein L18-3-like [Setaria italica]
Length=187

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>gb|AAA69928.1| cytoplasmic ribosomal protein L18 [Arabidopsis thaliana]
Length=187

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  187



>ref|XP_006382454.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93398.1| unknown [Populus trichocarpa]
 gb|ABK93783.1| unknown [Populus trichocarpa]
 gb|ERP60251.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KP+VRAKGRKFE+ARGKRNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPFVRAKGRKFEKARGKRNSRGFRV  187



>ref|XP_011079632.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
 ref|XP_011084062.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
Length=187

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG+RNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSKGFRV  187



>ref|XP_009796134.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+R SRGYKV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187



>gb|KJB41867.1| hypothetical protein B456_007G127300 [Gossypium raimondii]
Length=187

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG+RNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRRNSKGFRV  187



>ref|XP_009625475.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+R SRGYKV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187



>ref|XP_009772706.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
 ref|XP_009772708.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+R SRGYKV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187



>emb|CDY66803.1| BnaAnng22990D, partial [Brassica napus]
Length=200

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  160  AVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  200



>gb|ACF79980.1| unknown [Zea mays]
 tpg|DAA64100.1| TPA: hypothetical protein ZEAMMB73_909543 [Zea mays]
Length=91

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  51   AVRHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  91



>ref|NP_001236701.1| uncharacterized protein LOC100306301 [Glycine max]
 gb|ACU14418.1| unknown [Glycine max]
Length=187

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFERARG++NSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRAKGRKFERARGRKNSRGFRV  187



>gb|KIZ05100.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
 gb|KIZ07537.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
Length=187

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRGYK
Sbjct  147  AVKHFGPAPGVPHSSTKPYVRSKGRKFEKARGRRNSRGYK  186



>ref|XP_004247404.1| PREDICTED: 60S ribosomal protein L18-2 [Solanum lycopersicum]
Length=187

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF  A GVPHS  KPYVRAKGRKFERARGKRNSRGYK
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRAKGRKFERARGKRNSRGYK  186



>ref|XP_009129884.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=222

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  182  AVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKV  222



>emb|CDO98841.1| unnamed protein product [Coffea canephora]
Length=243

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRA GRKFERARG+RNSRG++V
Sbjct  203  AVKHFGPAPGVPHSHTKPYVRATGRKFERARGRRNSRGFRV  243



>gb|ACR35483.1| unknown [Zea mays]
 tpg|DAA64099.1| TPA: hypothetical protein ZEAMMB73_909543 [Zea mays]
Length=134

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  94   AVRHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  134



>ref|XP_009629074.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
 ref|XP_009788537.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=187

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP+VR+KGRKFERARG+RNSRGYK
Sbjct  147  AVKHFGPAPGVPHSHTKPFVRSKGRKFERARGRRNSRGYK  186



>gb|KJB23305.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=134

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+RNS+G++V
Sbjct  94   AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  134



>ref|XP_011015181.1| PREDICTED: 60S ribosomal protein L18-2-like, partial [Populus 
euphratica]
Length=126

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPY+R+KGRKFE+ARGKRNS+G++V
Sbjct  86   AVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKRNSKGFRV  126



>ref|XP_007144959.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
 gb|ESW16953.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
Length=187

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRRNSRGFRV  187



>emb|CDX74138.1| BnaA03g29090D [Brassica napus]
Length=213

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  173  AVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  213



>gb|AGV54741.1| 60S ribosomal protein L18-3-like protein [Phaseolus vulgaris]
Length=222

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  182  AVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGRRNSRGFRV  222



>ref|XP_002976425.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
 gb|EFJ22685.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187



>ref|XP_009124870.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  187



>ref|NP_001050069.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|ABF95861.1| 60S ribosomal protein L18, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11983.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|EEC75232.1| hypothetical protein OsI_11506 [Oryza sativa Indica Group]
 gb|EEE59035.1| hypothetical protein OsJ_10788 [Oryza sativa Japonica Group]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNS+G+KV
Sbjct  147  AVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRRNSKGFKV  187



>gb|EPS67068.1| hypothetical protein M569_07709, partial [Genlisea aurea]
Length=186

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF PA GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  146  AVRHFGPAPGVPHSSTKPYVRSKGRKFERARGRRNSRGFRV  186



>ref|XP_002985888.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
 gb|EFJ13065.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187



>ref|XP_007147006.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
 gb|ESW19000.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGRRNSRGFRV  187



>ref|XP_007050975.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
 gb|EOX95132.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
Length=180

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+RNS+G++V
Sbjct  140  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  180



>ref|XP_009134833.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  187



>ref|XP_007050976.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
 gb|EOX95133.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
Length=186

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+RNS+G++V
Sbjct  146  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  186



>ref|XP_008370417.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_009338229.1| PREDICTED: 60S ribosomal protein L18-2-like [Pyrus x bretschneideri]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_006288739.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
 gb|EOA21637.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRAKGRKFE+ARG+R SRG+KV
Sbjct  147  AVKHFGPAPGVPHSSTKPYVRAKGRKFEKARGRRKSRGFKV  187



>emb|CDP17112.1| unnamed protein product [Coffea canephora]
Length=234

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+ GRKFERARG+RNSRG++V
Sbjct  194  AVKHFGPAPGVPHSNTKPYVRSSGRKFERARGRRNSRGFRV  234



>ref|XP_009335702.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
 ref|XP_009335725.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_008388515.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_006658116.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNS+G+KV
Sbjct  147  AVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRRNSKGFKV  187



>ref|XP_006650060.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNS+G+KV
Sbjct  147  AVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRRNSKGFKV  187



>ref|XP_007050974.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
 gb|EOX95131.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+RNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  187



>ref|XP_008369026.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008345218.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008355492.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>gb|KJB23303.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+RNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  187



>ref|XP_008386678.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>gb|ADD54595.1| putative ribosomal protein L18 [Linum usitatissimum]
Length=154

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  114  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  154



>ref|XP_007031040.1| Ribosomal protein L18 [Theobroma cacao]
 gb|EOY11542.1| Ribosomal protein L18 [Theobroma cacao]
Length=187

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+RNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSKGFRV  187



>ref|NP_001131538.1| uncharacterized protein LOC100192878 [Zea mays]
 gb|ACG24841.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG31936.1| 60S ribosomal protein L18 [Zea mays]
 tpg|DAA64098.1| TPA: ribosomal protein L18 [Zea mays]
Length=187

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVRHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|NP_001060617.1| Os07g0674700 [Oryza sativa Japonica Group]
 dbj|BAC83538.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAD31974.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAF22531.1| Os07g0674700 [Oryza sativa Japonica Group]
 gb|EAZ05118.1| hypothetical protein OsI_27311 [Oryza sativa Indica Group]
 dbj|BAG89915.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67806.1| hypothetical protein OsJ_25556 [Oryza sativa Japonica Group]
Length=195

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNS+G+KV
Sbjct  155  AVKHFGPAPGVPHSNTKPYVRSKGRKFEKARGRRNSKGFKV  195



>ref|XP_007205962.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
 ref|XP_008245548.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ07161.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
Length=187

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_007201344.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
 ref|XP_008235116.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ02543.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
Length=187

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_002512455.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF49907.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=403

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  363  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  403



>ref|XP_008775991.1| PREDICTED: 60S ribosomal protein L18-2 [Phoenix dactylifera]
Length=187

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187



>ref|XP_006386732.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
 gb|ERP64529.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
Length=184

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPY+R+KGRKFE+ARGKRNS+G++V
Sbjct  144  AVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKRNSKGFRV  184



>ref|XP_010497850.1| PREDICTED: 60S ribosomal protein L18-2-like, partial [Camelina 
sativa]
Length=64

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVRA GRKFERARG+R SRG+KV
Sbjct  24   AVKHFGPAPGVPHSHTKPYVRADGRKFERARGRRKSRGFKV  64



>ref|XP_002301485.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE80758.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPY+R+KGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_009630920.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF PA GVPHS  KPYVR+KGRKFERARG+R SRGYKV
Sbjct  147  AVRHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187



>ref|XP_010931680.1| PREDICTED: 60S ribosomal protein L18-2 [Elaeis guineensis]
Length=187

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187



>ref|XP_011042004.1| PREDICTED: 60S ribosomal protein L18-2-like [Populus euphratica]
Length=187

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPY+R+KGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_002320999.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93820.1| unknown [Populus trichocarpa]
 gb|EEE99314.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPY+R+KGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYIRSKGRKFEKARGKRNSKGFRV  187



>ref|XP_009783807.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF PA GVPHS  KPYVR+KGRKFERARG+R SRGYKV
Sbjct  147  AVRHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGYKV  187



>ref|XP_010546736.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+R SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187



>ref|NP_001266634.1| uncharacterized protein LOC101027163 [Zea mays]
 gb|ACG37525.1| hypothetical protein [Zea mays]
Length=91

 Score = 67.4 bits (163),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF P  GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  51   AVRHFGPTPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  91



>emb|CDY18813.1| BnaAnng02780D [Brassica napus]
Length=249

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  209  AVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  249



>ref|XP_010544997.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+R SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187



>ref|XP_010524859.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+R SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187



>ref|XP_010523956.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+R SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187



>ref|XP_010559185.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFERARG+R SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  187



>emb|CDY05183.1| BnaC05g46200D [Brassica napus]
Length=223

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  183  AVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  223



>gb|KJB82633.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=134

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR++GRKFERARG+RNS+G++V
Sbjct  94   AVKHFGPAPGVPHSHTKPYVRSRGRKFERARGRRNSKGFRV  134



>gb|ABK92688.1| unknown [Populus trichocarpa]
Length=187

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPH   KPYVRAKGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHGHTKPYVRAKGRKFEKARGKRNSKGFRV  187



>gb|AFK49563.1| unknown [Lotus japonicus]
Length=187

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEMARGKRNSKGFRV  187



>gb|KJB22517.1| hypothetical protein B456_004G052100 [Gossypium raimondii]
Length=134

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+ GRKFERARG+RNS+G++V
Sbjct  94   AVKHFGPAPGVPHSHTKPYVRSNGRKFERARGRRNSKGFRV  134



>gb|EYU21621.1| hypothetical protein MIMGU_mgv1a014504mg [Erythranthe guttata]
Length=187

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF PA GVPHS  KPYVR+KGRKFE+ARGKRNS+G++V
Sbjct  147  AVRHFGPAPGVPHSHTKPYVRSKGRKFEKARGKRNSKGFRV  187



>gb|KFK26512.1| hypothetical protein AALP_AA8G258600 [Arabis alpina]
Length=187

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+KGRKFE+ARG+R SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGRRKSRGFKV  187



>gb|KFK37967.1| hypothetical protein AALP_AA3G053100 [Arabis alpina]
Length=187

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+KGRKFE+ARG+R SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGRRKSRGFKV  187



>gb|KJB82634.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=184

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR++GRKFERARG+RNS+G++V
Sbjct  144  AVKHFGPAPGVPHSHTKPYVRSRGRKFERARGRRNSKGFRV  184



>gb|KJB82632.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=187

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR++GRKFERARG+RNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSRGRKFERARGRRNSKGFRV  187



>ref|NP_198137.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
 sp|Q940B0.1|RL183_ARATH RecName: Full=60S ribosomal protein L18-3 [Arabidopsis thaliana]
 gb|AAL07220.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAM67529.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAN31854.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AED93736.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
Length=187

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR KGRKFE+ARGKR SRG+KV
Sbjct  147  AVKHFGPAPGVPHSNTKPYVRHKGRKFEKARGKRKSRGFKV  187



>ref|XP_010674074.1| PREDICTED: 60S ribosomal protein L18-2 [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVRA GRKFERARG+RNSRGY+V
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRANGRKFERARGRRNSRGYRV  187



>gb|KJB45330.1| hypothetical protein B456_007G301700 [Gossypium raimondii]
Length=187

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRK+ERARG+RNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKYERARGRRNSKGFRV  187



>ref|XP_010684349.1| PREDICTED: 60S ribosomal protein L18-2-like [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVRA GRKFERARG+RNSRGY+V
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRANGRKFERARGRRNSRGYRV  187



>ref|XP_002874343.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50602.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
Length=187

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR KGRKFE+ARGKR SRG+KV
Sbjct  147  AVKHFGPAPGVPHSSTKPYVRHKGRKFEKARGKRKSRGFKV  187



>gb|KHF98574.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
 gb|KJB22518.1| hypothetical protein B456_004G052100 [Gossypium raimondii]
Length=187

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+ GRKFERARG+RNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSNGRKFERARGRRNSKGFRV  187



>ref|XP_006408052.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
 gb|ESQ49505.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
Length=187

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR+ GRKFE+ARGKR SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHSKPYVRSTGRKFEKARGKRKSRGFKV  187



>ref|XP_010421566.1| PREDICTED: 60S ribosomal protein L18-2-like [Camelina sativa]
Length=187

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR KGRKFE+ARG+R SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHSKPYVRGKGRKFEKARGRRKSRGFKV  187



>gb|AFK45456.1| unknown [Lotus japonicus]
Length=187

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+ GRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSNGRKFEKARGKRNSKGFRV  187



>ref|XP_002882427.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58686.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVR KGRKFE+ARG+R SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHSKPYVRGKGRKFEKARGRRKSRGFKV  187



>emb|CDY05559.1| BnaA02g31320D [Brassica napus]
Length=503

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS +KPYVRAKGRKFE+ARGKR SRG+K+
Sbjct  182  AVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFKL  222



>ref|XP_009411663.1| PREDICTED: 60S ribosomal protein L18-3-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGKAPGVPHSNTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_010259492.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_005843726.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
 gb|EFN51624.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
Length=187

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVP S AKPYVRAKGRKFERARG+R SRGYK
Sbjct  147  AVKHFGPAPGVPGSTAKPYVRAKGRKFERARGRRKSRGYK  186



>ref|XP_006828669.1| hypothetical protein AMTR_s00129p00125840, partial [Amborella 
trichopoda]
 gb|ERM96085.1| hypothetical protein AMTR_s00129p00125840, partial [Amborella 
trichopoda]
Length=52

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  12   AVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  52



>ref|XP_010269589.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_002270635.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>emb|CDY19736.1| BnaA09g03890D [Brassica napus]
Length=215

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  175  AVKHFGKAPGVPHSHTKPYVRAKGRKFEKARGKRKSRGFKV  215



>gb|KHG07157.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=207

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+K RKFERARG+RNS+G++V
Sbjct  167  AVKHFGPAPGVPHSHTKPYVRSKARKFERARGRRNSKGFRV  207



>ref|XP_009381102.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_009629121.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
Length=187

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVRAKGRKFERARGKR SRG+KV
Sbjct  147  AVKHFGRAPGVPHSHTKPYVRAKGRKFERARGKRKSRGFKV  187



>ref|XP_009611670.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVRAKGRKFERARGKR SRG+KV
Sbjct  147  AVKHFGRAPGVPHSHTKPYVRAKGRKFERARGKRKSRGFKV  187



>ref|XP_008810211.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGLAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_002271179.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_010659657.1| PREDICTED: 60S ribosomal protein L18-2-like [Vitis vinifera]
 emb|CAN65685.1| hypothetical protein VITISV_022459 [Vitis vinifera]
Length=187

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_006855263.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
 gb|ERN16730.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
Length=187

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  187



>ref|XP_009111741.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRAKGRKFEKARGKRKSRGFKV  187



>emb|CDX99969.1| BnaC09g03320D [Brassica napus]
Length=210

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVRAKGRKFE+ARGKR SRG+KV
Sbjct  170  AVKHFGKAPGVPHSHTKPYVRAKGRKFEKARGKRKSRGFKV  210



>sp|O65729.1|RL18_CICAR RecName: Full=60S ribosomal protein L18, partial [Cicer arietinum]
 emb|CAA06246.1| ribosomal protein L18 [Cicer arietinum]
Length=183

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+R SRG++V
Sbjct  143  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV  183



>emb|CBI39539.3| unnamed protein product [Vitis vinifera]
Length=249

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  209  AVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  249



>ref|XP_010455078.1| PREDICTED: 60S ribosomal protein L18-2-like isoform X2 [Camelina 
sativa]
Length=134

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR +GRKFE+ARG+R SRG+KV
Sbjct  94   AVKHFGPAPGVPHSHTKPYVRGRGRKFEKARGRRKSRGFKV  134



>gb|ACF81873.1| unknown [Zea mays]
 gb|AFW77277.1| hypothetical protein ZEAMMB73_917876 [Zea mays]
Length=91

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  51   AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  91



>gb|ABD36585.1| putative 60S ribosomal protein L18, partial [Saccharum hybrid 
cultivar]
Length=105

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  65   AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  105



>ref|XP_004494578.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+R SRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV  187



>ref|XP_011023716.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVRAKGRKFE+ARGKRNS+G++V
Sbjct  147  AVKHFGRAPGVPHSHTKPYVRAKGRKFEKARGKRNSKGFRV  187



>ref|XP_004494383.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+R SRG++V
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV  187



>emb|CBI36879.3| unnamed protein product [Vitis vinifera]
Length=297

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  257  AVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  297



>ref|XP_010550998.1| PREDICTED: 60S ribosomal protein L18-2-like isoform X2 [Tarenaya 
hassleriana]
Length=157

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR  GRKFERARG+R SRG+KV
Sbjct  117  AVKHFGPAPGVPHSHTKPYVRYTGRKFERARGRRKSRGFKV  157



>emb|CBI22977.3| unnamed protein product [Vitis vinifera]
Length=254

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG++V
Sbjct  214  AVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV  254



>gb|ACF83096.1| unknown [Zea mays]
 gb|AFW81441.1| hypothetical protein ZEAMMB73_288952 [Zea mays]
 gb|AFW81442.1| hypothetical protein ZEAMMB73_288952 [Zea mays]
Length=134

 Score = 65.5 bits (158),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  94   AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  134



>ref|XP_010455077.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Camelina 
sativa]
Length=187

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR +GRKFE+ARG+R SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRGRGRKFEKARGRRKSRGFKV  187



>emb|CDY25018.1| BnaC02g39900D [Brassica napus]
Length=197

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS +KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  157  AVKHFGLAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  197



>ref|XP_003568896.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=188

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  148  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>gb|EMT18368.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=188

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  148  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>dbj|BAJ90421.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88976.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  148  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>emb|CDX80616.1| BnaC07g28280D [Brassica napus]
Length=232

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS +KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  192  AVKHFGLAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  232



>ref|NP_001054688.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|AAV32218.1| cytoplasmic ribosomal protein L18 [Oryza sativa Japonica Group]
 dbj|BAF16602.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|EAY96610.1| hypothetical protein OsI_18515 [Oryza sativa Indica Group]
 gb|ABR25945.1| 60S ribosomal protein l18 [Oryza sativa Indica Group]
 dbj|BAG88175.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00211.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62383.1| hypothetical protein OsJ_17172 [Oryza sativa Japonica Group]
Length=188

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  148  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>ref|XP_003562459.1| PREDICTED: 60S ribosomal protein L18-3-like [Brachypodium distachyon]
Length=187

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVRHFGAAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|NP_001132852.1| uncharacterized protein LOC100194344 [Zea mays]
 gb|ACG24961.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG34787.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG39589.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACR34137.1| unknown [Zea mays]
 gb|AFW77275.1| ribosomal protein L18 [Zea mays]
 gb|AFW81439.1| ribosomal protein L18 [Zea mays]
 gb|AGS43131.1| hypothetical protein [Zea mays]
Length=187

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|XP_004977069.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=188

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  148  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>gb|AFC88838.1| 60S ribosomal protein L18-like protein [Miscanthus sinensis]
Length=188

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  148  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>ref|XP_002439318.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
 gb|EES17748.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
Length=188

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  148  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>gb|EMS45435.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=187

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|XP_008656150.1| PREDICTED: 60S ribosomal protein L18-3-like [Zea mays]
Length=222

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  182  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  222



>ref|XP_006654064.1| PREDICTED: 60S ribosomal protein L18-2-like [Oryza brachyantha]
Length=188

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  148  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  188



>ref|XP_008784768.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187



>gb|EMT12638.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=187

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>gb|AFC88843.1| 60S ribosomal protein L18-3-like protein, partial [Miscanthus 
sinensis]
Length=166

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRG  197
            AVKHF PA GVPHS  KPYVR+KGRKFE+ARG+RNSRG
Sbjct  129  AVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRG  166



>ref|XP_009630742.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPY+ +KGRKFERARG R SRGYKV
Sbjct  147  AVKHFGPAPGVPHSHTKPYMHSKGRKFERARGIRKSRGYKV  187



>ref|XP_010550997.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Tarenaya 
hassleriana]
Length=187

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR  GRKFERARG+R SRG+KV
Sbjct  147  AVKHFGPAPGVPHSHTKPYVRYTGRKFERARGRRKSRGFKV  187



>ref|XP_010228645.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=187

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  187



>ref|XP_010938374.1| PREDICTED: 60S ribosomal protein L18-2-like [Elaeis guineensis]
Length=187

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  187



>ref|XP_009384409.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPY+R+KGRKFERARG+RNSRG++V
Sbjct  147  AVRHFGKAPGVPHSHTKPYIRSKGRKFERARGRRNSRGFRV  187



>ref|XP_009402513.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRK+ERARG+RNSRG++V
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRSKGRKYERARGRRNSRGFRV  187



>emb|CDY40718.1| BnaC03g34340D [Brassica napus]
Length=227

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS +KPYVR+KGRKFE+ARGKR SRG+KV
Sbjct  187  AVKHFGRAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKV  227



>gb|ABR23470.1| 60s ribosomal protein L18 [Ornithodoros parkeri]
Length=188

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            A +HF PA GVPHS  KPYVR+KGRKFERARG+R SRG+KV
Sbjct  148  ACRHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFKV  188



>dbj|BAJ93091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  172  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFKV  212



>gb|AAX48850.1| L18 [Suberites domuncula]
Length=187

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS +KPYVR+KGRKFERARG+RNS+G+KV
Sbjct  147  AVRHFGRAPGVPHSHSKPYVRSKGRKFERARGRRNSKGFKV  187



>ref|XP_002948325.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ50732.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=187

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVP S  KPYVRAKGRKFE+ARG+R SRG+KV
Sbjct  147  AVKHFGPAPGVPGSTTKPYVRAKGRKFEKARGRRKSRGFKV  187



>ref|XP_010273829.1| PREDICTED: 60S ribosomal protein L18-2-like [Nelumbo nucifera]
Length=187

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGY  194
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+RNSRG+
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRNSRGF  185



>ref|XP_002400316.1| ribosomal protein L18, putative [Ixodes scapularis]
 gb|EEC15787.1| ribosomal protein L18, putative [Ixodes scapularis]
Length=188

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            A +HF PA GVPHS  KPYVR+KGRKFERARG+R SRGYK
Sbjct  148  ACRHFGPAPGVPHSHTKPYVRSKGRKFERARGRRKSRGYK  187



>emb|CAJ17292.1| ribosomal protein L18e [Cicindela campestris]
Length=118

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP+VR+KGRKFERARG+R S GYK
Sbjct  78   AVKHFGPAPGVPHSHTKPFVRSKGRKFERARGRRKSCGYK  117



>ref|XP_006394935.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
 gb|ESQ32221.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
Length=230

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFE+ARG+R SRG+KV
Sbjct  190  AVKHFGLAPGVPHSNTKPYVRSKGRKFEKARGRRKSRGFKV  230



>ref|XP_006298641.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
 gb|EOA31539.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
Length=134

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR KGRKFE+ARGKR SRG+KV
Sbjct  94   AVKHFGLAPGVPHSDTKPYVRHKGRKFEKARGKRKSRGFKV  134



>ref|XP_009775352.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=173

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GV HS  KPYVRAKGRKFERARGKR SRG+KV
Sbjct  133  AVKHFGRAPGVSHSHTKPYVRAKGRKFERARGKRKSRGFKV  173



>pdb|3J61|Q Chain Q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50985.1| ribosomal protein L18 [Triticum aestivum]
Length=188

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ RG+RNSRG+KV
Sbjct  148  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKVRGRRNSRGFKV  188



>ref|XP_006298640.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
 gb|EOA31538.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
Length=187

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR KGRKFE+ARGKR SRG+KV
Sbjct  147  AVKHFGLAPGVPHSDTKPYVRHKGRKFEKARGKRKSRGFKV  187



>ref|XP_010464086.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR KGRKFE+ARGKR SRG+KV
Sbjct  147  AVKHFGLAPGVPHSDTKPYVRHKGRKFEKARGKRKSRGFKV  187



>ref|XP_010429374.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR KGRKFE+ARGKR SRG+KV
Sbjct  147  AVKHFGLAPGVPHSDTKPYVRHKGRKFEKARGKRKSRGFKV  187



>gb|ACN41161.1| unknown [Picea sitchensis]
Length=134

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRK+E ARG+RNSRG+KV
Sbjct  94   AVKHFGRAPGVPHSHTKPYVRSKGRKYEMARGRRNSRGFKV  134



>ref|XP_010486014.1| PREDICTED: 60S ribosomal protein L18-3 [Camelina sativa]
Length=187

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR KGRKFE+ARGKR SRG+KV
Sbjct  147  AVKHFGLAPGVPHSDTKPYVRHKGRKFEKARGKRKSRGFKV  187



>ref|XP_011351685.1| PREDICTED: 60S ribosomal protein L18 [Cerapachys biroi]
 gb|EZA61183.1| 60S ribosomal protein L18 [Cerapachys biroi]
Length=188

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            +VKHF PA GVPHS +KPYVR+KGRKFERARG+R S GYK
Sbjct  148  SVKHFGPAPGVPHSHSKPYVRSKGRKFERARGRRRSCGYK  187



>ref|XP_009417724.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+R SRG++V
Sbjct  147  AVKHFGKAPGVPHSHTKPYVRSKGRKFERARGRRKSRGFRV  187



>gb|ABK21809.1| unknown [Picea sitchensis]
 gb|ABK26564.1| unknown [Picea sitchensis]
Length=187

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRK+E ARG+RNSRG+KV
Sbjct  147  AVKHFGRAPGVPHSHTKPYVRSKGRKYEMARGRRNSRGFKV  187



>gb|ABK22247.1| unknown [Picea sitchensis]
Length=187

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRK+E ARG+RNSRG+KV
Sbjct  147  AVKHFGRAPGVPHSHTKPYVRSKGRKYEMARGRRNSRGFKV  187



>ref|XP_011255380.1| PREDICTED: 60S ribosomal protein L18 [Camponotus floridanus]
 gb|EFN68908.1| 60S ribosomal protein L18 [Camponotus floridanus]
Length=188

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            +VKHF PA GVPHS +KPYVR+KGRKFERARG+R S GYK
Sbjct  148  SVKHFGPAPGVPHSHSKPYVRSKGRKFERARGRRRSCGYK  187



>gb|ABK26318.1| unknown [Picea sitchensis]
Length=187

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRK+E ARG+RNSRG+KV
Sbjct  147  AVKHFGRAPGVPHSHTKPYVRSKGRKYEMARGRRNSRGFKV  187



>gb|EMS65848.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=229

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG+K
Sbjct  154  AVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFK  193



>ref|XP_010921627.1| PREDICTED: uncharacterized protein LOC105045157 [Elaeis guineensis]
Length=398

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  358  AVKHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  398



>ref|XP_008789961.1| PREDICTED: uncharacterized protein LOC103707302 [Phoenix dactylifera]
Length=988

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFE+ARG+RNSRG++V
Sbjct  948  AVKHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV  988



>sp|Q4GXG7.1|RL18_TIMBA RecName: Full=60S ribosomal protein L18 [Timarcha balearica]
 emb|CAJ17295.1| ribosomal protein L18e [Timarcha balearica]
Length=188

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS AKP VR+KGRKFERARG+R S GYK
Sbjct  148  AVKHFGPAPGVPHSHAKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_001690885.1| ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 ref|XP_010832938.1| PREDICTED: 60S ribosomal protein L18-2-like [Bison bison bison]
 gb|EDP05331.1| ribosomal protein L18 [Chlamydomonas reinhardtii]
Length=187

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            A KHF PA GVP S  KPYVRAKGRKFE+ARG+R SRG+KV
Sbjct  147  ACKHFGPAPGVPGSTTKPYVRAKGRKFEKARGRRKSRGFKV  187



>emb|CAJ17294.1| ribosomal protein L18e [Hister sp. APV-2005]
Length=188

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP+VR+KGRKFERARG+R S GYK
Sbjct  148  AVKHFGPAPGVPHSHTKPFVRSKGRKFERARGRRRSCGYK  187



>gb|AGI03919.1| 60S ribosomal protein L18-like protein, partial [Leptinotarsa 
decemlineata]
Length=99

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP VR+KGRKFERARG+R S GYK
Sbjct  59   AVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRKSCGYK  98



>ref|XP_968042.1| PREDICTED: 60S ribosomal protein L18 [Tribolium castaneum]
 gb|EFA00786.1| hypothetical protein TcasGA2_TC003672 [Tribolium castaneum]
Length=188

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP+VR KGRKFERARG+R S GYK
Sbjct  148  AVKHFGPAPGVPHSHTKPFVRTKGRKFERARGRRRSCGYK  187



>ref|XP_008547226.1| PREDICTED: 60S ribosomal protein L18-like [Microplitis demolitor]
Length=188

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS AKP VR+KGRKFERARG+R S GYK
Sbjct  148  AVKHFGPAPGVPHSHAKPLVRSKGRKFERARGRRFSCGYK  187



>emb|CDJ38394.1| 60S ribosomal protein L18, putative [Eimeria tenella]
Length=90

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            A KHF PA G PHS  KPYVR+KGRKFE ARG+R SRGYK
Sbjct  50   ADKHFGPAPGTPHSHTKPYVRSKGRKFEMARGRRKSRGYK  89



>sp|Q56FG8.1|RL18_LYSTE RecName: Full=60S ribosomal protein L18 [Lysiphlebus testaceipes]
 gb|AAX62434.1| ribosomal protein L18 [Lysiphlebus testaceipes]
Length=188

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP VR+KGRKFERARG+R S GYK
Sbjct  148  AVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRKSCGYK  187



>ref|XP_008546759.1| PREDICTED: 60S ribosomal protein L18 [Microplitis demolitor]
Length=188

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP VR+KGRKFERARG+R S GYK
Sbjct  148  AVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>gb|ADV03044.1| ribosomal protein L18 [Amphidinium carterae]
Length=187

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  304  KHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            KHF  A GVPHS  KPY+RAKGRKFE+ARG+R SRGYKV
Sbjct  149  KHFGKAPGVPHSSTKPYLRAKGRKFEKARGRRKSRGYKV  187



>ref|XP_009012591.1| hypothetical protein HELRODRAFT_156470 [Helobdella robusta]
 gb|ESO09498.1| hypothetical protein HELRODRAFT_156470 [Helobdella robusta]
Length=188

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            A +HF  A GVPHS  KPYVRAKGRKFERARG+R SRGYK
Sbjct  148  AYRHFGLAPGVPHSHTKPYVRAKGRKFERARGRRKSRGYK  187



>ref|XP_008201914.1| PREDICTED: 60S ribosomal protein L18 [Nasonia vitripennis]
Length=188

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP VR+KGRKFERARG+R S GYK
Sbjct  148  AVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_011313252.1| PREDICTED: 60S ribosomal protein L18 [Fopius arisanus]
Length=188

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP VR+KGRKFERARG+R S GYK
Sbjct  148  AVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_001781485.1| predicted protein [Physcomitrella patens]
 gb|EDQ53665.1| predicted protein [Physcomitrella patens]
Length=186

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVP S AKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVKHF-GAPGVPQSHAKPYVRSKGRKFEKARGRRNSRGFKV  186



>ref|XP_011497333.1| PREDICTED: 60S ribosomal protein L18 [Ceratosolen solmsi marchali]
Length=188

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP VR+KGRKFERARG+R S GYK
Sbjct  148  AVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_006561192.1| PREDICTED: 60S ribosomal protein L18-like [Apis mellifera]
 ref|XP_006622209.1| PREDICTED: 60S ribosomal protein L18-like [Apis dorsata]
Length=188

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP VR+KGRKFERARG+R S GYK
Sbjct  148  AVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_003691391.1| PREDICTED: 60S ribosomal protein L18-like [Apis florea]
Length=188

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP VR+KGRKFERARG+R S GYK
Sbjct  148  AVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  187



>ref|XP_001760902.1| predicted protein [Physcomitrella patens]
 gb|EDQ74291.1| predicted protein [Physcomitrella patens]
Length=186

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVP S AKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVKHF-GAPGVPQSHAKPYVRSKGRKFEKARGRRNSRGFKV  186



>gb|KJE95959.1| ribosomal protein L18e [Capsaspora owczarzaki ATCC 30864]
Length=209

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVP S  KPYVR+KGRKFE+ARG+R SRGYKV
Sbjct  169  AVKHFGAAPGVPKSTTKPYVRSKGRKFEKARGRRASRGYKV  209



>ref|XP_001751734.1| predicted protein [Physcomitrella patens]
 gb|EDQ83169.1| predicted protein [Physcomitrella patens]
Length=186

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVP S AKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVKHF-GAPGVPQSHAKPYVRSKGRKFEKARGRRNSRGFKV  186



>ref|XP_001785869.1| predicted protein [Physcomitrella patens]
 gb|EDQ49322.1| predicted protein [Physcomitrella patens]
Length=186

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVP S AKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVKHF-GAPGVPQSHAKPYVRSKGRKFEKARGRRNSRGFKV  186



>gb|EYU46738.1| hypothetical protein MIMGU_mgv1a014520mg [Erythranthe guttata]
Length=187

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AV+HF  A GVPHS  KPYVR+KGRKFE+ARG+R SRG++V
Sbjct  147  AVRHFGAAPGVPHSHTKPYVRSKGRKFEKARGRRKSRGFRV  187



>ref|XP_004345091.2| ribosomal protein L18e [Capsaspora owczarzaki ATCC 30864]
Length=186

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVP S  KPYVR+KGRKFE+ARG+R SRGYKV
Sbjct  146  AVKHFGAAPGVPKSTTKPYVRSKGRKFEKARGRRASRGYKV  186



>ref|XP_003707499.1| PREDICTED: 60S ribosomal protein L18-like [Megachile rotundata]
Length=218

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP VR+KGRKFERARG+R S GYK
Sbjct  178  AVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  217



>gb|KDR14978.1| 60S ribosomal protein L18 [Zootermopsis nevadensis]
Length=188

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF  A GVPHS  KPYVR+KGRKFERARG+R S GYK
Sbjct  148  AVKHFGLAPGVPHSHTKPYVRSKGRKFERARGRRRSCGYK  187



>emb|CDI82997.1| 60S ribosomal protein L18, putative [Eimeria acervulina]
Length=186

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  304  KHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            KHF PA G PHS  KPYVR+KGRKFE ARG+R SRGYK
Sbjct  148  KHFGPAPGTPHSHTKPYVRSKGRKFEMARGRRKSRGYK  185



>ref|XP_003485273.1| PREDICTED: hypothetical protein LOC100746406 [Bombus impatiens]
Length=400

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP VR+KGRKFERARG+R S GYK
Sbjct  360  AVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  399



>ref|XP_003393579.1| PREDICTED: hypothetical protein LOC100643724 [Bombus terrestris]
Length=409

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF PA GVPHS  KP VR+KGRKFERARG+R S GYK
Sbjct  369  AVKHFGPAPGVPHSHTKPLVRSKGRKFERARGRRRSCGYK  408



>ref|XP_001745439.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90017.1| predicted protein [Monosiga brevicollis MX1]
Length=185

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVPHS  KPYVR+KGRKFE+ARG+R SRGYKV
Sbjct  146  AVKHF-GAPGVPHSHVKPYVRSKGRKFEKARGRRASRGYKV  185



>emb|CAJ17293.1| ribosomal protein L18e [Eucinetus sp. APV-2005]
Length=108

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            AVKHF  A GVPHS  KP+VR+KGRKFERARG+R S GYK
Sbjct  68   AVKHFGQAPGVPHSHTKPFVRSKGRKFERARGRRRSCGYK  107



>ref|XP_001760959.1| predicted protein [Physcomitrella patens]
 gb|EDQ74348.1| predicted protein [Physcomitrella patens]
Length=186

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A GVP S AKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVKHF-GAPGVPRSHAKPYVRSKGRKFEKARGRRNSRGFKV  186



>ref|XP_002130217.1| PREDICTED: 60S ribosomal protein L18 isoform X1 [Ciona intestinalis]
 ref|XP_004226452.1| PREDICTED: 60S ribosomal protein L18 isoform X2 [Ciona intestinalis]
Length=188

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  304  KHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            KHF  A GVPHS  KPYVR+KGRKFERARG+R+S+G+KV
Sbjct  150  KHFGKAPGVPHSHTKPYVRSKGRKFERARGRRHSKGFKV  188



>ref|XP_003081305.1| ribosomal protein L18 (ISS) [Ostreococcus tauri]
Length=181

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A G+P S AKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  142  AVKHF-GAPGIPGSHAKPYVRSKGRKFEKARGRRNSRGFKV  181



>emb|CBI40138.3| unnamed protein product [Vitis vinifera]
Length=128

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV*VHFHTCQWEVS  152
            AVKHF  A GVPHS  KPYV +KGRKFERARG+RN+R  +  + +   Q++++
Sbjct  48   AVKHFGKAPGVPHSHTKPYVLSKGRKFERARGRRNNRVSRFDLSYSFLQYKLN  100



>emb|CEF99132.1| Ribosomal protein L18e, conserved site [Ostreococcus tauri]
Length=186

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF  A G+P S AKPYVR+KGRKFE+ARG+RNSRG+KV
Sbjct  147  AVKHF-GAPGIPGSHAKPYVRSKGRKFEKARGRRNSRGFKV  186



>gb|EJW88057.1| 50S ribosomal protein L18 [Wuchereria bancrofti]
Length=190

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            A +HF PA GVPHS  KP VR+KGRKFERARG+R SRGY+
Sbjct  150  AERHFGPAPGVPHSHTKPLVRSKGRKFERARGRRKSRGYR  189



>gb|ABC25103.1| ribosomal protein L18 [Glossina morsitans morsitans]
Length=136

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            A KHF  A GVPHS  +PYVR+KGRKFERARG+R+S GYK
Sbjct  96   ACKHFGKAPGVPHSHTRPYVRSKGRKFERARGRRSSCGYK  135



>ref|XP_011351645.1| PREDICTED: 60S ribosomal protein L18-like [Cerapachys biroi]
 gb|EZA61166.1| 60S ribosomal protein L18 [Cerapachys biroi]
Length=188

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            +VKHF  A GVPHS  KPYVR+KGRKFERARG+R S GYK
Sbjct  148  SVKHFGLAPGVPHSHTKPYVRSKGRKFERARGRRRSCGYK  187



>ref|XP_001897286.1| 60S ribosomal protein L18 [Brugia malayi]
 emb|CDP94037.1| Protein BM-RPL-18, isoform a [Brugia malayi]
Length=188

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            A +HF PA GVPHS  KP VR+KGRKFERARG+R SRGY+
Sbjct  148  AERHFGPAPGVPHSHTKPLVRSKGRKFERARGRRKSRGYR  187



>ref|XP_011062886.1| PREDICTED: 60S ribosomal protein L18 [Acromyrmex echinatior]
 gb|EGI60312.1| 60S ribosomal protein L18 [Acromyrmex echinatior]
Length=232

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYK  191
            +VKHF  A GVPHS  KPYVR+KGRKFERARG+R S GYK
Sbjct  192  SVKHFGLAPGVPHSHTKPYVRSKGRKFERARGRRRSCGYK  231



>ref|NP_566104.1| putative 60S ribosomal protein L18-1 [Arabidopsis thaliana]
 ref|NP_001189771.1| putative 60S ribosomal protein L18-1 [Arabidopsis thaliana]
 gb|AAC62853.2| 60S ribosomal protein L18, 5'partial [Arabidopsis thaliana]
 gb|AEC10859.1| putative 60S ribosomal protein L18-1 [Arabidopsis thaliana]
 gb|AEC10860.1| putative 60S ribosomal protein L18-1 [Arabidopsis thaliana]
Length=135

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  310  AVKHFVPAAGVPHSRAKPYVRAKGRKFERARGKRNSRGYKV  188
            AVKHF PA GVPHS  KPYVR  G+K E ARG+R SRG+KV
Sbjct  95   AVKHFGPAPGVPHSHTKPYVRQTGKKIEIARGRRRSRGFKV  135



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556888308225