BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF048M11

Length=610
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004237549.1|  PREDICTED: lysine-specific demethylase JMJ25...    226   2e-64   Solanum lycopersicum
ref|XP_006340029.1|  PREDICTED: uncharacterized protein LOC102601654    224   3e-64   Solanum tuberosum [potatoes]
ref|XP_009781661.1|  PREDICTED: lysine-specific demethylase JMJ25...    224   6e-64   Nicotiana sylvestris
ref|XP_009630740.1|  PREDICTED: lysine-specific demethylase JMJ25...    222   3e-63   Nicotiana tomentosiformis
gb|EPS68030.1|  hypothetical protein M569_06743                         202   1e-61   Genlisea aurea
ref|XP_010655918.1|  PREDICTED: lysine-specific demethylase JMJ25...    218   2e-61   Vitis vinifera
ref|XP_010655917.1|  PREDICTED: lysine-specific demethylase JMJ25...    217   3e-61   Vitis vinifera
ref|XP_010275975.1|  PREDICTED: lysine-specific demethylase JMJ25...    217   3e-61   Nelumbo nucifera [Indian lotus]
emb|CBI29042.3|  unnamed protein product                                215   6e-61   Vitis vinifera
ref|XP_010275976.1|  PREDICTED: lysine-specific demethylase JMJ25...    216   6e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010275974.1|  PREDICTED: lysine-specific demethylase JMJ25...    216   6e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010263984.1|  PREDICTED: LOW QUALITY PROTEIN: lysine-speci...    204   7e-61   
ref|XP_010418217.1|  PREDICTED: lysine-specific demethylase JMJ25...    203   9e-61   Camelina sativa [gold-of-pleasure]
ref|XP_011465839.1|  PREDICTED: LOW QUALITY PROTEIN: lysine-speci...    210   2e-60   Fragaria vesca subsp. vesca
ref|XP_008224709.1|  PREDICTED: uncharacterized protein LOC103324...    209   5e-59   Prunus mume [ume]
ref|XP_008224707.1|  PREDICTED: uncharacterized protein LOC103324...    209   5e-59   Prunus mume [ume]
emb|CDP19052.1|  unnamed protein product                                210   5e-59   Coffea canephora [robusta coffee]
emb|CBI24025.3|  unnamed protein product                                208   5e-59   Vitis vinifera
ref|XP_007214653.1|  hypothetical protein PRUPE_ppa002063mg             207   5e-59   
ref|XP_010069331.1|  PREDICTED: lysine-specific demethylase JMJ25...    209   6e-59   Eucalyptus grandis [rose gum]
ref|XP_010648866.1|  PREDICTED: lysine-specific demethylase JMJ25...    210   6e-59   Vitis vinifera
ref|XP_010648865.1|  PREDICTED: lysine-specific demethylase JMJ25...    210   7e-59   Vitis vinifera
ref|XP_009365722.1|  PREDICTED: lysine-specific demethylase JMJ25...    209   1e-58   Pyrus x bretschneideri [bai li]
ref|XP_004497219.1|  PREDICTED: uncharacterized protein LOC101510...    209   2e-58   Cicer arietinum [garbanzo]
gb|KDO52715.1|  hypothetical protein CISIN_1g006745mg                   204   2e-58   Citrus sinensis [apfelsine]
ref|XP_008371063.1|  PREDICTED: uncharacterized protein LOC103434...    207   3e-58   
ref|XP_008371061.1|  PREDICTED: uncharacterized protein LOC103434...    206   3e-58   
ref|XP_011022030.1|  PREDICTED: lysine-specific demethylase JMJ25...    208   3e-58   Populus euphratica
ref|XP_009357483.1|  PREDICTED: lysine-specific demethylase JMJ25...    206   4e-58   Pyrus x bretschneideri [bai li]
ref|XP_009357482.1|  PREDICTED: lysine-specific demethylase JMJ25...    206   4e-58   Pyrus x bretschneideri [bai li]
ref|XP_009357484.1|  PREDICTED: lysine-specific demethylase JMJ25...    206   4e-58   Pyrus x bretschneideri [bai li]
ref|XP_008238007.1|  PREDICTED: uncharacterized protein LOC103336696    206   4e-58   
ref|XP_006604040.1|  PREDICTED: uncharacterized protein LOC100780...    207   5e-58   Glycine max [soybeans]
emb|CBI23201.3|  unnamed protein product                                204   6e-58   Vitis vinifera
ref|XP_010524259.1|  PREDICTED: lysine-specific demethylase JMJ25...    206   6e-58   Tarenaya hassleriana [spider flower]
ref|XP_010524176.1|  PREDICTED: lysine-specific demethylase JMJ25...    206   6e-58   Tarenaya hassleriana [spider flower]
ref|XP_008232371.1|  PREDICTED: uncharacterized protein LOC103331520    208   7e-58   Prunus mume [ume]
ref|XP_007210952.1|  hypothetical protein PRUPE_ppa024079mg             206   8e-58   
ref|XP_010655371.1|  PREDICTED: lysine-specific demethylase JMJ25...    205   1e-57   
ref|XP_006584086.1|  PREDICTED: uncharacterized protein LOC100797860    205   1e-57   Glycine max [soybeans]
ref|XP_008373436.1|  PREDICTED: uncharacterized protein LOC103436763    204   1e-57   
ref|XP_008384091.1|  PREDICTED: uncharacterized protein LOC103446...    205   1e-57   
ref|XP_008384090.1|  PREDICTED: uncharacterized protein LOC103446...    205   1e-57   
emb|CDP04436.1|  unnamed protein product                                207   1e-57   Coffea canephora [robusta coffee]
ref|XP_010099167.1|  Lysine-specific demethylase 3B                     204   1e-57   Morus notabilis
ref|XP_002518433.1|  conserved hypothetical protein                     206   1e-57   
ref|XP_006417283.1|  hypothetical protein EUTSA_v10006772mg             204   1e-57   Eutrema salsugineum [saltwater cress]
gb|KEH42474.1|  transcription factor jumonji (JmjC) domain protein      204   1e-57   Medicago truncatula
ref|XP_009592859.1|  PREDICTED: lysine-specific demethylase JMJ25...    206   2e-57   Nicotiana tomentosiformis
ref|XP_009769192.1|  PREDICTED: lysine-specific demethylase JMJ25...    206   2e-57   Nicotiana sylvestris
ref|XP_009392239.1|  PREDICTED: lysine-specific demethylase JMJ25...    206   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009592864.1|  PREDICTED: lysine-specific demethylase JMJ25...    206   2e-57   Nicotiana tomentosiformis
ref|XP_007142780.1|  hypothetical protein PHAVU_007G016300g             206   2e-57   Phaseolus vulgaris [French bean]
ref|XP_009592863.1|  PREDICTED: lysine-specific demethylase JMJ25...    206   2e-57   
ref|XP_009592860.1|  PREDICTED: lysine-specific demethylase JMJ25...    206   2e-57   Nicotiana tomentosiformis
ref|XP_007142779.1|  hypothetical protein PHAVU_007G016300g             205   2e-57   Phaseolus vulgaris [French bean]
ref|XP_010473447.1|  PREDICTED: lysine-specific demethylase JMJ25...    204   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009392240.1|  PREDICTED: lysine-specific demethylase JMJ25...    206   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009110682.1|  PREDICTED: uncharacterized protein LOC103836196    204   2e-57   Brassica rapa
ref|XP_011460015.1|  PREDICTED: lysine-specific demethylase JMJ25...    204   2e-57   Fragaria vesca subsp. vesca
ref|XP_011460014.1|  PREDICTED: lysine-specific demethylase JMJ25...    204   2e-57   Fragaria vesca subsp. vesca
ref|XP_009592861.1|  PREDICTED: lysine-specific demethylase JMJ25...    205   2e-57   Nicotiana tomentosiformis
ref|XP_006484521.1|  PREDICTED: uncharacterized protein LOC102628262    206   2e-57   Citrus sinensis [apfelsine]
ref|XP_006437606.1|  hypothetical protein CICLE_v10030567mg             206   2e-57   Citrus clementina [clementine]
emb|CDY21024.1|  BnaA08g25010D                                          204   2e-57   Brassica napus [oilseed rape]
gb|EYU27724.1|  hypothetical protein MIMGU_mgv1a000745mg                204   3e-57   Erythranthe guttata [common monkey flower]
ref|XP_009592868.1|  PREDICTED: lysine-specific demethylase JMJ25...    204   3e-57   Nicotiana tomentosiformis
ref|XP_009386690.1|  PREDICTED: lysine-specific demethylase JMJ25...    204   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007026157.1|  Transcription factor jumonji domain-containi...    203   4e-57   
ref|XP_003610469.1|  Lysine-specific demethylase 3A-B                   203   5e-57   
ref|XP_007022717.1|  Transcription factor jumonji domain-containi...    202   5e-57   
ref|XP_009592858.1|  PREDICTED: lysine-specific demethylase JMJ25...    205   5e-57   
ref|XP_003619259.1|  Lysine-specific demethylase 3A-B                   202   6e-57   
ref|XP_004507665.1|  PREDICTED: uncharacterized protein LOC101492686    203   6e-57   
gb|KDP37515.1|  hypothetical protein JCGZ_05954                         204   6e-57   Jatropha curcas
ref|XP_011099649.1|  PREDICTED: lysine-specific demethylase JMJ25...    204   6e-57   Sesamum indicum [beniseed]
gb|KDO78327.1|  hypothetical protein CISIN_1g002333mg                   202   7e-57   Citrus sinensis [apfelsine]
ref|XP_008805590.1|  PREDICTED: uncharacterized protein LOC103718...    203   7e-57   Phoenix dactylifera
ref|XP_008805589.1|  PREDICTED: uncharacterized protein LOC103718...    203   7e-57   Phoenix dactylifera
ref|XP_008805587.1|  PREDICTED: uncharacterized protein LOC103718...    203   7e-57   
ref|XP_009592866.1|  PREDICTED: lysine-specific demethylase JMJ25...    203   8e-57   Nicotiana tomentosiformis
gb|KJB81461.1|  hypothetical protein B456_013G146800                    201   8e-57   Gossypium raimondii
ref|XP_006467395.1|  PREDICTED: uncharacterized protein LOC102618...    202   9e-57   
gb|KDP20708.1|  hypothetical protein JCGZ_21179                         199   9e-57   Jatropha curcas
ref|XP_010430273.1|  PREDICTED: lysine-specific demethylase JMJ25...    202   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010244125.1|  PREDICTED: lysine-specific demethylase JMJ25...    202   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010678589.1|  PREDICTED: lysine-specific demethylase JMJ25...    204   1e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB81463.1|  hypothetical protein B456_013G146800                    201   1e-56   Gossypium raimondii
ref|NP_172659.3|  transcription factor jumonji (jmjC) domain-cont...    201   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892666.1|  transcription factor jumonji domain-containi...    201   2e-56   
ref|XP_010052876.1|  PREDICTED: lysine-specific demethylase JMJ25...    202   2e-56   Eucalyptus grandis [rose gum]
ref|XP_006449783.1|  hypothetical protein CICLE_v10014405mg             200   2e-56   
ref|XP_009357718.1|  PREDICTED: lysine-specific demethylase JMJ25...    201   2e-56   Pyrus x bretschneideri [bai li]
ref|XP_011081460.1|  PREDICTED: lysine-specific demethylase JMJ25...    203   2e-56   
ref|XP_011081459.1|  PREDICTED: lysine-specific demethylase JMJ25...    203   2e-56   
ref|XP_009357780.1|  PREDICTED: lysine-specific demethylase JMJ25...    201   2e-56   Pyrus x bretschneideri [bai li]
gb|KJB81462.1|  hypothetical protein B456_013G146800                    201   2e-56   Gossypium raimondii
emb|CDY19538.1|  BnaC09g13650D                                          201   3e-56   Brassica napus [oilseed rape]
ref|XP_009113089.1|  PREDICTED: uncharacterized protein LOC103838...    201   3e-56   Brassica rapa
ref|XP_010052875.1|  PREDICTED: lysine-specific demethylase JMJ25...    202   3e-56   Eucalyptus grandis [rose gum]
emb|CDY31229.1|  BnaC08g15240D                                          201   3e-56   Brassica napus [oilseed rape]
ref|XP_010533793.1|  PREDICTED: lysine-specific demethylase JMJ25       201   3e-56   Tarenaya hassleriana [spider flower]
gb|AES62955.2|  transcription factor jumonji (JmjC) domain protein      202   3e-56   Medicago truncatula
ref|XP_009596947.1|  PREDICTED: LOW QUALITY PROTEIN: lysine-speci...    203   3e-56   
ref|XP_010052874.1|  PREDICTED: lysine-specific demethylase JMJ25...    202   4e-56   Eucalyptus grandis [rose gum]
gb|KJB49978.1|  hypothetical protein B456_008G148100                    202   4e-56   Gossypium raimondii
gb|KJB49979.1|  hypothetical protein B456_008G148100                    202   4e-56   Gossypium raimondii
ref|XP_007022716.1|  Transcription factor jumonji domain-containi...    202   4e-56   
gb|KHN32999.1|  Lysine-specific demethylase 3B                          199   5e-56   Glycine soja [wild soybean]
ref|XP_007022715.1|  Transcription factor jumonji domain-containi...    202   5e-56   
gb|AFW63900.1|  putative jumonji-like transcription factor family...    192   5e-56   
ref|XP_006598342.1|  PREDICTED: uncharacterized protein LOC100801772    200   5e-56   
ref|XP_010686791.1|  PREDICTED: lysine-specific demethylase JMJ25...    200   7e-56   
gb|KHN37375.1|  Lysine-specific demethylase 3B                          202   8e-56   Glycine soja [wild soybean]
ref|XP_010913412.1|  PREDICTED: lysine-specific demethylase JMJ25       199   9e-56   
ref|XP_003535763.1|  PREDICTED: uncharacterized protein LOC100805...    201   1e-55   Glycine max [soybeans]
ref|XP_006304678.1|  hypothetical protein CARUB_v10011915mg             199   1e-55   Capsella rubella
ref|XP_011095986.1|  PREDICTED: lysine-specific demethylase JMJ25...    201   1e-55   Sesamum indicum [beniseed]
ref|XP_011095987.1|  PREDICTED: lysine-specific demethylase JMJ25...    201   1e-55   Sesamum indicum [beniseed]
ref|XP_007153986.1|  hypothetical protein PHAVU_003G081400g             199   1e-55   Phaseolus vulgaris [French bean]
ref|XP_011095985.1|  PREDICTED: lysine-specific demethylase JMJ25...    201   1e-55   Sesamum indicum [beniseed]
ref|XP_004954498.1|  PREDICTED: lysine-specific demethylase 3A-li...    195   1e-55   
gb|EYU23675.1|  hypothetical protein MIMGU_mgv1a020177mg                197   1e-55   Erythranthe guttata [common monkey flower]
ref|XP_011469248.1|  PREDICTED: LOW QUALITY PROTEIN: lysine-speci...    201   2e-55   Fragaria vesca subsp. vesca
ref|XP_006847841.1|  hypothetical protein AMTR_s00029p00058780          194   2e-55   
gb|AES98174.2|  transcription factor jumonji (JmjC) domain protein      198   2e-55   Medicago truncatula
gb|KHF99180.1|  Lysine-specific demethylase 3A                          200   2e-55   Gossypium arboreum [tree cotton]
ref|XP_010233682.1|  PREDICTED: lysine-specific demethylase JMJ25...    200   2e-55   Brachypodium distachyon [annual false brome]
ref|XP_010032501.1|  PREDICTED: lysine-specific demethylase JMJ25...    199   2e-55   Eucalyptus grandis [rose gum]
ref|NP_001050423.1|  Os03g0430400                                       193   2e-55   
ref|XP_009123381.1|  PREDICTED: uncharacterized protein LOC103848...    198   3e-55   Brassica rapa
gb|EYU40205.1|  hypothetical protein MIMGU_mgv1a000930mg                198   4e-55   Erythranthe guttata [common monkey flower]
ref|XP_009395410.1|  PREDICTED: lysine-specific demethylase JMJ25...    197   4e-55   
ref|XP_010100868.1|  Lysine-specific demethylase 3A                     200   4e-55   
ref|XP_010252491.1|  PREDICTED: lysine-specific demethylase JMJ25...    198   4e-55   
ref|XP_008347084.1|  PREDICTED: trichohyalin-like                       197   4e-55   
ref|XP_008811219.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    200   6e-55   
ref|XP_002307161.2|  hypothetical protein POPTR_0005s09360g             199   7e-55   
emb|CDP01722.1|  unnamed protein product                                199   8e-55   Coffea canephora [robusta coffee]
ref|XP_010688672.1|  PREDICTED: lysine-specific demethylase JMJ25...    197   8e-55   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS68622.1|  hypothetical protein M569_06146                         195   9e-55   Genlisea aurea
ref|XP_009773361.1|  PREDICTED: lysine-specific demethylase JMJ25...    199   9e-55   Nicotiana sylvestris
ref|XP_004954497.1|  PREDICTED: lysine-specific demethylase 3A-li...    194   1e-54   Setaria italica
ref|XP_006348210.1|  PREDICTED: uncharacterized protein LOC102601383    199   1e-54   Solanum tuberosum [potatoes]
ref|XP_011002578.1|  PREDICTED: lysine-specific demethylase JMJ25...    198   1e-54   Populus euphratica
ref|XP_008803158.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    199   1e-54   Phoenix dactylifera
ref|XP_010940352.1|  PREDICTED: lysine-specific demethylase JMJ25...    198   1e-54   
gb|AAC17616.1|  Contains similarity to box helicases gb|U29097 fr...    196   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010233683.1|  PREDICTED: lysine-specific demethylase JMJ25...    197   1e-54   Brachypodium distachyon [annual false brome]
ref|XP_004308619.1|  PREDICTED: lysine-specific demethylase JMJ25...    196   1e-54   Fragaria vesca subsp. vesca
ref|XP_004486316.1|  PREDICTED: uncharacterized protein LOC101504299    196   1e-54   Cicer arietinum [garbanzo]
gb|KHG27938.1|  Lysine-specific demethylase 3B                          196   1e-54   Gossypium arboreum [tree cotton]
ref|XP_009773362.1|  PREDICTED: lysine-specific demethylase JMJ25...    198   1e-54   Nicotiana sylvestris
ref|XP_010940351.1|  PREDICTED: lysine-specific demethylase JMJ25...    198   2e-54   
ref|XP_010493582.1|  PREDICTED: lysine-specific demethylase JMJ25...    196   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010940350.1|  PREDICTED: lysine-specific demethylase JMJ25...    198   2e-54   Elaeis guineensis
ref|XP_010493568.1|  PREDICTED: lysine-specific demethylase JMJ25...    196   2e-54   Camelina sativa [gold-of-pleasure]
gb|KJB34769.1|  hypothetical protein B456_006G082600                    196   2e-54   Gossypium raimondii
gb|AES62954.2|  transcription factor jumonji (JmjC) domain protein      197   2e-54   Medicago truncatula
ref|XP_007220059.1|  hypothetical protein PRUPE_ppa026232mg             195   2e-54   
ref|XP_010935549.1|  PREDICTED: lysine-specific demethylase JMJ25...    198   2e-54   Elaeis guineensis
gb|EYU33540.1|  hypothetical protein MIMGU_mgv1a002212mg                194   3e-54   Erythranthe guttata [common monkey flower]
ref|XP_010458615.1|  PREDICTED: lysine-specific demethylase JMJ25...    195   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_004954496.1|  PREDICTED: lysine-specific demethylase 3A-li...    194   3e-54   Setaria italica
ref|XP_010476145.1|  PREDICTED: lysine-specific demethylase JMJ25...    195   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_004954495.1|  PREDICTED: lysine-specific demethylase 3A-li...    194   3e-54   Setaria italica
dbj|BAD22935.1|  putative DNA-binding protein PD3, chloroplast          195   4e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006423930.1|  hypothetical protein CICLE_v10030129mg             194   5e-54   
ref|XP_004233782.1|  PREDICTED: lysine-specific demethylase JMJ25...    197   5e-54   Solanum lycopersicum
gb|EEC74293.1|  hypothetical protein OsI_09545                          196   6e-54   Oryza sativa Indica Group [Indian rice]
ref|NP_001048603.1|  Os02g0828900                                       196   6e-54   
gb|EEE58101.1|  hypothetical protein OsJ_08976                          195   6e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003537382.1|  PREDICTED: uncharacterized protein LOC100808...    196   6e-54   Glycine max [soybeans]
ref|XP_009614455.1|  PREDICTED: lysine-specific demethylase JMJ25...    196   7e-54   Nicotiana tomentosiformis
ref|XP_009801360.1|  PREDICTED: lysine-specific demethylase JMJ25...    196   8e-54   Nicotiana sylvestris
emb|CDP11593.1|  unnamed protein product                                194   9e-54   Coffea canephora [robusta coffee]
ref|XP_006480383.1|  PREDICTED: uncharacterized protein LOC102609204    193   1e-53   
ref|XP_007043268.1|  Transcription factor jumonji domain-containi...    196   1e-53   
ref|XP_007043267.1|  Transcription factor jumonji domain-containi...    196   1e-53   
gb|KDP27278.1|  hypothetical protein JCGZ_21009                         196   1e-53   Jatropha curcas
ref|XP_008680032.1|  PREDICTED: uncharacterized protein LOC103654986    194   1e-53   Zea mays [maize]
gb|AFW63902.1|  putative jumonji-like transcription factor family...    195   1e-53   
ref|XP_006407817.1|  hypothetical protein EUTSA_v10020080mg             193   1e-53   
ref|XP_010107786.1|  Lysine-specific demethylase 3B                     196   1e-53   
ref|XP_003614288.1|  Lysine-specific demethylase 3B                     193   2e-53   
ref|XP_009123380.1|  PREDICTED: uncharacterized protein LOC103848...    193   2e-53   Brassica rapa
ref|XP_007022639.1|  Transcription factor jumonji domain-containi...    194   2e-53   
ref|XP_003576493.2|  PREDICTED: lysine-specific demethylase JMJ25...    193   2e-53   Brachypodium distachyon [annual false brome]
ref|XP_007022640.1|  Transcription factor jumonji domain-containi...    194   2e-53   
ref|XP_006650227.1|  PREDICTED: uncharacterized protein LOC102706...    192   2e-53   
ref|XP_006650228.1|  PREDICTED: uncharacterized protein LOC102706...    192   2e-53   
ref|XP_011021911.1|  PREDICTED: lysine-specific demethylase JMJ25...    195   3e-53   Populus euphratica
ref|XP_011021910.1|  PREDICTED: lysine-specific demethylase JMJ25...    195   3e-53   Populus euphratica
gb|EYU21033.1|  hypothetical protein MIMGU_mgv1a019315mg                185   3e-53   Erythranthe guttata [common monkey flower]
ref|XP_008677146.1|  PREDICTED: putative jumonji-like transcripti...    194   3e-53   Zea mays [maize]
ref|XP_011021912.1|  PREDICTED: lysine-specific demethylase JMJ25...    194   4e-53   Populus euphratica
gb|KJB31857.1|  hypothetical protein B456_005G211300                    193   4e-53   Gossypium raimondii
gb|EEC75532.1|  hypothetical protein OsI_12150                          192   4e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_006604048.1|  PREDICTED: lysine-specific demethylase 3B-li...    191   4e-53   
gb|ABF96755.1|  jmjC domain containing protein, expressed               193   5e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010506391.1|  PREDICTED: lysine-specific demethylase JMJ25...    187   5e-53   Camelina sativa [gold-of-pleasure]
gb|ABF96756.1|  jmjC domain containing protein, expressed               193   6e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004168323.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    192   6e-53   
ref|XP_008463115.1|  PREDICTED: uncharacterized protein LOC103501341    192   7e-53   Cucumis melo [Oriental melon]
ref|XP_002453143.1|  hypothetical protein SORBIDRAFT_04g000775          191   7e-53   
ref|XP_004150127.1|  PREDICTED: uncharacterized protein LOC101221956    192   8e-53   
ref|XP_004301534.1|  PREDICTED: lysine-specific demethylase JMJ25...    191   9e-53   Fragaria vesca subsp. vesca
dbj|BAK04490.1|  predicted protein                                      189   1e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009784763.1|  PREDICTED: lysine-specific demethylase JMJ25...    192   1e-52   Nicotiana sylvestris
ref|XP_009784765.1|  PREDICTED: lysine-specific demethylase JMJ25...    192   1e-52   Nicotiana sylvestris
ref|XP_011015684.1|  PREDICTED: lysine-specific demethylase JMJ25...    192   1e-52   Populus euphratica
gb|KHN01091.1|  Lysine-specific demethylase 3B                          192   1e-52   Glycine soja [wild soybean]
gb|KHN23225.1|  Lysine-specific demethylase 3B                          190   2e-52   Glycine soja [wild soybean]
gb|EMT12717.1|  Lysine-specific demethylase 3B                          192   2e-52   
ref|XP_004956737.1|  PREDICTED: uncharacterized protein LOC101782484    191   2e-52   Setaria italica
gb|KHG20930.1|  Lysine-specific demethylase 3B                          191   2e-52   Gossypium arboreum [tree cotton]
dbj|BAJ94488.1|  predicted protein                                      190   3e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010688669.1|  PREDICTED: lysine-specific demethylase JMJ25...    192   3e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH42473.1|  transcription factor jumonji (JmjC) domain protein      190   3e-52   Medicago truncatula
ref|XP_010688671.1|  PREDICTED: lysine-specific demethylase JMJ25...    192   3e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009765347.1|  PREDICTED: lysine-specific demethylase JMJ25...    189   3e-52   Nicotiana sylvestris
ref|XP_006604041.1|  PREDICTED: uncharacterized protein LOC100780...    191   3e-52   Glycine max [soybeans]
ref|XP_009622213.1|  PREDICTED: lysine-specific demethylase JMJ25...    191   3e-52   Nicotiana tomentosiformis
ref|XP_006360372.1|  PREDICTED: uncharacterized protein LOC102592630    189   3e-52   Solanum tuberosum [potatoes]
ref|NP_001146639.1|  putative jumonji-like transcription factor f...    181   4e-52   
ref|XP_007153397.1|  hypothetical protein PHAVU_003G0315000g            188   4e-52   Phaseolus vulgaris [French bean]
ref|XP_002453089.1|  hypothetical protein SORBIDRAFT_04g038170          191   4e-52   
ref|XP_011046984.1|  PREDICTED: uncharacterized protein LOC105141...    192   4e-52   Populus euphratica
ref|XP_009765350.1|  PREDICTED: lysine-specific demethylase JMJ25...    188   5e-52   Nicotiana sylvestris
gb|EMS49877.1|  Lysine-specific demethylase 3B                          191   5e-52   Triticum urartu
ref|XP_010648867.1|  PREDICTED: lysine-specific demethylase JMJ25...    191   5e-52   Vitis vinifera
ref|XP_007147691.1|  hypothetical protein PHAVU_006G146500g             189   5e-52   Phaseolus vulgaris [French bean]
tpg|DAA50229.1|  TPA: putative jumonji-like transcription factor ...    190   6e-52   
ref|XP_002520404.1|  conserved hypothetical protein                     190   7e-52   
ref|XP_010518064.1|  PREDICTED: lysine-specific demethylase JMJ25...    189   8e-52   
ref|XP_011101207.1|  PREDICTED: LOW QUALITY PROTEIN: lysine-speci...    190   1e-51   Sesamum indicum [beniseed]
ref|XP_008665049.1|  PREDICTED: uncharacterized protein LOC103643...    189   1e-51   Zea mays [maize]
ref|XP_004982480.1|  PREDICTED: uncharacterized protein LOC101776595    188   1e-51   
ref|XP_008665051.1|  PREDICTED: uncharacterized protein LOC103643...    189   1e-51   Zea mays [maize]
ref|XP_008665050.1|  PREDICTED: uncharacterized protein LOC103643...    189   1e-51   Zea mays [maize]
ref|XP_003592704.1|  Lysine-specific demethylase 3B                     189   2e-51   
ref|XP_002306344.2|  hypothetical protein POPTR_0005s08460g             189   2e-51   
gb|KDP30574.1|  hypothetical protein JCGZ_16953                         189   3e-51   Jatropha curcas
ref|XP_006296905.1|  hypothetical protein CARUB_v10012897mg             187   4e-51   Capsella rubella
ref|XP_004247948.2|  PREDICTED: lysine-specific demethylase JMJ25...    188   4e-51   
ref|XP_002462335.1|  hypothetical protein SORBIDRAFT_02g024010          184   4e-51   
ref|XP_010238030.1|  PREDICTED: lysine-specific demethylase JMJ25...    186   6e-51   
ref|XP_010238028.1|  PREDICTED: lysine-specific demethylase JMJ25...    186   6e-51   
ref|XP_010238029.1|  PREDICTED: lysine-specific demethylase JMJ25...    186   6e-51   
ref|XP_010508274.1|  PREDICTED: lysine-specific demethylase JMJ25...    187   7e-51   Camelina sativa [gold-of-pleasure]
gb|EYU23669.1|  hypothetical protein MIMGU_mgv1a026774mg                185   7e-51   Erythranthe guttata [common monkey flower]
ref|XP_010508275.1|  PREDICTED: lysine-specific demethylase JMJ25...    187   7e-51   Camelina sativa [gold-of-pleasure]
gb|KHN23092.1|  Lysine-specific demethylase 3B                          187   9e-51   Glycine soja [wild soybean]
gb|KJB69248.1|  hypothetical protein B456_011G012300                    187   9e-51   Gossypium raimondii
gb|KDO78330.1|  hypothetical protein CISIN_1g002333mg                   186   9e-51   Citrus sinensis [apfelsine]
gb|EEE56156.1|  hypothetical protein OsJ_05054                          186   1e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007220601.1|  hypothetical protein PRUPE_ppa001348mg             185   1e-50   
emb|CBI23011.3|  unnamed protein product                                188   1e-50   Vitis vinifera
emb|CDY32031.1|  BnaA03g60350D                                          186   1e-50   Brassica napus [oilseed rape]
ref|XP_010662857.1|  PREDICTED: uncharacterized protein LOC100247074    188   1e-50   Vitis vinifera
gb|KDO78334.1|  hypothetical protein CISIN_1g002333mg                   184   1e-50   Citrus sinensis [apfelsine]
ref|XP_004232586.1|  PREDICTED: lysine-specific demethylase JMJ25...    185   1e-50   Solanum lycopersicum
ref|XP_002865521.1|  hypothetical protein ARALYDRAFT_331156             186   1e-50   
gb|KDO78332.1|  hypothetical protein CISIN_1g002333mg                   184   2e-50   Citrus sinensis [apfelsine]
ref|XP_002466851.1|  hypothetical protein SORBIDRAFT_01g015210          186   2e-50   
emb|CDY08639.1|  BnaC04g19480D                                          185   2e-50   Brassica napus [oilseed rape]
ref|XP_006449784.1|  hypothetical protein CICLE_v10014405mg             184   2e-50   
ref|XP_010686790.1|  PREDICTED: lysine-specific demethylase JMJ25...    185   2e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH36924.1|  transcription factor jumonji (JmjC) domain protein      184   2e-50   Medicago truncatula
gb|KFK36435.1|  hypothetical protein AALP_AA4G123900                    184   2e-50   Arabis alpina [alpine rockcress]
emb|CDY28031.1|  BnaC05g44330D                                          184   2e-50   Brassica napus [oilseed rape]
gb|KHG27646.1|  Lysine-specific demethylase 3B                          183   2e-50   Gossypium arboreum [tree cotton]
gb|KDO78331.1|  hypothetical protein CISIN_1g002333mg                   185   2e-50   Citrus sinensis [apfelsine]
gb|KDO78328.1|  hypothetical protein CISIN_1g002333mg                   185   2e-50   Citrus sinensis [apfelsine]
ref|NP_176421.1|  transcription factor jumonji domain-containing ...    184   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006467391.1|  PREDICTED: uncharacterized protein LOC102618...    185   2e-50   
ref|XP_007043269.1|  Transcription factor jumonji domain-containi...    186   2e-50   
gb|KDO78329.1|  hypothetical protein CISIN_1g002333mg                   185   2e-50   Citrus sinensis [apfelsine]
ref|XP_006467394.1|  PREDICTED: uncharacterized protein LOC102618...    185   2e-50   
ref|XP_006648215.1|  PREDICTED: uncharacterized protein LOC102700407    185   2e-50   
ref|XP_006467390.1|  PREDICTED: uncharacterized protein LOC102618...    185   2e-50   
ref|XP_006467392.1|  PREDICTED: uncharacterized protein LOC102618...    185   2e-50   
gb|KDO52714.1|  hypothetical protein CISIN_1g006745mg                   182   2e-50   
ref|XP_006467389.1|  PREDICTED: uncharacterized protein LOC102618...    185   3e-50   
ref|XP_006467393.1|  PREDICTED: uncharacterized protein LOC102618...    185   3e-50   
ref|XP_008233138.1|  PREDICTED: uncharacterized protein LOC103332...    185   3e-50   
ref|XP_008233137.1|  PREDICTED: uncharacterized protein LOC103332...    185   3e-50   
ref|NP_187418.1|  histone H3mK9 demethylase                             185   3e-50   
ref|XP_008233136.1|  PREDICTED: uncharacterized protein LOC103332...    185   4e-50   
ref|NP_001189838.1|  histone H3mK9 demethylase                          185   4e-50   
ref|XP_010464395.1|  PREDICTED: lysine-specific demethylase JMJ25...    184   4e-50   
ref|XP_008233135.1|  PREDICTED: uncharacterized protein LOC103332...    184   5e-50   
ref|XP_002886476.1|  predicted protein                                  184   5e-50   
ref|XP_008233134.1|  PREDICTED: uncharacterized protein LOC103332...    184   5e-50   
gb|EEC72327.1|  hypothetical protein OsI_05529                          184   5e-50   
ref|NP_001045644.1|  Os02g0109400                                       184   5e-50   
ref|XP_007022638.1|  Transcription factor jumonji domain-containi...    184   6e-50   
gb|AFW63901.1|  putative jumonji-like transcription factor family...    184   6e-50   
ref|XP_011044634.1|  PREDICTED: uncharacterized protein LOC105139...    186   6e-50   
ref|XP_011044633.1|  PREDICTED: uncharacterized protein LOC105139...    186   9e-50   
ref|XP_009113091.1|  PREDICTED: uncharacterized protein LOC103838...    183   9e-50   
ref|XP_010235136.1|  PREDICTED: lysine-specific demethylase JMJ25...    176   1e-49   
ref|XP_009147050.1|  PREDICTED: uncharacterized protein LOC103870649    184   1e-49   
ref|XP_010486329.1|  PREDICTED: lysine-specific demethylase JMJ25...    183   1e-49   
ref|XP_010486327.1|  PREDICTED: lysine-specific demethylase JMJ25...    183   1e-49   
ref|XP_010671439.1|  PREDICTED: uncharacterized protein LOC104888238    184   1e-49   
emb|CDY35950.1|  BnaA05g30000D                                          184   1e-49   
ref|XP_008677147.1|  PREDICTED: putative jumonji-like transcripti...    184   1e-49   
gb|EMT13865.1|  hypothetical protein F775_08528                         181   1e-49   
ref|XP_008356006.1|  PREDICTED: uncharacterized protein LOC103419652    181   2e-49   
emb|CDY12938.1|  BnaA09g13360D                                          183   2e-49   
ref|XP_008437887.1|  PREDICTED: uncharacterized protein LOC103483...    183   2e-49   
ref|XP_008437886.1|  PREDICTED: uncharacterized protein LOC103483...    183   2e-49   
gb|KFK38237.1|  hypothetical protein AALP_AA3G087000                    181   2e-49   
ref|XP_006391906.1|  hypothetical protein EUTSA_v10023846mg             182   2e-49   
ref|XP_004155248.1|  PREDICTED: uncharacterized LOC101205548            182   2e-49   
gb|KEH24644.1|  transcription factor jumonji (JmjC) domain protein      182   2e-49   
gb|KEH24646.1|  transcription factor jumonji (JmjC) domain protein      182   2e-49   
ref|XP_008437884.1|  PREDICTED: uncharacterized protein LOC103483...    182   3e-49   
ref|XP_004134301.1|  PREDICTED: uncharacterized protein LOC101205548    182   3e-49   
ref|XP_006296913.1|  hypothetical protein CARUB_v10012905mg             182   3e-49   
gb|KGN56420.1|  hypothetical protein Csa_3G119530                       182   3e-49   
ref|XP_006596786.1|  PREDICTED: uncharacterized protein LOC100800662    184   3e-49   
gb|KHN44317.1|  Lysine-specific demethylase 3A                          184   3e-49   
gb|KHN03498.1|  Leucine--tRNA ligase                                    183   4e-49   
gb|KEH24645.1|  transcription factor jumonji (JmjC) domain protein      182   4e-49   
ref|XP_009113092.1|  PREDICTED: uncharacterized protein LOC103838...    182   4e-49   
ref|XP_009113090.1|  PREDICTED: uncharacterized protein LOC103838...    181   5e-49   
ref|XP_006493318.1|  PREDICTED: uncharacterized protein LOC102627...    183   5e-49   
ref|XP_006493317.1|  PREDICTED: uncharacterized protein LOC102627...    183   5e-49   
ref|XP_002882538.1|  transcription factor jumonji domain-containi...    182   5e-49   
ref|XP_009113088.1|  PREDICTED: uncharacterized protein LOC103838...    182   5e-49   
ref|XP_002516668.1|  transcription factor, putative                     181   6e-49   
ref|XP_004494828.1|  PREDICTED: uncharacterized protein LOC101512...    181   7e-49   
ref|XP_006441091.1|  hypothetical protein CICLE_v10018464mg             182   7e-49   
ref|XP_006855902.1|  hypothetical protein AMTR_s00037p00169980          182   7e-49   
ref|XP_010430276.1|  PREDICTED: lysine-specific demethylase JMJ25...    180   8e-49   
ref|XP_009336769.1|  PREDICTED: lysine-specific demethylase JMJ25...    181   9e-49   
ref|XP_009336770.1|  PREDICTED: lysine-specific demethylase JMJ25...    181   9e-49   
ref|XP_007039055.1|  Transcription factor jumonji domain-containi...    182   9e-49   
ref|XP_009123379.1|  PREDICTED: uncharacterized protein LOC103848...    180   1e-48   
ref|XP_006661191.1|  PREDICTED: uncharacterized protein LOC102715972    180   1e-48   
ref|NP_001063090.1|  Os09g0393200                                       174   1e-48   
gb|KCW46561.1|  hypothetical protein EUGRSUZ_K00384                     181   1e-48   
ref|XP_006852624.1|  hypothetical protein AMTR_s00021p00232350          181   2e-48   
ref|XP_010035268.1|  PREDICTED: lysine-specific demethylase JMJ25...    181   2e-48   
ref|XP_010035272.1|  PREDICTED: lysine-specific demethylase JMJ25...    181   2e-48   
ref|XP_011470245.1|  PREDICTED: lysine-specific demethylase JMJ25...    178   2e-48   
ref|XP_011470244.1|  PREDICTED: lysine-specific demethylase JMJ25...    179   3e-48   
ref|XP_004309136.1|  PREDICTED: lysine-specific demethylase JMJ25...    179   3e-48   
ref|XP_002263925.2|  PREDICTED: lysine-specific demethylase JMJ25       179   4e-48   
gb|AES62949.2|  transcription factor jumonji (JmjC) domain protein      179   4e-48   
ref|XP_003636724.1|  Lysine-specific demethylase 3B                     179   4e-48   
emb|CBI40561.3|  unnamed protein product                                178   4e-48   
ref|XP_006649196.1|  PREDICTED: uncharacterized protein LOC102704400    179   4e-48   
ref|XP_011468931.1|  PREDICTED: lysine-specific demethylase JMJ25...    179   5e-48   
emb|CAN64660.1|  hypothetical protein VITISV_009615                     179   6e-48   
ref|XP_011468932.1|  PREDICTED: lysine-specific demethylase JMJ25...    179   6e-48   
ref|XP_011468934.1|  PREDICTED: lysine-specific demethylase JMJ25...    179   7e-48   
gb|EPS57919.1|  hypothetical protein M569_16897                         166   7e-48   
gb|KDO42891.1|  hypothetical protein CISIN_1g0392271mg                  175   7e-48   
ref|XP_006301659.1|  hypothetical protein CARUB_v10022109mg             177   8e-48   
emb|CAA67296.1|  chloroplast DNA-binding protein PD3                    179   8e-48   
ref|XP_011468933.1|  PREDICTED: lysine-specific demethylase JMJ25...    178   8e-48   
ref|XP_007051533.1|  Transcription factor jumonji domain-containi...    179   9e-48   
gb|EMS46642.1|  Lysine-specific demethylase 3B                          175   9e-48   
emb|CAA65242.1|  ENBP1                                                  179   1e-47   
ref|XP_007051532.1|  Transcription factor jumonji domain-containi...    179   1e-47   
ref|XP_006591280.1|  PREDICTED: uncharacterized protein LOC100808...    178   1e-47   
gb|KEH39730.1|  transcription factor jumonji (JmjC) domain protei...    179   1e-47   
emb|CAA05489.1|  ENBP1                                                  179   1e-47   
gb|KJB41530.1|  hypothetical protein B456_007G109100                    178   1e-47   
gb|EEE59308.1|  hypothetical protein OsJ_11363                          177   2e-47   
ref|XP_004498514.1|  PREDICTED: uncharacterized protein LOC101491141    179   2e-47   
ref|XP_002321404.2|  hypothetical protein POPTR_0015s01510g             178   2e-47   
ref|XP_011468930.1|  PREDICTED: lysine-specific demethylase JMJ25...    177   2e-47   
tpg|DAA61322.1|  TPA: putative jumonji-like transcription factor ...    176   2e-47   
gb|KHG18904.1|  clpX                                                    178   2e-47   
ref|XP_006833137.1|  hypothetical protein AMTR_s00072p00101130          176   2e-47   
gb|EEE69639.1|  hypothetical protein OsJ_29246                          174   4e-47   
gb|EAZ08997.1|  hypothetical protein OsI_31259                          174   5e-47   
ref|XP_010318017.1|  PREDICTED: uncharacterized protein LOC101252...    177   6e-47   
emb|CAN60121.1|  hypothetical protein VITISV_038746                     176   6e-47   
ref|XP_009123382.1|  PREDICTED: uncharacterized protein LOC103848...    175   6e-47   
gb|KHG18903.1|  clpX                                                    177   6e-47   
ref|XP_009123378.1|  PREDICTED: uncharacterized protein LOC103848...    175   7e-47   
gb|KJB52582.1|  hypothetical protein B456_008G268700                    176   7e-47   
ref|XP_009780311.1|  PREDICTED: lysine-specific demethylase JMJ25...    177   7e-47   
gb|KDO54241.1|  hypothetical protein CISIN_1g001517mg                   176   8e-47   
ref|XP_009780310.1|  PREDICTED: lysine-specific demethylase JMJ25...    176   9e-47   
gb|KHG18906.1|  Lysine-specific demethylase 3B                          176   9e-47   
ref|XP_009588205.1|  PREDICTED: uncharacterized protein LOC104085...    176   1e-46   
ref|XP_009588206.1|  PREDICTED: uncharacterized protein LOC104085...    176   1e-46   
ref|XP_011099642.1|  PREDICTED: lysine-specific demethylase JMJ25...    173   1e-46   
gb|AAF70852.1|AC003113_19  F24O1.3                                      174   1e-46   
ref|XP_011099640.1|  PREDICTED: lysine-specific demethylase JMJ25...    174   2e-46   
ref|XP_011099641.1|  PREDICTED: lysine-specific demethylase JMJ25...    173   2e-46   
ref|XP_011099639.1|  PREDICTED: lysine-specific demethylase JMJ25...    173   2e-46   
ref|XP_003592703.1|  Lysine-specific demethylase 3B                     174   2e-46   
ref|XP_007136429.1|  hypothetical protein PHAVU_009G044500g             172   3e-46   
gb|EMT26740.1|  Lysine-specific demethylase 3B                          173   5e-46   
ref|XP_011075986.1|  PREDICTED: uncharacterized protein LOC105160354    174   6e-46   
ref|XP_007022641.1|  Transcription factor jumonji domain-containi...    172   7e-46   
ref|XP_003588516.1|  Lysine-specific demethylase 3B                     173   1e-45   
ref|XP_001784917.1|  predicted protein                                  169   2e-45   
emb|CAN75139.1|  hypothetical protein VITISV_040756                     173   2e-45   
ref|XP_010325060.1|  PREDICTED: uncharacterized protein LOC101244...    171   3e-45   
emb|CDY07163.1|  BnaCnng01780D                                          169   4e-45   
ref|XP_010325059.1|  PREDICTED: uncharacterized protein LOC101244...    171   4e-45   
ref|XP_010325057.1|  PREDICTED: uncharacterized protein LOC101244...    171   4e-45   
ref|XP_010325056.1|  PREDICTED: uncharacterized protein LOC101244...    171   4e-45   
ref|XP_010325058.1|  PREDICTED: uncharacterized protein LOC101244...    171   4e-45   
ref|XP_010325053.1|  PREDICTED: uncharacterized protein LOC101244...    171   4e-45   
ref|XP_010325051.1|  PREDICTED: uncharacterized protein LOC101244...    171   4e-45   
ref|XP_010325055.1|  PREDICTED: uncharacterized protein LOC101244...    171   4e-45   
ref|XP_010325054.1|  PREDICTED: uncharacterized protein LOC101244...    171   4e-45   
emb|CDX91867.1|  BnaC03g31690D                                          170   5e-45   
ref|XP_010277904.1|  PREDICTED: lysine-specific demethylase JMJ25...    171   5e-45   
gb|KEH17360.1|  transcription factor jumonji (jmjC) domain protein      168   5e-45   
ref|XP_009111409.1|  PREDICTED: uncharacterized protein LOC103836...    168   1e-44   
ref|XP_006350632.1|  PREDICTED: uncharacterized protein LOC102602507    167   2e-44   
gb|EYU20992.1|  hypothetical protein MIMGU_mgv11b022386mg               158   2e-44   
emb|CDY48494.1|  BnaA09g00290D                                          168   2e-44   
ref|XP_009111408.1|  PREDICTED: uncharacterized protein LOC103836...    168   3e-44   
gb|KEH36920.1|  transcription factor jumonji (JmjC) domain protein      166   3e-44   
ref|XP_009134499.1|  PREDICTED: uncharacterized protein LOC103858...    167   5e-44   
emb|CDX74371.1|  BnaA03g26760D                                          167   5e-44   
ref|XP_009134498.1|  PREDICTED: uncharacterized protein LOC103858...    167   7e-44   
ref|XP_009134497.1|  PREDICTED: uncharacterized protein LOC103858...    167   8e-44   
ref|XP_006396316.1|  hypothetical protein EUTSA_v10028389mg             167   1e-43   
ref|XP_002875004.1|  transcription factor jumonji domain-containi...    166   1e-43   
gb|EYU40201.1|  hypothetical protein MIMGU_mgv1a019594mg                164   1e-43   
gb|EYU20990.1|  hypothetical protein MIMGU_mgv1a019317mg                164   1e-43   
gb|KJB41529.1|  hypothetical protein B456_007G109100                    166   2e-43   
ref|XP_003615216.1|  Lysine-specific demethylase 3A                     166   2e-43   
gb|KFK30675.1|  hypothetical protein AALP_AA6G013500                    166   3e-43   
ref|XP_007220578.1|  hypothetical protein PRUPE_ppa000113mg             166   3e-43   
emb|CDX74372.1|  BnaA03g26750D                                          162   4e-43   
gb|KJB41533.1|  hypothetical protein B456_007G109100                    163   1e-42   
gb|KJB41532.1|  hypothetical protein B456_007G109100                    163   1e-42   
gb|KJB41542.1|  hypothetical protein B456_007G109100                    164   1e-42   
gb|KJB41534.1|  hypothetical protein B456_007G109100                    163   2e-42   
gb|KJB41531.1|  hypothetical protein B456_007G109100                    163   2e-42   
gb|KJB41537.1|  hypothetical protein B456_007G109100                    164   2e-42   
ref|XP_002444360.1|  hypothetical protein SORBIDRAFT_07g020680          160   2e-42   
gb|KJB41536.1|  hypothetical protein B456_007G109100                    163   2e-42   
gb|KJB41539.1|  hypothetical protein B456_007G109100                    163   2e-42   
ref|XP_007039059.1|  Transcription factor jumonji domain-containi...    164   2e-42   
gb|KJB41535.1|  hypothetical protein B456_007G109100                    163   3e-42   
gb|KJB41538.1|  hypothetical protein B456_007G109100                    163   3e-42   
gb|AAT81741.1|  jmjC domain containing protein                          162   4e-42   
emb|CDM86632.1|  unnamed protein product                                159   9e-42   
ref|XP_001785117.1|  predicted protein                                  159   1e-41   
ref|NP_192008.3|  transcription factor jumonji (jmjC) domain-cont...    160   1e-41   
ref|XP_010422752.1|  PREDICTED: lysine-specific demethylase JMJ25...    160   1e-41   
ref|XP_010427969.1|  PREDICTED: lysine-specific demethylase JMJ25...    160   1e-41   
ref|XP_010457005.1|  PREDICTED: lysine-specific demethylase JMJ25...    160   2e-41   
ref|XP_009352026.1|  PREDICTED: uncharacterized protein LOC103943...    160   3e-41   
ref|XP_008380797.1|  PREDICTED: uncharacterized protein LOC103443682    160   4e-41   
ref|XP_009352028.1|  PREDICTED: uncharacterized protein LOC103943...    160   4e-41   
gb|KGN50871.1|  hypothetical protein Csa_5G308760                       159   6e-41   
ref|XP_006287042.1|  hypothetical protein CARUB_v10000192mg             158   8e-41   
gb|EMT24288.1|  hypothetical protein F775_13475                         150   8e-41   
emb|CDX91865.1|  BnaC03g31670D                                          149   2e-40   
gb|ADE76854.1|  unknown                                                 145   2e-40   
ref|XP_008349260.1|  PREDICTED: uncharacterized protein LOC103412487    150   2e-40   
ref|XP_009349950.1|  PREDICTED: uncharacterized protein LOC103941...    157   5e-40   
ref|XP_009349951.1|  PREDICTED: uncharacterized protein LOC103941...    157   5e-40   
emb|CBI40867.3|  unnamed protein product                                152   2e-39   
gb|EYU20994.1|  hypothetical protein MIMGU_mgv1a021402mg                151   5e-39   
ref|XP_011015578.1|  PREDICTED: lysine-specific demethylase JMJ25...    149   6e-39   
ref|XP_006360371.1|  PREDICTED: uncharacterized protein LOC102592286    150   7e-39   
gb|EYU40203.1|  hypothetical protein MIMGU_mgv1a003411mg                149   1e-38   
gb|EYU19008.1|  hypothetical protein MIMGU_mgv1a026627mg                149   2e-38   
gb|EYU40204.1|  hypothetical protein MIMGU_mgv1a003458mg                149   2e-38   
gb|KHG04475.1|  Lysine-specific demethylase 3B                          144   2e-38   
emb|CAN59730.1|  hypothetical protein VITISV_042729                     151   4e-38   
ref|XP_010646369.1|  PREDICTED: uncharacterized protein LOC100266659    150   4e-38   
gb|KFK38222.1|  hypothetical protein AALP_AA3G084700                    149   4e-38   
gb|EYU40200.1|  hypothetical protein MIMGU_mgv1a021999mg                148   6e-38   
ref|XP_002304991.2|  hypothetical protein POPTR_0004s03270g             149   7e-38   
ref|XP_009352025.1|  PREDICTED: uncharacterized protein LOC103943...    150   8e-38   
ref|XP_009352027.1|  PREDICTED: uncharacterized protein LOC103943...    150   9e-38   
ref|XP_010507147.1|  PREDICTED: lysine-specific demethylase JMJ25...    140   1e-37   
emb|CAB45782.1|  putative protein (fragment)                            148   2e-37   
ref|XP_011043318.1|  PREDICTED: lysine-specific demethylase JMJ25...    149   2e-37   
ref|XP_009374151.1|  PREDICTED: lysine-specific demethylase JMJ25       149   2e-37   
gb|KFK38223.1|  hypothetical protein AALP_AA3G084700                    148   2e-37   
ref|XP_007025834.1|  Lysine-specific demethylase 3B, putative iso...    147   2e-37   
ref|XP_008383854.1|  PREDICTED: uncharacterized protein LOC103446492    149   2e-37   
ref|XP_009348004.1|  PREDICTED: lysine-specific demethylase JMJ25...    149   2e-37   
ref|XP_008371234.1|  PREDICTED: uncharacterized protein LOC103434663    149   2e-37   
ref|XP_010686255.1|  PREDICTED: uncharacterized protein LOC104900526    149   2e-37   
ref|XP_011001156.1|  PREDICTED: LOW QUALITY PROTEIN: lysine-speci...    148   3e-37   
ref|XP_007025832.1|  Lysine-specific demethylase 3B, putative iso...    147   1e-36   
ref|XP_007025830.1|  Lysine-specific demethylase 3B, putative iso...    147   1e-36   
ref|XP_001757132.1|  predicted protein                                  145   1e-36   
ref|XP_006467914.1|  PREDICTED: uncharacterized protein LOC102608...    147   1e-36   
ref|XP_006467915.1|  PREDICTED: uncharacterized protein LOC102608...    146   1e-36   
gb|KHG00341.1|  Lysine-specific demethylase 3B                          147   1e-36   



>ref|XP_004237549.1| PREDICTED: lysine-specific demethylase JMJ25-like [Solanum lycopersicum]
Length=1110

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHI+C PVPQV+HPIHDQ FYLT +HK++LKEEYG+EPWTF+QKLGDA+FIPAGCPHQVR
Sbjct  963   RHIYCCPVPQVIHPIHDQTFYLTEDHKRKLKEEYGVEPWTFVQKLGDAIFIPAGCPHQVR  1022

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+HEC+RLTE FRTLPQNHRAKEDKLEVKKM ICAV++A+ ++E
Sbjct  1023  NLKSCIKVALDFVSPENLHECIRLTEEFRTLPQNHRAKEDKLEVKKMSICAVRDAVIELE  1082

Query  248   KLTLE  234
             KL+ E
Sbjct  1083  KLSKE  1087



>ref|XP_006340029.1| PREDICTED: uncharacterized protein LOC102601654 [Solanum tuberosum]
Length=1105

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHI+C PVPQV+HPIHDQ FYLT +HK++LKEEYG+EPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  958   RHIYCCPVPQVIHPIHDQTFYLTEDHKRKLKEEYGVEPWTFVQKLGDAVFIPAGCPHQVR  1017

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+HEC+RLTE FRTLPQNHRAKEDKLEVKKM ICAV++AL  +E
Sbjct  1018  NLKSCIKVALDFVSPENLHECIRLTEEFRTLPQNHRAKEDKLEVKKMSICAVRQALNKLE  1077

Query  248   KLT  240
              L+
Sbjct  1078  GLS  1080



>ref|XP_009781661.1| PREDICTED: lysine-specific demethylase JMJ25-like [Nicotiana 
sylvestris]
Length=1112

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC PVPQV+HPIHDQ FYLT +HK++LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  962   RHIHCSPVPQVIHPIHDQTFYLTEDHKRKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  1021

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+HEC+RLTE FRTLPQNHRAKEDKLEVKKM I A++EALK +E
Sbjct  1022  NLKSCIKVALDFVSPENLHECIRLTEEFRTLPQNHRAKEDKLEVKKMSIYAMREALKCLE  1081

Query  248   KLT  240
             +L 
Sbjct  1082  ELA  1084



>ref|XP_009630740.1| PREDICTED: lysine-specific demethylase JMJ25-like [Nicotiana 
tomentosiformis]
Length=1176

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC PVPQV+HPIHDQ FYLT +HK++LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  1019  RHIHCSPVPQVIHPIHDQTFYLTEDHKRKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  1078

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+HEC+RLTE FRTLPQNHRAKEDKLEVKKM I A++EALK +E
Sbjct  1079  NLKSCIKVALDFVSPENLHECIRLTEEFRTLPQNHRAKEDKLEVKKMSIYAMREALKCLE  1138

Query  248   KLT  240
             ++ 
Sbjct  1139  EVA  1141



>gb|EPS68030.1| hypothetical protein M569_06743, partial [Genlisea aurea]
Length=211

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV +V+HPIHDQ+FYLT +H ++LKEEYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  84   RHTYCCPVDEVIHPIHDQSFYLTKQHIRKLKEEYGIEPWTFEQKLGEAVFIPAGCPHQVR  143

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPEN+HEC+RLTE FR LP++HRA EDKLEVKKMII AV  A++D+E
Sbjct  144  NLKSCTKVAVDFVSPENLHECLRLTEEFRKLPRHHRANEDKLEVKKMIIYAVDRAVRDLE  203

Query  248  KLT  240
            +LT
Sbjct  204  ELT  206



>ref|XP_010655918.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Vitis vinifera]
Length=1231

 Score =   218 bits (554),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC+P+ QVVHPIHDQ FYLT+EHK++LK+EYGIEPWTF+Q LGDAVFIPAGCPHQVR
Sbjct  1111  RHIHCFPLQQVVHPIHDQTFYLTLEHKRKLKDEYGIEPWTFVQNLGDAVFIPAGCPHQVR  1170

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
             NLKSC+KVAVDFVSPEN+ EC+RLTE FRTLPQNHRAKEDKLEVKKM+I AV  ALK +
Sbjct  1171  NLKSCIKVAVDFVSPENVGECVRLTEEFRTLPQNHRAKEDKLEVKKMVIHAVYNALKTL  1229



>ref|XP_010655917.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Vitis vinifera]
Length=1256

 Score =   217 bits (553),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC+P+ QVVHPIHDQ FYLT+EHK++LK+EYGIEPWTF+Q LGDAVFIPAGCPHQVR
Sbjct  1111  RHIHCFPLQQVVHPIHDQTFYLTLEHKRKLKDEYGIEPWTFVQNLGDAVFIPAGCPHQVR  1170

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
             NLKSC+KVAVDFVSPEN+ EC+RLTE FRTLPQNHRAKEDKLEVKKM+I AV  ALK +
Sbjct  1171  NLKSCIKVAVDFVSPENVGECVRLTEEFRTLPQNHRAKEDKLEVKKMVIHAVYNALKTL  1229



>ref|XP_010275975.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Nelumbo nucifera]
Length=1266

 Score =   217 bits (553),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 95/123 (77%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC  V +VVHPIHDQ+FYLT EHK++LKEE+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  1102  RHIHCNQVEKVVHPIHDQSFYLTSEHKRKLKEEFGIEPWTFVQKLGEAVFIPAGCPHQVR  1161

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+HEC+RLTE FRTLPQNHRAKEDKLEVK+M + A+++ ++D+E
Sbjct  1162  NLKSCIKVALDFVSPENVHECIRLTEEFRTLPQNHRAKEDKLEVKRMTLHAIRKTVEDLE  1221

Query  248   KLT  240
             +LT
Sbjct  1222  QLT  1224



>emb|CBI29042.3| unnamed protein product [Vitis vinifera]
Length=1019

 Score =   215 bits (547),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC+P+ QVVHPIHDQ FYLT+EHK++LK+EYGIEPWTF+Q LGDAVFIPAGCPHQVR
Sbjct  874  RHIHCFPLQQVVHPIHDQTFYLTLEHKRKLKDEYGIEPWTFVQNLGDAVFIPAGCPHQVR  933

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
            NLKSC+KVAVDFVSPEN+ EC+RLTE FRTLPQNHRAKEDKLEVKKM+I AV  ALK +
Sbjct  934  NLKSCIKVAVDFVSPENVGECVRLTEEFRTLPQNHRAKEDKLEVKKMVIHAVYNALKTL  992



>ref|XP_010275976.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X3 
[Nelumbo nucifera]
Length=1242

 Score =   216 bits (551),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 95/123 (77%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC  V +VVHPIHDQ+FYLT EHK++LKEE+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  1070  RHIHCNQVEKVVHPIHDQSFYLTSEHKRKLKEEFGIEPWTFVQKLGEAVFIPAGCPHQVR  1129

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+HEC+RLTE FRTLPQNHRAKEDKLEVK+M + A+++ ++D+E
Sbjct  1130  NLKSCIKVALDFVSPENVHECIRLTEEFRTLPQNHRAKEDKLEVKRMTLHAIRKTVEDLE  1189

Query  248   KLT  240
             +LT
Sbjct  1190  QLT  1192



>ref|XP_010275974.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Nelumbo nucifera]
Length=1274

 Score =   216 bits (551),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 95/123 (77%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC  V +VVHPIHDQ+FYLT EHK++LKEE+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  1102  RHIHCNQVEKVVHPIHDQSFYLTSEHKRKLKEEFGIEPWTFVQKLGEAVFIPAGCPHQVR  1161

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+HEC+RLTE FRTLPQNHRAKEDKLEVK+M + A+++ ++D+E
Sbjct  1162  NLKSCIKVALDFVSPENVHECIRLTEEFRTLPQNHRAKEDKLEVKRMTLHAIRKTVEDLE  1221

Query  248   KLT  240
             +LT
Sbjct  1222  QLT  1224



>ref|XP_010263984.1| PREDICTED: LOW QUALITY PROTEIN: lysine-specific demethylase JMJ25-like 
[Nelumbo nucifera]
Length=322

 Score =   204 bits (519),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV QV+HPIHDQAFYLT+EHK++LKEE+G+EPWTF Q++G+AVFIPAGCPHQVR
Sbjct  195  RHIYCSPVEQVIHPIHDQAFYLTLEHKRKLKEEFGVEPWTFEQRVGEAVFIPAGCPHQVR  254

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPENIH+C  L++ FR LP+NHRA+EDKLEVKKMI+ AV +A+KD++
Sbjct  255  NLKSCTKVALDFVSPENIHQCFLLSDEFRQLPKNHRAREDKLEVKKMILHAVNQAVKDLQ  314

Query  248  KL  243
             L
Sbjct  315  DL  316



>ref|XP_010418217.1| PREDICTED: lysine-specific demethylase JMJ25-like [Camelina sativa]
Length=305

 Score =   203 bits (517),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV +V HPIHDQA YLTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  175  RHTYCCPVTKVYHPIHDQACYLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  234

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENIHEC+RLTE FR LP+NH+A+EDKLE+KKM+I A+++AL ++E
Sbjct  235  NLKSCTKVAVDFVSPENIHECLRLTEEFRQLPKNHKAREDKLEIKKMVIYAIEQALNELE  294

Query  248  KLTLE*R  228
             L  E R
Sbjct  295  TLPEETR  301



>ref|XP_011465839.1| PREDICTED: LOW QUALITY PROTEIN: lysine-specific demethylase JMJ25-like 
[Fragaria vesca subsp. vesca]
Length=621

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QVVHPIHDQ FYLTV+HKK LKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR
Sbjct  489  RHIHCCPVQQVVHPIHDQTFYLTVQHKKMLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  548

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPEN+ EC  LTE FRTLP++HRAKEDKLEVKKMI+ +V +ALK+++
Sbjct  549  NLKSCIKVAMDFVSPENVGECFHLTEVFRTLPEDHRAKEDKLEVKKMILHSVTDALKELD  608

Query  248  KL  243
            ++
Sbjct  609  QI  610



>ref|XP_008224709.1| PREDICTED: uncharacterized protein LOC103324432 isoform X2 [Prunus 
mume]
Length=865

 Score =   209 bits (531),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V+HPIHDQ+FYLT+EHKK+LKEE+G+EPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  739  RHTYCSLVERVIHPIHDQSFYLTLEHKKKLKEEFGVEPWTFLQKLGEAVFIPAGCPHQVR  798

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPEN+HEC+RLTE FR LP+NHRA+EDKLE+KKMI+ AV EALKD+E
Sbjct  799  NLKSCTKVAADFVSPENVHECLRLTEEFRQLPKNHRAREDKLEIKKMILYAVDEALKDLE  858

Query  248  KL  243
             L
Sbjct  859  AL  860



>ref|XP_008224707.1| PREDICTED: uncharacterized protein LOC103324432 isoform X1 [Prunus 
mume]
Length=866

 Score =   209 bits (531),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V+HPIHDQ+FYLT+EHKK+LKEE+G+EPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  740  RHTYCSLVERVIHPIHDQSFYLTLEHKKKLKEEFGVEPWTFLQKLGEAVFIPAGCPHQVR  799

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPEN+HEC+RLTE FR LP+NHRA+EDKLE+KKMI+ AV EALKD+E
Sbjct  800  NLKSCTKVAADFVSPENVHECLRLTEEFRQLPKNHRAREDKLEIKKMILYAVDEALKDLE  859

Query  248  KL  243
             L
Sbjct  860  AL  861



>emb|CDP19052.1| unnamed protein product [Coffea canephora]
Length=1106

 Score =   210 bits (535),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH++C P+ QVVHPIHDQ+ YLT+EHK+RLKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  981   RHVYCRPLEQVVHPIHDQSIYLTMEHKRRLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  1040

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+R+TE FR LPQNHRAKEDKLEVKKM   A+KEA+ D+E
Sbjct  1041  NLKSCIKVALDFVSPENVGECVRMTEEFRVLPQNHRAKEDKLEVKKMTYYAMKEAIIDLE  1100



>emb|CBI24025.3| unnamed protein product [Vitis vinifera]
Length=862

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH HC PV QVVHPIHDQ FYLT+ HK++LKEE+G+EPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  716  RHTHCSPVEQVVHPIHDQTFYLTLHHKRKLKEEFGVEPWTFVQKLGEAVFIPAGCPHQVR  775

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPENIHEC+RLTE FR LP NHRAKEDKLEVKKM + A+++A+ ++E
Sbjct  776  NLKSCIKVALDFVSPENIHECVRLTEEFRALPHNHRAKEDKLEVKKMSLHALRQAVDNLE  835

Query  248  KLT  240
            +LT
Sbjct  836  QLT  838



>ref|XP_007214653.1| hypothetical protein PRUPE_ppa002063mg [Prunus persica]
 gb|EMJ15852.1| hypothetical protein PRUPE_ppa002063mg [Prunus persica]
Length=723

 Score =   207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V+HPIHDQ+FYLT+EHKK+LKEE+G+EPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  597  RHTYCSLVERVIHPIHDQSFYLTLEHKKKLKEEFGVEPWTFLQKLGEAVFIPAGCPHQVR  656

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPEN+HEC+RLTE FR LP+NHRA+EDKLE+KKMI+ AV EALKD+E
Sbjct  657  NLKSCTKVAADFVSPENVHECLRLTEEFRQLPKNHRAREDKLEIKKMILYAVDEALKDLE  716

Query  248  KL  243
             L
Sbjct  717  AL  718



>ref|XP_010069331.1| PREDICTED: lysine-specific demethylase JMJ25-like [Eucalyptus 
grandis]
 gb|KCW57655.1| hypothetical protein EUGRSUZ_H00420 [Eucalyptus grandis]
Length=925

 Score =   209 bits (531),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC P+ QV+HPIHDQ  YLT +HK++LKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR
Sbjct  788  RHIHCNPLSQVIHPIHDQTMYLTSQHKRKLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  847

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP NHRAKEDKLEVKKM +  ++  +KD+E
Sbjct  848  NLKSCIKVALDFVSPENVKECLRLTEEFRVLPANHRAKEDKLEVKKMAVYGLQRVVKDLE  907

Query  248  KLT  240
             L+
Sbjct  908  ALS  910



>ref|XP_010648866.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Vitis vinifera]
Length=1174

 Score =   210 bits (535),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH HC PV QVVHPIHDQ FYLT+ HK++LKEE+G+EPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  1028  RHTHCSPVEQVVHPIHDQTFYLTLHHKRKLKEEFGVEPWTFVQKLGEAVFIPAGCPHQVR  1087

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPENIHEC+RLTE FR LP NHRAKEDKLEVKKM + A+++A+ ++E
Sbjct  1088  NLKSCIKVALDFVSPENIHECVRLTEEFRALPHNHRAKEDKLEVKKMSLHALRQAVDNLE  1147

Query  248   KLT  240
             +LT
Sbjct  1148  QLT  1150



>ref|XP_010648865.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Vitis vinifera]
Length=1175

 Score =   210 bits (535),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH HC PV QVVHPIHDQ FYLT+ HK++LKEE+G+EPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  1029  RHTHCSPVEQVVHPIHDQTFYLTLHHKRKLKEEFGVEPWTFVQKLGEAVFIPAGCPHQVR  1088

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPENIHEC+RLTE FR LP NHRAKEDKLEVKKM + A+++A+ ++E
Sbjct  1089  NLKSCIKVALDFVSPENIHECVRLTEEFRALPHNHRAKEDKLEVKKMSLHALRQAVDNLE  1148

Query  248   KLT  240
             +LT
Sbjct  1149  QLT  1151



>ref|XP_009365722.1| PREDICTED: lysine-specific demethylase JMJ25-like [Pyrus x bretschneideri]
Length=1078

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH HC P+PQV+HPIHDQ FYLTVEHKK+LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  921   RHTHCCPLPQVIHPIHDQTFYLTVEHKKKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  980

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
             NLKSC+KVA+DFVSPEN+ EC ++TE FR LP NHRAKEDKLEVKKMI+ AV++AL
Sbjct  981   NLKSCIKVALDFVSPENVGECFQMTEEFRKLPPNHRAKEDKLEVKKMIVHAVEDAL  1036



>ref|XP_004497219.1| PREDICTED: uncharacterized protein LOC101510800 isoform X1 [Cicer 
arietinum]
Length=1144

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH+HC P+ QV+HPIHDQ FYLT+EHKKRLKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  1014  RHVHCSPLKQVIHPIHDQTFYLTIEHKKRLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  1073

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC KVA+DFVSPEN+ EC RLTE FR LP NHR+ EDKLEVKKMI+ A+ + +K++E
Sbjct  1074  NLKSCTKVALDFVSPENVGECFRLTEEFRKLPVNHRSTEDKLEVKKMIVYAMLDVVKNLE  1133

Query  248   K  246
             K
Sbjct  1134  K  1134



>gb|KDO52715.1| hypothetical protein CISIN_1g006745mg [Citrus sinensis]
Length=632

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV+HPIHDQ FYL+ EHK +LK+EYGIEPWTFIQKLG+AVF+PAGCPHQVR
Sbjct  500  RHIHCCPVQQVIHPIHDQVFYLSSEHKAKLKQEYGIEPWTFIQKLGEAVFVPAGCPHQVR  559

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
            NLKSC+K A+DFVSPEN+ +C+RLTE FR LP NHRAKEDKLEVKKMI+ AV +A+KDI
Sbjct  560  NLKSCIKAALDFVSPENVSQCVRLTEEFRLLPPNHRAKEDKLEVKKMILYAVSQAVKDI  618



>ref|XP_008371063.1| PREDICTED: uncharacterized protein LOC103434479 isoform X2 [Malus 
domestica]
Length=887

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V+HPIHDQ+FYLT+EHK+RLKEE+G+EPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  747  RHTYCSLVEKVIHPIHDQSFYLTLEHKQRLKEEFGVEPWTFVQRLGEAVFIPAGCPHQVR  806

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPEN+HEC+RLTE FR LP+NHRA+EDKLE+KKMI+ AV +A+KD+E
Sbjct  807  NLKSCTKVAADFVSPENVHECLRLTEEFRQLPKNHRAREDKLEIKKMILYAVDQAVKDLE  866

Query  248  KL  243
             L
Sbjct  867  SL  868



>ref|XP_008371061.1| PREDICTED: uncharacterized protein LOC103434479 isoform X1 [Malus 
domestica]
 ref|XP_008371062.1| PREDICTED: uncharacterized protein LOC103434479 isoform X1 [Malus 
domestica]
Length=888

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V+HPIHDQ+FYLT+EHK+RLKEE+G+EPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  748  RHTYCSLVEKVIHPIHDQSFYLTLEHKQRLKEEFGVEPWTFVQRLGEAVFIPAGCPHQVR  807

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPEN+HEC+RLTE FR LP+NHRA+EDKLE+KKMI+ AV +A+KD+E
Sbjct  808  NLKSCTKVAADFVSPENVHECLRLTEEFRQLPKNHRAREDKLEIKKMILYAVDQAVKDLE  867

Query  248  KL  243
             L
Sbjct  868  SL  869



>ref|XP_011022030.1| PREDICTED: lysine-specific demethylase JMJ25-like [Populus euphratica]
Length=1187

 Score =   208 bits (530),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 92/116 (79%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+P+VVHPIHDQ F+LT+EHK++LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  1046  RHIHCSPLPKVVHPIHDQTFFLTLEHKRKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  1105

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP NHRAKEDKLE+KKM + A + AL
Sbjct  1106  NLKSCIKVAMDFVSPENVGECIRLTEEFRLLPPNHRAKEDKLEIKKMYLHAARWAL  1161



>ref|XP_009357483.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Pyrus x bretschneideri]
Length=892

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V+HPIHDQ+FYLT+EHK+RLKEE+G+EPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  748  RHTYCSLVEKVIHPIHDQSFYLTLEHKRRLKEEFGVEPWTFVQRLGEAVFIPAGCPHQVR  807

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPEN+HEC+RLTE FR LP+NHRA+EDKLE+KKMI+ AV +A+KD E
Sbjct  808  NLKSCTKVAADFVSPENVHECLRLTEEFRQLPKNHRAREDKLEIKKMILYAVDQAVKDFE  867

Query  248  KLT  240
             L 
Sbjct  868  SLA  870



>ref|XP_009357482.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Pyrus x bretschneideri]
Length=893

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V+HPIHDQ+FYLT+EHK+RLKEE+G+EPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  749  RHTYCSLVEKVIHPIHDQSFYLTLEHKRRLKEEFGVEPWTFVQRLGEAVFIPAGCPHQVR  808

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPEN+HEC+RLTE FR LP+NHRA+EDKLE+KKMI+ AV +A+KD E
Sbjct  809  NLKSCTKVAADFVSPENVHECLRLTEEFRQLPKNHRAREDKLEIKKMILYAVDQAVKDFE  868

Query  248  KLT  240
             L 
Sbjct  869  SLA  871



>ref|XP_009357484.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X3 
[Pyrus x bretschneideri]
Length=887

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V+HPIHDQ+FYLT+EHK+RLKEE+G+EPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  743  RHTYCSLVEKVIHPIHDQSFYLTLEHKRRLKEEFGVEPWTFVQRLGEAVFIPAGCPHQVR  802

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPEN+HEC+RLTE FR LP+NHRA+EDKLE+KKMI+ AV +A+KD E
Sbjct  803  NLKSCTKVAADFVSPENVHECLRLTEEFRQLPKNHRAREDKLEIKKMILYAVDQAVKDFE  862

Query  248  KLT  240
             L 
Sbjct  863  SLA  865



>ref|XP_008238007.1| PREDICTED: uncharacterized protein LOC103336696 [Prunus mume]
Length=944

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH+HC P+ QV+HPIHDQ FYLT+EHKK+LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  814  RHVHCCPLQQVIHPIHDQTFYLTLEHKKKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  873

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPEN+ EC R+TE FR LPQNHRAKEDKLEVKKMI+ AV   +
Sbjct  874  NLKSCIKVAMDFVSPENVSECFRMTEEFRKLPQNHRAKEDKLEVKKMIVHAVNNLM  929



>ref|XP_006604040.1| PREDICTED: uncharacterized protein LOC100780803 isoform X1 [Glycine 
max]
Length=1015

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+ QV+HPIHDQ FYLT+EHKK+LKEEYGIEPWTF QKLGDAVFIPAGCPHQVR
Sbjct  885   RHIHCCPLKQVIHPIHDQTFYLTMEHKKKLKEEYGIEPWTFTQKLGDAVFIPAGCPHQVR  944

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC RLTE FRTLP NHR+ EDKLEVKKM I A++E +  +E
Sbjct  945   NLKSCIKVALDFVSPENVGECFRLTEEFRTLPINHRSTEDKLEVKKMTIYAMQEVITKLE  1004

Query  248   K  246
             K
Sbjct  1005  K  1005



>emb|CBI23201.3| unnamed protein product [Vitis vinifera]
Length=646

 Score =   204 bits (518),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH+ C PV +VVHPIHDQ+FYLT+EHKK+LKEEYGIEPWTF Q++G+AVFIPAGCPHQVR
Sbjct  522  RHVFCSPVNRVVHPIHDQSFYLTLEHKKKLKEEYGIEPWTFEQRIGEAVFIPAGCPHQVR  581

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
            NLKSC KVAVDFVSPENIHEC+RLTE FR LP+NHR +EDKLE+KKMI+ AV ++LKD 
Sbjct  582  NLKSCTKVAVDFVSPENIHECIRLTEEFRQLPKNHRVREDKLEIKKMIVYAVAQSLKDF  640



>ref|XP_010524259.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X2 [Tarenaya 
hassleriana]
Length=882

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC P+PQVVHPIHDQ FYLT EHK++LKEEYGIEPWTF+QKLGDAV IPAGCPHQVR
Sbjct  729  RHIHCCPLPQVVHPIHDQTFYLTWEHKRKLKEEYGIEPWTFVQKLGDAVLIPAGCPHQVR  788

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
            NLKSC KVAVDFVSPEN+ EC RLT+ FR LP NH  KEDKLEVKKM+I AV +ALKD+
Sbjct  789  NLKSCTKVAVDFVSPENVGECFRLTKEFRLLPPNHPTKEDKLEVKKMVIHAVNQALKDL  847



>ref|XP_010524176.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X1 [Tarenaya 
hassleriana]
Length=896

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC P+PQVVHPIHDQ FYLT EHK++LKEEYGIEPWTF+QKLGDAV IPAGCPHQVR
Sbjct  743  RHIHCCPLPQVVHPIHDQTFYLTWEHKRKLKEEYGIEPWTFVQKLGDAVLIPAGCPHQVR  802

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
            NLKSC KVAVDFVSPEN+ EC RLT+ FR LP NH  KEDKLEVKKM+I AV +ALKD+
Sbjct  803  NLKSCTKVAVDFVSPENVGECFRLTKEFRLLPPNHPTKEDKLEVKKMVIHAVNQALKDL  861



>ref|XP_008232371.1| PREDICTED: uncharacterized protein LOC103331520 [Prunus mume]
Length=1323

 Score =   208 bits (529),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C P+PQV+HPIHDQ FYLT+EHK++LKEEYGIEPWTFIQKLGDAV IPAGCPHQVR
Sbjct  821  RHTYCCPLPQVIHPIHDQTFYLTLEHKRKLKEEYGIEPWTFIQKLGDAVLIPAGCPHQVR  880

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA++FVSPEN+ EC+RLT+ FRTLPQNHRAKEDKLEVKKMI+ +V+  +KD++
Sbjct  881  NLKSCIKVALEFVSPENVGECIRLTDEFRTLPQNHRAKEDKLEVKKMIVHSVRWLVKDLD  940

Query  248  K  246
            +
Sbjct  941  Q  941



>ref|XP_007210952.1| hypothetical protein PRUPE_ppa024079mg, partial [Prunus persica]
 gb|EMJ12151.1| hypothetical protein PRUPE_ppa024079mg, partial [Prunus persica]
Length=962

 Score =   206 bits (523),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH HC P+ QV+HPIHDQ FYLT+EHKK+LKEEYGIEPWTF+Q LGDAVFIPAGCPHQVR
Sbjct  837  RHTHCCPLQQVIHPIHDQTFYLTLEHKKKLKEEYGIEPWTFVQNLGDAVFIPAGCPHQVR  896

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPEN+ EC R+TE FR LPQNHRAKEDKLEVKKMI+ AV + +    
Sbjct  897  NLKSCIKVAMDFVSPENVSECFRMTEEFRKLPQNHRAKEDKLEVKKMIVHAVNDLMSSDP  956

Query  248  KLTL  237
            K  L
Sbjct  957  KARL  960



>ref|XP_010655371.1| PREDICTED: lysine-specific demethylase JMJ25-like [Vitis vinifera]
 ref|XP_010655372.1| PREDICTED: lysine-specific demethylase JMJ25-like [Vitis vinifera]
 ref|XP_010655373.1| PREDICTED: lysine-specific demethylase JMJ25-like [Vitis vinifera]
Length=881

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH+ C PV +VVHPIHDQ+FYLT+EHKK+LKEEYGIEPWTF Q++G+AVFIPAGCPHQVR
Sbjct  757  RHVFCSPVNRVVHPIHDQSFYLTLEHKKKLKEEYGIEPWTFEQRIGEAVFIPAGCPHQVR  816

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
            NLKSC KVAVDFVSPENIHEC+RLTE FR LP+NHR +EDKLE+KKMI+ AV ++LKD 
Sbjct  817  NLKSCTKVAVDFVSPENIHECIRLTEEFRQLPKNHRVREDKLEIKKMIVYAVAQSLKDF  875



>ref|XP_006584086.1| PREDICTED: uncharacterized protein LOC100797860 [Glycine max]
 gb|KHN35715.1| Lysine-specific demethylase 3B [Glycine soja]
Length=889

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV QVVHPIHDQ FYLT+EHKK+LKEE+G+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  764  RHTYCSPVEQVVHPIHDQCFYLTLEHKKKLKEEFGVEPWTFEQKLGEAVFIPAGCPHQVR  823

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVAVDFVSPENI EC+RLT  FR LP+NH+A+EDKLE+KKMI+ AV +A+KD++
Sbjct  824  NLKSCIKVAVDFVSPENIRECLRLTNEFRQLPKNHKAREDKLEIKKMIVYAVDQAVKDLK  883

Query  248  KL  243
             L
Sbjct  884  DL  885



>ref|XP_008373436.1| PREDICTED: uncharacterized protein LOC103436763 [Malus domestica]
Length=778

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH HC P+ QV+HPIHDQ FYLTVEHKK+LKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR
Sbjct  621  RHTHCCPLQQVIHPIHDQTFYLTVEHKKKLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  680

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPEN+ EC ++TE FR LP NHRAKEDKLEVKKMI+ AV++AL
Sbjct  681  NLKSCIKVALDFVSPENVSECFQMTEEFRKLPPNHRAKEDKLEVKKMIVHAVEDAL  736



>ref|XP_008384091.1| PREDICTED: uncharacterized protein LOC103446740 isoform X2 [Malus 
domestica]
Length=890

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V+HPIHDQ+FYLT+EHK+RLKEE+G+EPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  746  RHTYCSLVEKVIHPIHDQSFYLTLEHKRRLKEEFGVEPWTFVQRLGEAVFIPAGCPHQVR  805

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPEN+HEC+RLTE FR LP+NHRA+EDKLE+KKMI+ A  +A+KD E
Sbjct  806  NLKSCTKVAADFVSPENVHECLRLTEEFRQLPKNHRAREDKLEIKKMILYAADQAVKDFE  865

Query  248  KLT  240
             L 
Sbjct  866  SLA  868



>ref|XP_008384090.1| PREDICTED: uncharacterized protein LOC103446740 isoform X1 [Malus 
domestica]
Length=891

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V+HPIHDQ+FYLT+EHK+RLKEE+G+EPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  747  RHTYCSLVEKVIHPIHDQSFYLTLEHKRRLKEEFGVEPWTFVQRLGEAVFIPAGCPHQVR  806

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPEN+HEC+RLTE FR LP+NHRA+EDKLE+KKMI+ A  +A+KD E
Sbjct  807  NLKSCTKVAADFVSPENVHECLRLTEEFRQLPKNHRAREDKLEIKKMILYAADQAVKDFE  866

Query  248  KLT  240
             L 
Sbjct  867  SLA  869



>emb|CDP04436.1| unnamed protein product [Coffea canephora]
Length=1139

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +C PV QV+HPIHDQ+FYLT+EHK++LKEEYGIEPWTF Q++G+AVFIPAGCPHQVR
Sbjct  1005  RHTYCCPVDQVIHPIHDQSFYLTMEHKRKLKEEYGIEPWTFEQRIGEAVFIPAGCPHQVR  1064

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC KVA DFVSPEN+HEC+RLTE FR LP+NH+A+EDKLEVKKMI+  V +A++++E
Sbjct  1065  NLKSCTKVAADFVSPENLHECLRLTEEFRRLPKNHKAREDKLEVKKMIVHGVNQAVQELE  1124

Query  248   KLT  240
             +LT
Sbjct  1125  QLT  1127



>ref|XP_010099167.1| Lysine-specific demethylase 3B [Morus notabilis]
 gb|EXB77039.1| Lysine-specific demethylase 3B [Morus notabilis]
Length=867

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV +V HPIHDQ+FYL+  HKK+LKEEYG+EPWTF Q+LG+AVFIPAGCPHQVR
Sbjct  745  RHTYCSPVQRVDHPIHDQSFYLSSAHKKKLKEEYGVEPWTFEQRLGEAVFIPAGCPHQVR  804

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENIHEC+RLTE FR LP+NHRA+EDKLE+KKM I AV  ALKD+E
Sbjct  805  NLKSCTKVAVDFVSPENIHECLRLTEEFRQLPKNHRAREDKLEIKKMAIYAVDHALKDLE  864

Query  248  KL  243
             L
Sbjct  865  DL  866



>ref|XP_002518433.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43820.1| conserved hypothetical protein [Ricinus communis]
Length=1122

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +C PV +VVHPIHDQ FYLT+EHK++LKEEYG+EPWTF Q++G+A+FIPAGCPHQVR
Sbjct  994   RHTYCSPVEKVVHPIHDQCFYLTLEHKRKLKEEYGVEPWTFEQRVGEAIFIPAGCPHQVR  1053

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC KVAVDFVSPENIHEC+ LTE FR LP+NHRA+EDKLE+KKMI+ AV++A+KD++
Sbjct  1054  NLKSCTKVAVDFVSPENIHECLLLTEEFRQLPKNHRAREDKLEIKKMIVYAVEQAIKDLQ  1113

Query  248   KL  243
             K+
Sbjct  1114  KV  1115



>ref|XP_006417283.1| hypothetical protein EUTSA_v10006772mg [Eutrema salsugineum]
 gb|ESQ35636.1| hypothetical protein EUTSA_v10006772mg [Eutrema salsugineum]
Length=863

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV +V HPIHDQ+F+LTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  737  RHTYCSPVTKVDHPIHDQSFFLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  796

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENIHEC+RLTE FR LP+ H+A+EDKLE+KKM+I AV++ALK++E
Sbjct  797  NLKSCTKVAVDFVSPENIHECLRLTEEFRQLPKKHKAREDKLEIKKMVIYAVEQALKELE  856

Query  248  KL  243
             L
Sbjct  857  TL  858



>gb|KEH42474.1| transcription factor jumonji (JmjC) domain protein [Medicago 
truncatula]
Length=890

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++C P+ QVVHPIHDQ FYLT+EHKKRLKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  760  RHVYCSPLKQVVHPIHDQTFYLTIEHKKRLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  819

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPEN+ EC RLTE FR LP NH++ EDKLEVKKMII A+ + +K +E
Sbjct  820  NLKSCTKVALDFVSPENVGECFRLTEEFRKLPVNHKSAEDKLEVKKMIIYAMVDLVKKLE  879

Query  248  K  246
            K
Sbjct  880  K  880



>ref|XP_009592859.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Nicotiana tomentosiformis]
Length=1168

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+PQVVHPIHD+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AVFIPAGCPHQ+R
Sbjct  733  RHIYGSPLPQVVHPIHDKTFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVFIPAGCPHQIR  792

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDFVSPEN++EC+RLTE FR LP+NH A+EDKLEVKK+I+ AV +AL  +E
Sbjct  793  NLKSCINVAVDFVSPENVNECIRLTEEFRKLPRNHDAREDKLEVKKIILHAVSQALDHLE  852

Query  248  KLTL  237
            K TL
Sbjct  853  KTTL  856



>ref|XP_009769192.1| PREDICTED: lysine-specific demethylase JMJ25-like [Nicotiana 
sylvestris]
Length=1155

 Score =   206 bits (524),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 93/124 (75%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+PQVVHPIHD+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AVFIPAGCPHQ+R
Sbjct  719  RHIYGSPLPQVVHPIHDKTFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVFIPAGCPHQIR  778

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDFVSPEN++EC+RLTE FR LP+NH A+EDKLEVKK+I+ AV +AL  +E
Sbjct  779  NLKSCINVAVDFVSPENVNECIRLTEEFRKLPRNHDAREDKLEVKKIILHAVSQALDHLE  838

Query  248  KLTL  237
            K TL
Sbjct  839  KTTL  842



>ref|XP_009392239.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=1201

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH+HC PV QV+HPIHDQ+FYLT+EHK++LK EYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  1057  RHVHCSPVEQVIHPIHDQSFYLTMEHKRKLKAEYGIEPWTFEQKLGEAVFIPAGCPHQVR  1116

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPENI EC+RLTE FRTLP  HRAKEDKLEVKKM + A+K+ +K++ 
Sbjct  1117  NLKSCIKVALDFVSPENIRECIRLTEEFRTLPDEHRAKEDKLEVKKMALLALKQVIKELN  1176

Query  248   KL  243
              L
Sbjct  1177  DL  1178



>ref|XP_009592864.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X6 
[Nicotiana tomentosiformis]
 ref|XP_009592865.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X6 
[Nicotiana tomentosiformis]
Length=1048

 Score =   206 bits (523),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 92/124 (74%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+PQVVHPIHD+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AVFIPAGCPHQ+R
Sbjct  612  RHIYGSPLPQVVHPIHDKTFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVFIPAGCPHQIR  671

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDFVSPEN++EC+RLTE FR LP+NH A+EDKLEVKK+I+ AV +AL  +E
Sbjct  672  NLKSCINVAVDFVSPENVNECIRLTEEFRKLPRNHDAREDKLEVKKIILHAVSQALDHLE  731

Query  248  KLTL  237
            K T 
Sbjct  732  KTTF  735



>ref|XP_007142780.1| hypothetical protein PHAVU_007G016300g [Phaseolus vulgaris]
 gb|ESW14774.1| hypothetical protein PHAVU_007G016300g [Phaseolus vulgaris]
Length=1048

 Score =   206 bits (523),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+ QV+HPIHDQ FYLTVEHK++LKEE+GIEPWTFIQKLGDAVFIPAGCPHQVR
Sbjct  911   RHIHCSPLKQVIHPIHDQTFYLTVEHKRKLKEEFGIEPWTFIQKLGDAVFIPAGCPHQVR  970

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC RLTE FRTLP NH + EDKLEVKKM I A+++ +  +E
Sbjct  971   NLKSCIKVALDFVSPENVGECFRLTEEFRTLPINHGSAEDKLEVKKMTIYAMQDVVTKLE  1030



>ref|XP_009592863.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X5 
[Nicotiana tomentosiformis]
Length=1061

 Score =   206 bits (523),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 92/124 (74%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+PQVVHPIHD+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AVFIPAGCPHQ+R
Sbjct  625  RHIYGSPLPQVVHPIHDKTFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVFIPAGCPHQIR  684

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDFVSPEN++EC+RLTE FR LP+NH A+EDKLEVKK+I+ AV +AL  +E
Sbjct  685  NLKSCINVAVDFVSPENVNECIRLTEEFRKLPRNHDAREDKLEVKKIILHAVSQALDHLE  744

Query  248  KLTL  237
            K T 
Sbjct  745  KTTF  748



>ref|XP_009592860.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X3 
[Nicotiana tomentosiformis]
Length=1064

 Score =   206 bits (523),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 92/124 (74%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+PQVVHPIHD+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AVFIPAGCPHQ+R
Sbjct  628  RHIYGSPLPQVVHPIHDKTFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVFIPAGCPHQIR  687

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDFVSPEN++EC+RLTE FR LP+NH A+EDKLEVKK+I+ AV +AL  +E
Sbjct  688  NLKSCINVAVDFVSPENVNECIRLTEEFRKLPRNHDAREDKLEVKKIILHAVSQALDHLE  747

Query  248  KLTL  237
            K T 
Sbjct  748  KTTF  751



>ref|XP_007142779.1| hypothetical protein PHAVU_007G016300g [Phaseolus vulgaris]
 gb|ESW14773.1| hypothetical protein PHAVU_007G016300g [Phaseolus vulgaris]
Length=1050

 Score =   205 bits (522),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+ QV+HPIHDQ FYLTVEHK++LKEE+GIEPWTFIQKLGDAVFIPAGCPHQVR
Sbjct  913   RHIHCSPLKQVIHPIHDQTFYLTVEHKRKLKEEFGIEPWTFIQKLGDAVFIPAGCPHQVR  972

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC RLTE FRTLP NH + EDKLEVKKM I A+++ +  +E
Sbjct  973   NLKSCIKVALDFVSPENVGECFRLTEEFRTLPINHGSAEDKLEVKKMTIYAMQDVVTKLE  1032



>ref|XP_010473447.1| PREDICTED: lysine-specific demethylase JMJ25-like [Camelina sativa]
Length=920

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV +V HPIHDQ  YLTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  790  RHTYCCPVTKVYHPIHDQTCYLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  849

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENIHEC+RLTE FR LP+NH+A+EDKLE+KKM+I A+++ALK++E
Sbjct  850  NLKSCTKVAVDFVSPENIHECLRLTEEFRQLPKNHKAREDKLEIKKMVIYAIEQALKELE  909

Query  248  KLTLE*R  228
             L  E R
Sbjct  910  TLPEETR  916



>ref|XP_009392240.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=1183

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH+HC PV QV+HPIHDQ+FYLT+EHK++LK EYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  1057  RHVHCSPVEQVIHPIHDQSFYLTMEHKRKLKAEYGIEPWTFEQKLGEAVFIPAGCPHQVR  1116

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPENI EC+RLTE FRTLP  HRAKEDKLEVKKM + A+K+ +K++ 
Sbjct  1117  NLKSCIKVALDFVSPENIRECIRLTEEFRTLPDEHRAKEDKLEVKKMALLALKQVIKELN  1176

Query  248   KL  243
              L
Sbjct  1177  DL  1178



>ref|XP_009110682.1| PREDICTED: uncharacterized protein LOC103836196 [Brassica rapa]
 ref|XP_009110683.1| PREDICTED: uncharacterized protein LOC103836196 [Brassica rapa]
Length=852

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV +V HPIHDQ  +LTVEHK++LK E+GIEPWTF+QK+G+AVFIPAGCPHQVR
Sbjct  722  RHTYCSPVTKVYHPIHDQTLFLTVEHKRKLKAEFGIEPWTFVQKVGEAVFIPAGCPHQVR  781

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENIHEC+RLTE FR LP+NH+A+EDKLEVKKM+I AV+++LK++E
Sbjct  782  NLKSCTKVAVDFVSPENIHECLRLTEEFRQLPKNHKAREDKLEVKKMVIYAVEQSLKEVE  841

Query  248  KL  243
             L
Sbjct  842  TL  843



>ref|XP_011460015.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=894

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V+HPIHDQ+FYLTV+HK++LKEE+GIEPWTF+Q LG+AVFIPAGCPHQVR
Sbjct  768  RHTYCSLVERVIHPIHDQSFYLTVDHKRKLKEEFGIEPWTFVQSLGEAVFIPAGCPHQVR  827

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPEN+HEC+RLT+ FR LP+NHRA+EDKLE+KKMI+ AV  A+KD+E
Sbjct  828  NLKSCTKVAVDFVSPENVHECLRLTKDFRQLPKNHRAREDKLEIKKMILYAVDHAVKDLE  887

Query  248  KL  243
             L
Sbjct  888  AL  889



>ref|XP_011460014.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=895

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V+HPIHDQ+FYLTV+HK++LKEE+GIEPWTF+Q LG+AVFIPAGCPHQVR
Sbjct  769  RHTYCSLVERVIHPIHDQSFYLTVDHKRKLKEEFGIEPWTFVQSLGEAVFIPAGCPHQVR  828

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPEN+HEC+RLT+ FR LP+NHRA+EDKLE+KKMI+ AV  A+KD+E
Sbjct  829  NLKSCTKVAVDFVSPENVHECLRLTKDFRQLPKNHRAREDKLEIKKMILYAVDHAVKDLE  888

Query  248  KL  243
             L
Sbjct  889  AL  890



>ref|XP_009592861.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X4 
[Nicotiana tomentosiformis]
 ref|XP_009592862.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X4 
[Nicotiana tomentosiformis]
Length=1063

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+PQVVHPIHD+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AVFIPAGCPHQ+R
Sbjct  627  RHIYGSPLPQVVHPIHDKTFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVFIPAGCPHQIR  686

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDFVSPEN++EC+RLTE FR LP+NH A+EDKLEVKK+I+ AV +AL  +E
Sbjct  687  NLKSCINVAVDFVSPENVNECIRLTEEFRKLPRNHDAREDKLEVKKIILHAVSQALDHLE  746

Query  248  KLTL  237
            K T 
Sbjct  747  KTTF  750



>ref|XP_006484521.1| PREDICTED: uncharacterized protein LOC102628262 [Citrus sinensis]
Length=1119

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC PV QV+HPIHDQ FYL+ EHK +LK+EYGIEPWTFIQKLG+AVF+PAGCPHQVR
Sbjct  987   RHIHCCPVQQVIHPIHDQVFYLSSEHKAKLKQEYGIEPWTFIQKLGEAVFVPAGCPHQVR  1046

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
             NLKSC+K A+DFVSPEN+ +C+RLTE FR LP NHRAKEDKLEVKKMI+ AV +A+KDI
Sbjct  1047  NLKSCIKAALDFVSPENVSQCVRLTEEFRLLPPNHRAKEDKLEVKKMILYAVSQAVKDI  1105



>ref|XP_006437606.1| hypothetical protein CICLE_v10030567mg [Citrus clementina]
 gb|ESR50846.1| hypothetical protein CICLE_v10030567mg [Citrus clementina]
Length=1117

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC PV QV+HPIHDQ FYL+ EHK +LK+EYGIEPWTFIQKLG+AVF+PAGCPHQVR
Sbjct  987   RHIHCCPVQQVIHPIHDQVFYLSSEHKAKLKQEYGIEPWTFIQKLGEAVFVPAGCPHQVR  1046

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
             NLKSC+K A+DFVSPEN+ +C+RLTE FR LP NHRAKEDKLEVKKMI+ AV +A+KDI
Sbjct  1047  NLKSCIKAALDFVSPENVSQCVRLTEEFRLLPPNHRAKEDKLEVKKMILYAVSQAVKDI  1105



>emb|CDY21024.1| BnaA08g25010D [Brassica napus]
Length=850

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV +V HPIHDQ  +LTVEHK++LK E+GIEPWTF+QK+G+AVFIPAGCPHQVR
Sbjct  720  RHTYCSPVTKVYHPIHDQTLFLTVEHKRKLKAEFGIEPWTFVQKVGEAVFIPAGCPHQVR  779

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENIHEC+RLTE FR LP+NH+A+EDKLEVKKM+I AV+++LK++E
Sbjct  780  NLKSCTKVAVDFVSPENIHECLRLTEEFRQLPKNHKAREDKLEVKKMVIYAVEQSLKEVE  839

Query  248  KL  243
             L
Sbjct  840  TL  841



>gb|EYU27724.1| hypothetical protein MIMGU_mgv1a000745mg [Erythranthe guttata]
Length=997

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV QV+HP+HDQ FYLT EHK +LKEEYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  870  RHTYCCPVNQVIHPVHDQTFYLTSEHKLKLKEEYGIEPWTFEQKLGEAVFIPAGCPHQVR  929

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPEN+HEC+RLTE FR LP+ HRA+EDKLE+KKMI+ AV +A++D+E
Sbjct  930  NLKSCTKVAADFVSPENLHECLRLTEEFRKLPREHRAREDKLEIKKMILHAVDKAVEDLE  989

Query  248  KLT  240
            +LT
Sbjct  990  ELT  992



>ref|XP_009592868.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X8 
[Nicotiana tomentosiformis]
Length=943

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+PQVVHPIHD+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AVFIPAGCPHQ+R
Sbjct  733  RHIYGSPLPQVVHPIHDKTFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVFIPAGCPHQIR  792

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDFVSPEN++EC+RLTE FR LP+NH A+EDKLEVKK+I+ AV +AL  +E
Sbjct  793  NLKSCINVAVDFVSPENVNECIRLTEEFRKLPRNHDAREDKLEVKKIILHAVSQALDHLE  852

Query  248  KLTL  237
            K TL
Sbjct  853  KTTL  856



>ref|XP_009386690.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=955

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC P+ QV HPIHDQ FYLT+EHK++LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  831  RHIHCSPLHQVTHPIHDQTFYLTLEHKRKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  890

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPENI EC+ L +  R LP NHR KEDKLEVKKM+I AV++ +KD+E
Sbjct  891  NLKSCIKVALDFVSPENIKECVHLADEIRVLPTNHRGKEDKLEVKKMVIYAVQQVIKDLE  950

Query  248  KL  243
            +L
Sbjct  951  EL  952



>ref|XP_007026157.1| Transcription factor jumonji domain-containing protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY28779.1| Transcription factor jumonji domain-containing protein, putative 
isoform 1 [Theobroma cacao]
Length=918

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV QV+HPIHDQ+FYLT+EHK++LKEE+G+EPWTF Q LG+AVFIPAGCPHQVR
Sbjct  789  RHTYCSPVEQVIHPIHDQSFYLTMEHKRKLKEEFGVEPWTFEQHLGEAVFIPAGCPHQVR  848

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENI EC+RLTE FR LP+NHRA+EDKLE+KKMII  V+ A+K++E
Sbjct  849  NLKSCTKVAVDFVSPENIKECLRLTEEFRQLPKNHRAREDKLEIKKMIIYGVERAIKELE  908

Query  248  KL  243
            +L
Sbjct  909  EL  910



>ref|XP_003610469.1| Lysine-specific demethylase 3A-B [Medicago truncatula]
 gb|AES92666.1| transcription factor jumonji (JmjC) domain protein [Medicago 
truncatula]
Length=870

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV QVVHPIHDQ FYLT+EHK +LKEE+G+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  745  RHTYCSPVEQVVHPIHDQCFYLTLEHKNKLKEEFGVEPWTFEQKLGEAVFIPAGCPHQVR  804

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPEN+HEC+RLTE FR LP+ H+A+EDKLE++KMI+ A+ +A+KD+E
Sbjct  805  NLKSCTKVAVDFVSPENVHECLRLTEEFRQLPKKHKAREDKLEIQKMIVYAIDQAVKDLE  864

Query  248  KL  243
             L
Sbjct  865  AL  866



>ref|XP_007022717.1| Transcription factor jumonji domain-containing protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOY14242.1| Transcription factor jumonji domain-containing protein, putative 
isoform 3 [Theobroma cacao]
Length=738

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++  PV QVVHPIHDQ FYLT+ HK++LKEE+G+EPWT +QKLG+A+FIPAGCPHQVR
Sbjct  615  RHVYGSPVDQVVHPIHDQTFYLTMHHKRKLKEEFGVEPWTIVQKLGEAIFIPAGCPHQVR  674

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPENIHEC+RLTE FR LP NHRAKEDKLEVKKM++ A+  A++++E
Sbjct  675  NLKSCIKVALDFVSPENIHECIRLTEEFRVLPHNHRAKEDKLEVKKMMLHALNYAVEELE  734

Query  248  KLT  240
            KLT
Sbjct  735  KLT  737



>ref|XP_009592858.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Nicotiana tomentosiformis]
Length=1169

 Score =   205 bits (521),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+PQVVHPIHD+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AVFIPAGCPHQ+R
Sbjct  733  RHIYGSPLPQVVHPIHDKTFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVFIPAGCPHQIR  792

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDFVSPEN++EC+RLTE FR LP+NH A+EDKLEVKK+I+ AV +AL  +E
Sbjct  793  NLKSCINVAVDFVSPENVNECIRLTEEFRKLPRNHDAREDKLEVKKIILHAVSQALDHLE  852

Query  248  KLTL  237
            K T 
Sbjct  853  KTTF  856



>ref|XP_003619259.1| Lysine-specific demethylase 3A-B [Medicago truncatula]
Length=864

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV QVVHPIHDQ FYLT+EHK +LKEE+G+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  739  RHTYCSPVEQVVHPIHDQCFYLTLEHKNKLKEEFGVEPWTFEQKLGEAVFIPAGCPHQVR  798

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPEN+HEC+RLTE FR LP+ H+A+EDKLE++KMI+ A+ +A+KD+E
Sbjct  799  NLKSCTKVAVDFVSPENVHECLRLTEEFRQLPKKHKAREDKLEIQKMIVYAIDQAVKDLE  858

Query  248  KL  243
             L
Sbjct  859  AL  860



>ref|XP_004507665.1| PREDICTED: uncharacterized protein LOC101492686 [Cicer arietinum]
Length=876

 Score =   203 bits (516),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V QVVHPIHDQ FYL +EHKK+LKEE+G+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  751  RHTYCSRVKQVVHPIHDQCFYLNLEHKKKLKEEFGVEPWTFEQKLGEAVFIPAGCPHQVR  810

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPEN+HEC+RLTE FR LP+NH+A+EDKLE+KKMI+ AV +A+KD++
Sbjct  811  NLKSCTKVAVDFVSPENVHECLRLTEEFRQLPKNHKAREDKLEIKKMIVYAVDQAVKDLK  870

Query  248  KL  243
             L
Sbjct  871  AL  872



>gb|KDP37515.1| hypothetical protein JCGZ_05954 [Jatropha curcas]
Length=1057

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+ +VVHPIHDQ FYLT+EHK+RLKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  905   RHIHCCPLQKVVHPIHDQTFYLTLEHKRRLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  964

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP NHRAKEDKLEVKKM + A+K A++ +E
Sbjct  965   NLKSCIKVAMDFVSPENVGECIRLTEEFRVLPPNHRAKEDKLEVKKMYLHAMKWAVEVLE  1024



>ref|XP_011099649.1| PREDICTED: lysine-specific demethylase JMJ25-like [Sesamum indicum]
Length=1092

 Score =   204 bits (520),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHI+   + QVVHPIHDQ  YLT+EHK+RLKEE+GIEPWTFIQKLGDAVFIPAGCPHQVR
Sbjct  967   RHIYGNQLSQVVHPIHDQTVYLTMEHKRRLKEEHGIEPWTFIQKLGDAVFIPAGCPHQVR  1026

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LPQNHR+KEDKLEVKKM + A+ +A++D+E
Sbjct  1027  NLKSCIKVALDFVSPENVQECVRLTEEFRVLPQNHRSKEDKLEVKKMTLHAIGQAVEDLE  1086

Query  248   KLT  240
             K++
Sbjct  1087  KVS  1089



>gb|KDO78327.1| hypothetical protein CISIN_1g002333mg [Citrus sinensis]
Length=723

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++C PV QV+HPIHDQ FYL+ EHKK+LKEE+G+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  597  RHVYCSPVEQVIHPIHDQCFYLSSEHKKKLKEEFGVEPWTFEQKLGEAVFIPAGCPHQVR  656

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPEN+ EC+RLT+ FR LP+NHRA+EDKLE+KKMI+ AV +A+KD  
Sbjct  657  NLKSCTKVAVDFVSPENVDECLRLTKEFRLLPKNHRAREDKLEIKKMILYAVAQAIKDAN  716

Query  248  KL  243
             L
Sbjct  717  SL  718



>ref|XP_008805590.1| PREDICTED: uncharacterized protein LOC103718506 isoform X3 [Phoenix 
dactylifera]
Length=964

 Score =   203 bits (517),  Expect = 7e-57, Method: Composition-based stats.
 Identities = 89/124 (72%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV QV +P+HD+ FYLT+EHK++LKEE+G+EPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  834  RHIYCSPVEQVFNPVHDETFYLTIEHKRKLKEEFGVEPWTFVQRLGEAVFIPAGCPHQVR  893

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPEN+ EC+RLT+ FR LP+NHRAKEDKLEVKKMI+ AV  A+K ++
Sbjct  894  NLKSCTKVALDFVSPENVGECIRLTDNFRLLPKNHRAKEDKLEVKKMIVHAVAHAVKTLQ  953

Query  248  KLTL  237
            +L L
Sbjct  954  ELPL  957



>ref|XP_008805589.1| PREDICTED: uncharacterized protein LOC103718506 isoform X2 [Phoenix 
dactylifera]
Length=973

 Score =   203 bits (517),  Expect = 7e-57, Method: Composition-based stats.
 Identities = 89/124 (72%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV QV +P+HD+ FYLT+EHK++LKEE+G+EPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  843  RHIYCSPVEQVFNPVHDETFYLTIEHKRKLKEEFGVEPWTFVQRLGEAVFIPAGCPHQVR  902

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPEN+ EC+RLT+ FR LP+NHRAKEDKLEVKKMI+ AV  A+K ++
Sbjct  903  NLKSCTKVALDFVSPENVGECIRLTDNFRLLPKNHRAKEDKLEVKKMIVHAVAHAVKTLQ  962

Query  248  KLTL  237
            +L L
Sbjct  963  ELPL  966



>ref|XP_008805587.1| PREDICTED: uncharacterized protein LOC103718506 isoform X1 [Phoenix 
dactylifera]
Length=973

 Score =   203 bits (517),  Expect = 7e-57, Method: Composition-based stats.
 Identities = 89/124 (72%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV QV +P+HD+ FYLT+EHK++LKEE+G+EPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  843  RHIYCSPVEQVFNPVHDETFYLTIEHKRKLKEEFGVEPWTFVQRLGEAVFIPAGCPHQVR  902

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPEN+ EC+RLT+ FR LP+NHRAKEDKLEVKKMI+ AV  A+K ++
Sbjct  903  NLKSCTKVALDFVSPENVGECIRLTDNFRLLPKNHRAKEDKLEVKKMIVHAVAHAVKTLQ  962

Query  248  KLTL  237
            +L L
Sbjct  963  ELPL  966



>ref|XP_009592866.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X7 
[Nicotiana tomentosiformis]
Length=944

 Score =   203 bits (516),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+PQVVHPIHD+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AVFIPAGCPHQ+R
Sbjct  733  RHIYGSPLPQVVHPIHDKTFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVFIPAGCPHQIR  792

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDFVSPEN++EC+RLTE FR LP+NH A+EDKLEVKK+I+ AV +AL  +E
Sbjct  793  NLKSCINVAVDFVSPENVNECIRLTEEFRKLPRNHDAREDKLEVKKIILHAVSQALDHLE  852

Query  248  KLTL  237
            K T 
Sbjct  853  KTTF  856



>gb|KJB81461.1| hypothetical protein B456_013G146800 [Gossypium raimondii]
Length=728

 Score =   201 bits (512),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++C PV QVVHPIHDQ FYL + HK++LKEE+G+EPWT IQKLG+A+FIPAGCPHQVR
Sbjct  605  RHVYCSPVDQVVHPIHDQTFYLNMHHKRKLKEEFGVEPWTIIQKLGEAIFIPAGCPHQVR  664

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPENIHEC+RLTE FR LP  HR+KEDKLEVKKM++ A+K A++++E
Sbjct  665  NLKSCTKVALDFVSPENIHECIRLTEEFRVLPHEHRSKEDKLEVKKMMLHALKYAVEELE  724

Query  248  KLT  240
            KLT
Sbjct  725  KLT  727



>ref|XP_006467395.1| PREDICTED: uncharacterized protein LOC102618372 isoform X7 [Citrus 
sinensis]
Length=937

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++C PV QV+HPIHDQ FYL+ EHKK+LKEE+G+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  811  RHVYCSPVEQVIHPIHDQCFYLSSEHKKKLKEEFGVEPWTFEQKLGEAVFIPAGCPHQVR  870

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPEN+ EC+RLT+ FR LP+NHRA+EDKLE+KKMI+ AV +A+KD  
Sbjct  871  NLKSCTKVAVDFVSPENVDECLRLTKEFRLLPKNHRAREDKLEIKKMILYAVAQAIKDAN  930

Query  248  KL  243
             L
Sbjct  931  SL  932



>gb|KDP20708.1| hypothetical protein JCGZ_21179 [Jatropha curcas]
Length=547

 Score =   199 bits (505),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV QV HPIHDQ FYLT EHKK+LKEE+ +EPW+F Q++G+AVFIPAGCPHQVR
Sbjct  404  RHTYCCPVEQVAHPIHDQCFYLTSEHKKKLKEEFEVEPWSFGQRVGEAVFIPAGCPHQVR  463

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPEN+HEC RLTE FR LP+NH+A+EDKLEVKKMII A++ A+KD++
Sbjct  464  NLKSCTKVAVDFVSPENLHECFRLTEEFRQLPKNHKAREDKLEVKKMIIYAIEHAVKDLK  523

Query  248  KLTLE*RDGNKLT  210
            +L L    G++ T
Sbjct  524  ELIL--SSGDEFT  534



>ref|XP_010430273.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Camelina sativa]
 ref|XP_010430274.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Camelina sativa]
 ref|XP_010430275.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Camelina sativa]
Length=905

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV +V HPIHD   YLTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  775  RHTYCCPVTKVYHPIHDHTCYLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  834

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENIHEC+RLTE FR LP+NH+A+EDKLE+KKM+I A+++ALK++E
Sbjct  835  NLKSCTKVAVDFVSPENIHECLRLTEEFRQLPKNHKAREDKLEIKKMVIYAIEQALKELE  894

Query  248  KLTLE*R  228
             L  E R
Sbjct  895  TLPEETR  901



>ref|XP_010244125.1| PREDICTED: lysine-specific demethylase JMJ25-like [Nelumbo nucifera]
Length=923

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV QV+HPIHDQAFYLT+EHK++LKEE+G+EPWTF Q++G+AVFIPAGCPHQVR
Sbjct  797  RHIYCSPVEQVIHPIHDQAFYLTLEHKRKLKEEFGVEPWTFEQRVGEAVFIPAGCPHQVR  856

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPENIH+C  L++ FR LP+NHRA+EDKLEVKKMI+ AV +A+KD++
Sbjct  857  NLKSCTKVALDFVSPENIHQCFLLSDEFRQLPKNHRAREDKLEVKKMILHAVNQAVKDLQ  916

Query  248  KL  243
             L
Sbjct  917  DL  918



>ref|XP_010678589.1| PREDICTED: lysine-specific demethylase JMJ25-like [Beta vulgaris 
subsp. vulgaris]
Length=1189

 Score =   204 bits (519),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 93/119 (78%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHI+   V QVVHPIHDQ FYLT EHK++LKEEYG+EPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  1069  RHIYGSLVQQVVHPIHDQTFYLTEEHKRKLKEEYGVEPWTFVQKLGEAVFIPAGCPHQVR  1128

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
             NLKSC+KVA+DFVSPEN+ ECMRLTE FR LP NHRAKEDKLE+KKM   AV++ALKD+
Sbjct  1129  NLKSCIKVALDFVSPENVPECMRLTEEFRVLPPNHRAKEDKLEIKKMTFYAVEKALKDL  1187



>gb|KJB81463.1| hypothetical protein B456_013G146800 [Gossypium raimondii]
Length=771

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++C PV QVVHPIHDQ FYL + HK++LKEE+G+EPWT IQKLG+A+FIPAGCPHQVR
Sbjct  648  RHVYCSPVDQVVHPIHDQTFYLNMHHKRKLKEEFGVEPWTIIQKLGEAIFIPAGCPHQVR  707

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPENIHEC+RLTE FR LP  HR+KEDKLEVKKM++ A+K A++++E
Sbjct  708  NLKSCTKVALDFVSPENIHECIRLTEEFRVLPHEHRSKEDKLEVKKMMLHALKYAVEELE  767

Query  248  KLT  240
            KLT
Sbjct  768  KLT  770



>ref|NP_172659.3| transcription factor jumonji (jmjC) domain-containing protein 
[Arabidopsis thaliana]
 dbj|BAH30289.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28820.1| transcription factor jumonji (jmjC) domain-containing protein 
[Arabidopsis thaliana]
Length=875

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V HPIHDQ+++LTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  749  RHTYCSRVTKVYHPIHDQSYFLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  808

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENI EC+RLT+ FR LP+NH+A+EDKLE+KKM+I AV++ALK++E
Sbjct  809  NLKSCTKVAVDFVSPENIDECLRLTDEFRQLPKNHKAREDKLEIKKMVIYAVEQALKEVE  868

Query  248  KLTLE  234
             L L+
Sbjct  869  TLLLD  873



>ref|XP_002892666.1| transcription factor jumonji domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH68925.1| transcription factor jumonji domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=867

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH  C PV +V HPIHDQ+ +LTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  741  RHTFCSPVTKVYHPIHDQSCFLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  800

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENI EC+RLT+ FR LP+NH+A+EDKLE+KKM+I AV++ALK++E
Sbjct  801  NLKSCTKVAVDFVSPENIDECLRLTDEFRQLPKNHKAREDKLEIKKMVIYAVEQALKEVE  860

Query  248  KLTLE  234
             L L+
Sbjct  861  TLLLD  865



>ref|XP_010052876.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010052877.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010052878.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X3 [Eucalyptus 
grandis]
 gb|KCW77005.1| hypothetical protein EUGRSUZ_D01354 [Eucalyptus grandis]
Length=943

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C P+ +V+HPIHDQ+FYLT+EHK++LKEE+GIEPWTF Q LG+AVFIPAGCPHQVR
Sbjct  811  RHTYCAPIKEVIHPIHDQSFYLTLEHKRKLKEEFGIEPWTFEQHLGEAVFIPAGCPHQVR  870

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPENI EC+RLTE FR LP+NH+A+EDKLE+KKMII AV +A KD+E
Sbjct  871  NLKSCTKVAADFVSPENIGECLRLTEEFRQLPRNHKAREDKLEIKKMIIYAVDQATKDLE  930

Query  248  KL  243
             L
Sbjct  931  DL  932



>ref|XP_006449783.1| hypothetical protein CICLE_v10014405mg [Citrus clementina]
 gb|ESR63023.1| hypothetical protein CICLE_v10014405mg [Citrus clementina]
Length=723

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++C PV QV+HPIHDQ FYL+ EHKK+LKEE+G+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  597  RHVYCSPVEQVIHPIHDQCFYLSSEHKKKLKEEFGVEPWTFEQKLGEAVFIPAGCPHQVR  656

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPEN+ EC+RLT+ FR LP+NHRA+EDKLE++KMI+ AV +A+KD  
Sbjct  657  NLKSCTKVAVDFVSPENVDECLRLTKEFRLLPKNHRAREDKLEIQKMILYAVAQAIKDAN  716

Query  248  KL  243
             L
Sbjct  717  SL  718



>ref|XP_009357718.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Pyrus x bretschneideri]
Length=888

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +   V +V+HPIHDQ+FYLT+ HK+RLKEE+G+EPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  748  RHTYSSLVEKVIHPIHDQSFYLTLVHKQRLKEEFGVEPWTFVQRLGEAVFIPAGCPHQVR  807

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPEN+HEC+RLTE FR LP+NHRA+EDKLE+KKMI+ AV +A+KD+E
Sbjct  808  NLKSCTKVAVDFVSPENVHECLRLTEEFRQLPKNHRAREDKLEIKKMILYAVDQAVKDLE  867

Query  248  KL  243
             L
Sbjct  868  SL  869



>ref|XP_011081460.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Sesamum indicum]
Length=1260

 Score =   203 bits (517),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 93/124 (75%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIH  PV QVVHPIHDQ+ YLT  HK +LKEE+G+EPWTF+QKLG+AVFI AGCPHQVR
Sbjct  1107  RHIHGCPVEQVVHPIHDQSLYLTSYHKAKLKEEFGVEPWTFVQKLGEAVFISAGCPHQVR  1166

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTEGFRTLPQNHRAKEDKLEVKKM I A+++A+  ++
Sbjct  1167  NLKSCIKVALDFVSPENLGECIRLTEGFRTLPQNHRAKEDKLEVKKMAIYALQDAVSHLK  1226

Query  248   KLTL  237
              L L
Sbjct  1227  DLIL  1230



>ref|XP_011081459.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Sesamum indicum]
Length=1261

 Score =   203 bits (517),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 93/124 (75%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIH  PV QVVHPIHDQ+ YLT  HK +LKEE+G+EPWTF+QKLG+AVFI AGCPHQVR
Sbjct  1108  RHIHGCPVEQVVHPIHDQSLYLTSYHKAKLKEEFGVEPWTFVQKLGEAVFISAGCPHQVR  1167

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTEGFRTLPQNHRAKEDKLEVKKM I A+++A+  ++
Sbjct  1168  NLKSCIKVALDFVSPENLGECIRLTEGFRTLPQNHRAKEDKLEVKKMAIYALQDAVSHLK  1227

Query  248   KLTL  237
              L L
Sbjct  1228  DLIL  1231



>ref|XP_009357780.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Pyrus x bretschneideri]
Length=887

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +   V +V+HPIHDQ+FYLT+ HK+RLKEE+G+EPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  747  RHTYSSLVEKVIHPIHDQSFYLTLVHKQRLKEEFGVEPWTFVQRLGEAVFIPAGCPHQVR  806

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPEN+HEC+RLTE FR LP+NHRA+EDKLE+KKMI+ AV +A+KD+E
Sbjct  807  NLKSCTKVAVDFVSPENVHECLRLTEEFRQLPKNHRAREDKLEIKKMILYAVDQAVKDLE  866

Query  248  KL  243
             L
Sbjct  867  SL  868



>gb|KJB81462.1| hypothetical protein B456_013G146800 [Gossypium raimondii]
Length=840

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++C PV QVVHPIHDQ FYL + HK++LKEE+G+EPWT IQKLG+A+FIPAGCPHQVR
Sbjct  717  RHVYCSPVDQVVHPIHDQTFYLNMHHKRKLKEEFGVEPWTIIQKLGEAIFIPAGCPHQVR  776

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPENIHEC+RLTE FR LP  HR+KEDKLEVKKM++ A+K A++++E
Sbjct  777  NLKSCTKVALDFVSPENIHECIRLTEEFRVLPHEHRSKEDKLEVKKMMLHALKYAVEELE  836

Query  248  KLT  240
            KLT
Sbjct  837  KLT  839



>emb|CDY19538.1| BnaC09g13650D [Brassica napus]
Length=970

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH  C PV +V HPIHDQ+ YLTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  840  RHTFCCPVTKVYHPIHDQSCYLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  899

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENIHEC+RLTE FR LP+NH+A+EDKLE+KKM+I A+++ LK+ E
Sbjct  900  NLKSCTKVAVDFVSPENIHECLRLTEEFRQLPKNHKAREDKLEIKKMVIYAIEQTLKEFE  959

Query  248  KLTLE  234
             L+ E
Sbjct  960  MLSEE  964



>ref|XP_009113089.1| PREDICTED: uncharacterized protein LOC103838408 isoform X2 [Brassica 
rapa]
Length=949

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH  C PV +V HPIHDQ+ YLTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  827  RHTFCCPVTKVYHPIHDQSCYLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  886

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENIHEC+RLTE FR LP+NH+A+EDKLE+KKM+I A+++ LK+ E
Sbjct  887  NLKSCTKVAVDFVSPENIHECLRLTEEFRQLPKNHKAREDKLEIKKMVIYAIEQTLKEFE  946

Query  248  KLT  240
             L+
Sbjct  947  MLS  949



>ref|XP_010052875.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X2 [Eucalyptus 
grandis]
Length=1031

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +C P+ +V+HPIHDQ+FYLT+EHK++LKEE+GIEPWTF Q LG+AVFIPAGCPHQVR
Sbjct  899   RHTYCAPIKEVIHPIHDQSFYLTLEHKRKLKEEFGIEPWTFEQHLGEAVFIPAGCPHQVR  958

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC KVA DFVSPENI EC+RLTE FR LP+NH+A+EDKLE+KKMII AV +A KD+E
Sbjct  959   NLKSCTKVAADFVSPENIGECLRLTEEFRQLPRNHKAREDKLEIKKMIIYAVDQATKDLE  1018

Query  248   KL  243
              L
Sbjct  1019  DL  1020



>emb|CDY31229.1| BnaC08g15240D [Brassica napus]
Length=845

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV +V HPIHDQ  +LTVEHK++LK E+GIEPWTF+QK+G+AVFIPAGCPHQVR
Sbjct  719  RHTYCSPVTKVYHPIHDQTLFLTVEHKRKLKAEFGIEPWTFVQKVGEAVFIPAGCPHQVR  778

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENIHEC+RLTE FR LP++H+A+EDKLE+KKM+I AV+++LK++E
Sbjct  779  NLKSCTKVAVDFVSPENIHECLRLTEEFRQLPKSHKAREDKLEIKKMVIYAVEQSLKEME  838

Query  248  KL  243
             L
Sbjct  839  AL  840



>ref|XP_010533793.1| PREDICTED: lysine-specific demethylase JMJ25 [Tarenaya hassleriana]
Length=877

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH  C PV +V HPIHDQ FYLTVE K++LK EYGIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  742  RHTFCSPVVKVYHPIHDQTFYLTVEQKRKLKAEYGIEPWTFVQKLGEAVFIPAGCPHQVR  801

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENI EC+RLTE FR LP+NH+A+EDKLE+KKM+I A +EA K++E
Sbjct  802  NLKSCTKVAVDFVSPENIKECLRLTEEFRQLPKNHKAREDKLEIKKMVIYAAEEAFKELE  861

Query  248  KL  243
             L
Sbjct  862  TL  863



>gb|AES62955.2| transcription factor jumonji (JmjC) domain protein [Medicago 
truncatula]
Length=1059

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH+H  P+ QV+HPIHDQ FYLT+EHKKRLKEEYGIEPWTF QKLGDAVFIPAGCPHQVR
Sbjct  929   RHVHSSPLKQVIHPIHDQHFYLTIEHKKRLKEEYGIEPWTFFQKLGDAVFIPAGCPHQVR  988

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC KVA+DFVSPEN+ EC RLTE FR LP NHR+ EDKLEVKKMII A+ E ++ +E
Sbjct  989   NLKSCTKVALDFVSPENVGECFRLTEEFRKLPVNHRSTEDKLEVKKMIIYAMLELVEKLE  1048

Query  248   K  246
             K
Sbjct  1049  K  1049



>ref|XP_009596947.1| PREDICTED: LOW QUALITY PROTEIN: lysine-specific demethylase JMJ25-like 
[Nicotiana tomentosiformis]
Length=1319

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+PQVVHPIHD+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AV IPAGCPHQ+R
Sbjct  773  RHIYGSPLPQVVHPIHDETFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVLIPAGCPHQIR  832

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDFVSPEN++EC+RLTE FR LP+NH A+EDKLEVKK+I+ AV +A+  +E
Sbjct  833  NLKSCINVAVDFVSPENVNECIRLTEEFRQLPKNHVAREDKLEVKKIIVRAVSQAVDHLE  892

Query  248  KLTLE*RDG  222
            K TL    G
Sbjct  893  KTTLHSESG  901



>ref|XP_010052874.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X1 [Eucalyptus 
grandis]
Length=1062

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +C P+ +V+HPIHDQ+FYLT+EHK++LKEE+GIEPWTF Q LG+AVFIPAGCPHQVR
Sbjct  930   RHTYCAPIKEVIHPIHDQSFYLTLEHKRKLKEEFGIEPWTFEQHLGEAVFIPAGCPHQVR  989

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC KVA DFVSPENI EC+RLTE FR LP+NH+A+EDKLE+KKMII AV +A KD+E
Sbjct  990   NLKSCTKVAADFVSPENIGECLRLTEEFRQLPRNHKAREDKLEIKKMIIYAVDQATKDLE  1049

Query  248   KL  243
              L
Sbjct  1050  DL  1051



>gb|KJB49978.1| hypothetical protein B456_008G148100 [Gossypium raimondii]
Length=1052

 Score =   202 bits (513),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             R++HC PV QV HPIHDQ+F+LT++HK +LK+EYGIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  921   RYVHCRPVSQVFHPIHDQSFFLTMDHKAKLKKEYGIEPWTFVQKLGEAVFIPAGCPHQVR  980

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             N+KSC+KVA+DFVSPEN+ EC+RLTE FR LP++HR  EDKLEVKKMI+ AV+E++ +++
Sbjct  981   NIKSCIKVALDFVSPENVGECVRLTEEFRVLPRDHRTNEDKLEVKKMIVHAVRESVNNLD  1040

Query  248   K  246
             K
Sbjct  1041  K  1041



>gb|KJB49979.1| hypothetical protein B456_008G148100 [Gossypium raimondii]
Length=1048

 Score =   202 bits (513),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             R++HC PV QV HPIHDQ+F+LT++HK +LK+EYGIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  921   RYVHCRPVSQVFHPIHDQSFFLTMDHKAKLKKEYGIEPWTFVQKLGEAVFIPAGCPHQVR  980

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             N+KSC+KVA+DFVSPEN+ EC+RLTE FR LP++HR  EDKLEVKKMI+ AV+E++ +++
Sbjct  981   NIKSCIKVALDFVSPENVGECVRLTEEFRVLPRDHRTNEDKLEVKKMIVHAVRESVNNLD  1040

Query  248   K  246
             K
Sbjct  1041  K  1041



>ref|XP_007022716.1| Transcription factor jumonji domain-containing protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY14241.1| Transcription factor jumonji domain-containing protein, putative 
isoform 2 [Theobroma cacao]
Length=1051

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH++  PV QVVHPIHDQ FYLT+ HK++LKEE+G+EPWT +QKLG+A+FIPAGCPHQVR
Sbjct  928   RHVYGSPVDQVVHPIHDQTFYLTMHHKRKLKEEFGVEPWTIVQKLGEAIFIPAGCPHQVR  987

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPENIHEC+RLTE FR LP NHRAKEDKLEVKKM++ A+  A++++E
Sbjct  988   NLKSCIKVALDFVSPENIHECIRLTEEFRVLPHNHRAKEDKLEVKKMMLHALNYAVEELE  1047

Query  248   KLT  240
             KLT
Sbjct  1048  KLT  1050



>gb|KHN32999.1| Lysine-specific demethylase 3B, partial [Glycine soja]
Length=710

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV QVVHPIHDQ+FYLT+EHKK+LKEE+G+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  585  RHTYCSPVEQVVHPIHDQSFYLTLEHKKKLKEEFGVEPWTFEQKLGEAVFIPAGCPHQVR  644

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPEN+H C+ LTE FR LP+NH+A+EDKLE+KKMI+ AV  A+K++E
Sbjct  645  NLKSCTKVAADFVSPENVHMCLHLTEEFRRLPKNHKAREDKLEIKKMIVYAVDHAVKELE  704

Query  248  KL  243
             L
Sbjct  705  AL  706



>ref|XP_007022715.1| Transcription factor jumonji domain-containing protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY14240.1| Transcription factor jumonji domain-containing protein, putative 
isoform 1 [Theobroma cacao]
Length=1056

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH++  PV QVVHPIHDQ FYLT+ HK++LKEE+G+EPWT +QKLG+A+FIPAGCPHQVR
Sbjct  933   RHVYGSPVDQVVHPIHDQTFYLTMHHKRKLKEEFGVEPWTIVQKLGEAIFIPAGCPHQVR  992

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPENIHEC+RLTE FR LP NHRAKEDKLEVKKM++ A+  A++++E
Sbjct  993   NLKSCIKVALDFVSPENIHECIRLTEEFRVLPHNHRAKEDKLEVKKMMLHALNYAVEELE  1052

Query  248   KLT  240
             KLT
Sbjct  1053  KLT  1055



>gb|AFW63900.1| putative jumonji-like transcription factor family protein [Zea 
mays]
Length=350

 Score =   192 bits (488),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV +V HPIHDQ+FYLT EHK++LKEEYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  189  RHIYCNPVKKVFHPIHDQSFYLTEEHKRKLKEEYGIEPWTFEQKLGEAVFIPAGCPHQVR  248

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPEN+ EC++LTE FR LP  H+AKEDKLE+KKM + A+ EA+  ++
Sbjct  249  NLKSCIKVALDFVSPENVGECVKLTEEFRRLPSFHKAKEDKLEIKKMAVHALNEAVNFLD  308

Query  248  KLTLE  234
              + E
Sbjct  309  PRSSE  313



>ref|XP_006598342.1| PREDICTED: uncharacterized protein LOC100801772 [Glycine max]
Length=825

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV QVVHPIHDQ+FYLT+EHKK+LKEE+G+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  700  RHTYCSPVEQVVHPIHDQSFYLTLEHKKKLKEEFGVEPWTFEQKLGEAVFIPAGCPHQVR  759

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA DFVSPEN+H C+ LTE FR LP+NH+A+EDKLE+KKMI+ AV  A+K++E
Sbjct  760  NLKSCTKVAADFVSPENVHMCLHLTEEFRRLPKNHKAREDKLEIKKMIVYAVDHAVKELE  819

Query  248  KL  243
             L
Sbjct  820  AL  821



>ref|XP_010686791.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=879

 Score =   200 bits (508),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++C PV QV+HPIHDQ+FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  756  RHMYCSPVEQVIHPIHDQSFYLTSEHKQKLKEEYGVEPWTFEQKLGEAVFIPAGCPHQVR  815

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENI EC+RLTE FR LP+ HR +EDKLE+KKMI+ AV + +K +E
Sbjct  816  NLKSCTKVAVDFVSPENIGECLRLTEEFRKLPKFHRVREDKLEIKKMILHAVNKTVKHLE  875

Query  248  KLTL  237
             L L
Sbjct  876  DLRL  879



>gb|KHN37375.1| Lysine-specific demethylase 3B [Glycine soja]
Length=1222

 Score =   202 bits (513),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 111/135 (82%), Gaps = 4/135 (3%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+ QV+HPIHDQ FYLTVEHK++LKEEYGIEPWTFIQK+GDAVF+PAGCPHQVR
Sbjct  1092  RHIHCCPLKQVIHPIHDQTFYLTVEHKRKLKEEYGIEPWTFIQKVGDAVFVPAGCPHQVR  1151

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC RLTE FRTLP +H + EDKLEVKKM I A+++ +  +E
Sbjct  1152  NLKSCIKVALDFVSPENVGECFRLTEEFRTLPISHASSEDKLEVKKMTIYAMQDVIGKLE  1211

Query  248   KLTLE*RDGNKLTPQ  204
                 E R G    P+
Sbjct  1212  ----EARSGKTKVPE  1222



>ref|XP_010913412.1| PREDICTED: lysine-specific demethylase JMJ25 [Elaeis guineensis]
Length=869

 Score =   199 bits (507),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV QV +P+HD+ FYLT+EHK++LKEE+GIEPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  744  RHIYCSPVEQVFNPVHDETFYLTIEHKRKLKEEFGIEPWTFVQRLGEAVFIPAGCPHQVR  803

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPEN+ EC+RLT+ FR LP+NHRAKEDKLEVKKM+I AV  A+K ++
Sbjct  804  NLKSCTKVALDFVSPENVGECIRLTDDFRLLPKNHRAKEDKLEVKKMVIHAVNHAVKTLQ  863

Query  248  KL  243
             L
Sbjct  864  DL  865



>ref|XP_003535763.1| PREDICTED: uncharacterized protein LOC100805723 isoform X1 [Glycine 
max]
Length=1222

 Score =   201 bits (512),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 111/135 (82%), Gaps = 4/135 (3%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+ QV+HPIHDQ FYLTVEHK++LKEEYGIEPWTFIQK+GDAVF+PAGCPHQVR
Sbjct  1092  RHIHCCPLKQVIHPIHDQTFYLTVEHKRKLKEEYGIEPWTFIQKVGDAVFVPAGCPHQVR  1151

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC RLTE FRTLP +H + EDKLEVKKM I A+++ +  +E
Sbjct  1152  NLKSCIKVALDFVSPENVGECFRLTEEFRTLPISHASSEDKLEVKKMTIYAMQDVIGKLE  1211

Query  248   KLTLE*RDGNKLTPQ  204
                 E R G    P+
Sbjct  1212  ----EARSGKTKVPE  1222



>ref|XP_006304678.1| hypothetical protein CARUB_v10011915mg [Capsella rubella]
 gb|EOA37576.1| hypothetical protein CARUB_v10011915mg [Capsella rubella]
Length=878

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH  C PV +V HPIHDQ+ +LTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  752  RHTFCSPVTKVYHPIHDQSCFLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  811

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENI EC+RLT+ FR LP+NH+A+EDKLE+KKM+I AV++ALK++E
Sbjct  812  NLKSCTKVAVDFVSPENIDECLRLTDEFRQLPKNHKAREDKLEIKKMVIYAVEQALKEVE  871

Query  248  KL  243
             L
Sbjct  872  TL  873



>ref|XP_011095986.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X2 [Sesamum 
indicum]
Length=1102

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +C PV QV+HPIHDQ FYLT EHK +LKEE+GIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  966   RHTYCCPVEQVIHPIHDQTFYLTSEHKVKLKEEFGIEPWTFEQKLGEAVFIPAGCPHQVR  1025

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC KVA DFVSPEN+HEC+RLTE FR LP++HRA+EDKLEVKKMI+ AV + + D+ 
Sbjct  1026  NLKSCTKVAADFVSPENLHECLRLTEEFRKLPKDHRAREDKLEVKKMILHAVNQVIDDLS  1085

Query  248   KL  243
             KL
Sbjct  1086  KL  1087



>ref|XP_011095987.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X3 [Sesamum 
indicum]
 ref|XP_011095988.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X3 [Sesamum 
indicum]
 ref|XP_011095989.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X3 [Sesamum 
indicum]
 ref|XP_011095990.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X3 [Sesamum 
indicum]
 ref|XP_011095991.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X3 [Sesamum 
indicum]
 ref|XP_011095992.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X3 [Sesamum 
indicum]
Length=1100

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +C PV QV+HPIHDQ FYLT EHK +LKEE+GIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  964   RHTYCCPVEQVIHPIHDQTFYLTSEHKVKLKEEFGIEPWTFEQKLGEAVFIPAGCPHQVR  1023

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC KVA DFVSPEN+HEC+RLTE FR LP++HRA+EDKLEVKKMI+ AV + + D+ 
Sbjct  1024  NLKSCTKVAADFVSPENLHECLRLTEEFRKLPKDHRAREDKLEVKKMILHAVNQVIDDLS  1083

Query  248   KL  243
             KL
Sbjct  1084  KL  1085



>ref|XP_007153986.1| hypothetical protein PHAVU_003G081400g [Phaseolus vulgaris]
 gb|ESW25980.1| hypothetical protein PHAVU_003G081400g [Phaseolus vulgaris]
Length=871

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV +V HPIHDQ FYLT EHKK+LKEE+ +EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  746  RHTYCSPVEEVAHPIHDQCFYLTSEHKKKLKEEFDVEPWTFEQKLGEAVFIPAGCPHQVR  805

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENIHEC+RLT  FR LP+NH+A+EDKLE+KKMI+ A+ EA+ D++
Sbjct  806  NLKSCTKVAVDFVSPENIHECLRLTNEFRQLPKNHKAREDKLEIKKMIVYAIDEAVTDLK  865

Query  248  KL  243
             L
Sbjct  866  AL  867



>ref|XP_011095985.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X1 [Sesamum 
indicum]
Length=1116

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +C PV QV+HPIHDQ FYLT EHK +LKEE+GIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  980   RHTYCCPVEQVIHPIHDQTFYLTSEHKVKLKEEFGIEPWTFEQKLGEAVFIPAGCPHQVR  1039

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC KVA DFVSPEN+HEC+RLTE FR LP++HRA+EDKLEVKKMI+ AV + + D+ 
Sbjct  1040  NLKSCTKVAADFVSPENLHECLRLTEEFRKLPKDHRAREDKLEVKKMILHAVNQVIDDLS  1099

Query  248   KL  243
             KL
Sbjct  1100  KL  1101



>ref|XP_004954498.1| PREDICTED: lysine-specific demethylase 3A-like isoform X4 [Setaria 
italica]
Length=499

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  306  RHIHCNPVKQVIHPIHDQTFYLTAEHKRKLKEEYGVEPWTFEQKLGEAVFIPAGCPHQVR  365

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPENI EC++LT  FR LP +H+A EDKLE+KKM + A+ E +  ++
Sbjct  366  NLKSCIKVALDFVSPENIGECVKLTGEFRRLPSSHKANEDKLEIKKMALHALNEVVNFLD  425

Query  248  KLTLE  234
              T E
Sbjct  426  PCTSE  430



>gb|EYU23675.1| hypothetical protein MIMGU_mgv1a020177mg [Erythranthe guttata]
Length=613

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C  + QVVHPIHDQ  YL++EHK++LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  488  RHIYCNQLSQVVHPIHDQTVYLSMEHKRKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  547

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VA+DFVSPEN+ EC+RLT+ FR LPQNHRAKEDKLEVKKM + A+++A+  +E
Sbjct  548  NLKSCINVALDFVSPENVQECLRLTQEFRVLPQNHRAKEDKLEVKKMALHAIEKAVDHLE  607



>ref|XP_011469248.1| PREDICTED: LOW QUALITY PROTEIN: lysine-specific demethylase JMJ25-like 
[Fragaria vesca subsp. vesca]
Length=1274

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C P+ QV HPIHDQ FYLT+EHK++LKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR
Sbjct  673  RHTYCCPLQQVTHPIHDQTFYLTLEHKRQLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  732

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+K +V+FVSPEN+ EC+RLT+ FR LP  HRAKEDKLEVKKMI+ AV+EA++ +E
Sbjct  733  NLKSCIKASVEFVSPENVGECLRLTDEFRALPLKHRAKEDKLEVKKMIVHAVREAVEILE  792

Query  248  K  246
            +
Sbjct  793  Q  793



>ref|XP_006847841.1| hypothetical protein AMTR_s00029p00058780 [Amborella trichopoda]
 gb|ERN09422.1| hypothetical protein AMTR_s00029p00058780 [Amborella trichopoda]
Length=479

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH+ C PV  VVHPIHDQ+FYL  +HKK+LKEE+G+EPWTF Q LG+AVFIPAGCPHQVR
Sbjct  325  RHLFCCPVEHVVHPIHDQSFYLDTKHKKKLKEEFGVEPWTFEQHLGEAVFIPAGCPHQVR  384

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPEN+ EC+ LT+ FR LP+NHRAKEDKLEVKKM I AV  AL++I+
Sbjct  385  NLKSCIKVALDFVSPENVQECIHLTDEFRLLPKNHRAKEDKLEVKKMGIYAVIHALEEIK  444

Query  248  KLT  240
             LT
Sbjct  445  SLT  447



>gb|AES98174.2| transcription factor jumonji (JmjC) domain protein [Medicago 
truncatula]
Length=837

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH+HC P+ +V+HPIHDQ FYLT+ HKK+LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  713  RHVHCSPLEEVIHPIHDQTFYLTIGHKKKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  772

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPEN+ EC RLTE FR LP NHR+ EDKLEVKKMI+  + + +K +E
Sbjct  773  NLKSCTKVALDFVSPENVGECFRLTEEFRKLPVNHRSIEDKLEVKKMIVYTMIDVVKKLE  832

Query  248  KLT  240
            K +
Sbjct  833  KAS  835



>gb|KHF99180.1| Lysine-specific demethylase 3A [Gossypium arboreum]
Length=1052

 Score =   200 bits (508),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             R++HC PV QV HPIHDQ+F+LT++HK +LK+EYGIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  921   RYVHCCPVSQVFHPIHDQSFFLTMDHKAKLKKEYGIEPWTFVQKLGEAVFIPAGCPHQVR  980

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             N+KSC+KVA+DFVSPEN+ EC+RLTE FR LP++HR  EDKLEVKKMI+ AV E++ +++
Sbjct  981   NIKSCIKVALDFVSPENVGECVRLTEEFRVLPRDHRTNEDKLEVKKMIVHAVCESVNNLD  1040

Query  248   K  246
             K
Sbjct  1041  K  1041



>ref|XP_010233682.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Brachypodium distachyon]
Length=1040

 Score =   200 bits (508),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 91/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +  PV QV HPIHDQ FYLT EHKK+LKEEYG+EPWTF QKLGDAVFIPAGCPHQVR
Sbjct  890   RHYNYEPVKQVAHPIHDQCFYLTNEHKKKLKEEYGVEPWTFEQKLGDAVFIPAGCPHQVR  949

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
             NLKSC+KVA+DFVSPEN+HEC+RLT+ FR LP+ HR  EDKLEVKKM + A+KEA+KD+
Sbjct  950   NLKSCIKVALDFVSPENVHECIRLTKEFRLLPKGHRVNEDKLEVKKMALYALKEAIKDL  1008



>ref|XP_010032501.1| PREDICTED: lysine-specific demethylase JMJ25-like [Eucalyptus 
grandis]
Length=990

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH HC P+PQV+HPIHDQ FYL+ EH ++LKEE+GIEPWTF+QKLGDAVF+PAGCPHQVR
Sbjct  867  RHTHCCPLPQVMHPIHDQTFYLSREHLRKLKEEFGIEPWTFVQKLGDAVFVPAGCPHQVR  926

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            N+KSC+KVA+DFVS EN+ EC+RLTE FR LP+NHRAKEDKLE+KKM+I AVK+A++ +E
Sbjct  927  NVKSCIKVALDFVSAENVGECIRLTEEFRLLPKNHRAKEDKLEIKKMVIYAVKQAVECLE  986



>ref|NP_001050423.1| Os03g0430400 [Oryza sativa Japonica Group]
 dbj|BAF12337.1| Os03g0430400, partial [Oryza sativa Japonica Group]
Length=460

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV  V HPIHDQ FYLTVEHK++LKEE+G+EPWTF QKLGDAVFIPAGCPHQVR
Sbjct  287  RHIHCNPVKNVSHPIHDQTFYLTVEHKRKLKEEHGVEPWTFEQKLGDAVFIPAGCPHQVR  346

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPEN+ EC++LT  FR LP +HRAKEDKLE+KK+ + A+KE +  ++
Sbjct  347  NLKSCIKVALDFVSPENVGECVKLTGEFRRLPSDHRAKEDKLEIKKIALNALKEVVNFLD  406

Query  248  KL  243
             L
Sbjct  407  PL  408



>ref|XP_009123381.1| PREDICTED: uncharacterized protein LOC103848169 isoform X4 [Brassica 
rapa]
Length=876

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV +V HPIHDQ+ YLTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  746  RHAYCCPVTKVYHPIHDQSCYLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  805

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENI EC+RLTE FR LP+NH+A+EDKLE+KKM+I A+++AL ++E
Sbjct  806  NLKSCTKVAVDFVSPENIKECLRLTEEFRQLPKNHKAREDKLEIKKMVIYAIEQALIELE  865

Query  248  KL  243
             L
Sbjct  866  TL  867



>gb|EYU40205.1| hypothetical protein MIMGU_mgv1a000930mg [Erythranthe guttata]
Length=940

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+ QV+HPIHDQ  YLT+EHK+ LKEEYGIEPWTF+QKLGDAV IPAGCPHQVR
Sbjct  815  RHIYGNPLSQVIHPIHDQTVYLTMEHKRILKEEYGIEPWTFVQKLGDAVIIPAGCPHQVR  874

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVAVDFVSPEN+ EC+RLT+ FR LPQNHRAKEDKLEVKKM + A+++A+  +E
Sbjct  875  NLKSCIKVAVDFVSPENVKECLRLTKEFRVLPQNHRAKEDKLEVKKMALHAIEQAVNCLE  934

Query  248  KLT  240
            K++
Sbjct  935  KIS  937



>ref|XP_009395410.1| PREDICTED: lysine-specific demethylase JMJ25-like [Musa acuminata 
subsp. malaccensis]
Length=758

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH+HC PV QV+HPIHDQ+FYLTV HKK+LK EYGIEPWTF QKLG+AV IPAGCPHQVR
Sbjct  614  RHVHCLPVEQVIHPIHDQSFYLTVAHKKKLKAEYGIEPWTFEQKLGEAVLIPAGCPHQVR  673

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVAVDFVSPEN+ ECMRLTE FR LP+ H+AKEDKLE+KK+ + A+ + +KD+E
Sbjct  674  NLKSCIKVAVDFVSPENVWECMRLTEEFRKLPEEHKAKEDKLEIKKIALHALNQVIKDLE  733



>ref|XP_010100868.1| Lysine-specific demethylase 3A [Morus notabilis]
 gb|EXB85447.1| Lysine-specific demethylase 3A [Morus notabilis]
Length=1187

 Score =   200 bits (508),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHI+C  V QV+HP+HDQ  YLT++HK++LKEEYGIEPW+FIQKLGDAVFIPAGCPHQVR
Sbjct  1032  RHIYCCQVQQVIHPVHDQTMYLTMDHKRKLKEEYGIEPWSFIQKLGDAVFIPAGCPHQVR  1091

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTE FRTLP +HRAKEDKLEVKKM + A+KE ++ ++
Sbjct  1092  NLKSCIKVALDFVSPENVDECVRLTEEFRTLPSSHRAKEDKLEVKKMALYAMKEVVETLD  1151



>ref|XP_010252491.1| PREDICTED: lysine-specific demethylase JMJ25-like [Nelumbo nucifera]
Length=912

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C P+ QV+HPIHDQAFYLT EHKK+LKEE+G+EPWTF Q++G+AVFIPAGCPHQVR
Sbjct  786  RHTYCSPIEQVIHPIHDQAFYLTFEHKKKLKEEFGVEPWTFEQRVGEAVFIPAGCPHQVR  845

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPEN+H+C +LT  FR LP+NHRA+EDKLE+KKM + AV +A+KD +
Sbjct  846  NLKSCTKVALDFVSPENVHQCFQLTNEFRQLPKNHRAREDKLEIKKMTLHAVYQAVKDFQ  905

Query  248  KL  243
             L
Sbjct  906  NL  907



>ref|XP_008347084.1| PREDICTED: trichohyalin-like [Malus domestica]
Length=767

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 109/129 (84%), Gaps = 3/129 (2%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH  C PV QV+HPIHDQ FYLT++HK++LKEEYGIEPWTFIQKLGDAV IPAGCPHQVR
Sbjct  193  RHTFCCPVQQVIHPIHDQTFYLTMQHKRKLKEEYGIEPWTFIQKLGDAVLIPAGCPHQVR  252

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLK C+KVA++FVSPEN+ EC+RLT+ FRTLP+NHRAKEDKLEVKKMI+ +V +    +E
Sbjct  253  NLKPCIKVALEFVSPENVGECIRLTDEFRTLPKNHRAKEDKLEVKKMILHSVHQV---VE  309

Query  248  KLTLE*RDG  222
            KL    R G
Sbjct  310  KLDTNMRHG  318



>ref|XP_008811219.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103722435 
[Phoenix dactylifera]
Length=1444

 Score =   200 bits (508),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH+HC P+ QV+HPIHDQ+FYLT+EHK++LK+EYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  1266  RHVHCSPIEQVIHPIHDQSFYLTLEHKRKLKDEYGIEPWTFEQKLGEAVFIPAGCPHQVR  1325

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP+ HRAKEDKLEVKKM + A    +K+++
Sbjct  1326  NLKSCIKVAMDFVSPENVRECIRLTEEFRILPEEHRAKEDKLEVKKMALHAFNHVIKELK  1385

Query  248   KLTLE*R  228
                 + R
Sbjct  1386  DYNFKPR  1392



>ref|XP_002307161.2| hypothetical protein POPTR_0005s09360g [Populus trichocarpa]
 gb|EEE94157.2| hypothetical protein POPTR_0005s09360g [Populus trichocarpa]
Length=1081

 Score =   199 bits (505),  Expect = 7e-55, Method: Composition-based stats.
 Identities = 86/104 (83%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+P+VVHPIHDQ F+ T+EHK++LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  969   RHIHCSPLPKVVHPIHDQTFFFTLEHKRKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  1028

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEV  297
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP NHRAKEDKLEV
Sbjct  1029  NLKSCIKVAMDFVSPENVGECIRLTEEFRLLPPNHRAKEDKLEV  1072



>emb|CDP01722.1| unnamed protein product [Coffea canephora]
Length=1503

 Score =   199 bits (507),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHI+C PV ++VHPIHDQAFYLT  HKK+LKEE+G+EPWTF+QKLGDAVF+PAGCPHQVR
Sbjct  1369  RHIYCRPVEKIVHPIHDQAFYLTEYHKKKLKEEFGVEPWTFVQKLGDAVFVPAGCPHQVR  1428

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
             NLKSC+KVA+DFVSPENI EC+RL+E FRTLPQ H+AKEDKLEVKKM + A+  A+
Sbjct  1429  NLKSCIKVALDFVSPENISECIRLSEEFRTLPQKHQAKEDKLEVKKMALHALDNAI  1484



>ref|XP_010688672.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=926

 Score =   197 bits (501),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -3

Query  599  HCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVRNLK  420
            HC P+ QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVRNLK
Sbjct  809  HCTPLKQVIHPIHDQTFYLTEEHKRKLKEEYGVEPWTFTQKLGEAVFIPAGCPHQVRNLK  868

Query  419  SCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            SC+KVA+DFVSPEN+ EC+R+    R+LP+NHRAKEDKLEV KMII AVK+A+KD+E
Sbjct  869  SCIKVALDFVSPENVEECIRVAGELRSLPRNHRAKEDKLEVWKMIIHAVKQAVKDLE  925



>gb|EPS68622.1| hypothetical protein M569_06146, partial [Genlisea aurea]
Length=633

 Score =   195 bits (495),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PVP+VVHPIHDQ  YL  EHK+RLK EYG+E W+F+Q+LGDAVFIPAGCPHQVR
Sbjct  513  RHTYCNPVPKVVHPIHDQTVYLGTEHKRRLKSEYGVEAWSFVQELGDAVFIPAGCPHQVR  572

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSCLKVA+DFVSPEN+ EC+RLTE FR LP NHRAKEDKLEVKKM + A   A+K++E
Sbjct  573  NLKSCLKVALDFVSPENVGECVRLTEEFRVLPHNHRAKEDKLEVKKMALHAAATAVKELE  632

Query  248  K  246
             
Sbjct  633  N  633



>ref|XP_009773361.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Nicotiana sylvestris]
Length=1373

 Score =   199 bits (506),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+ QV HPIHD+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AVFIPAGCPHQ+R
Sbjct  774  RHIYGSPLLQVAHPIHDETFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVFIPAGCPHQIR  833

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDFVSPEN++EC+RLTE FR LP+NH A+EDKLEVK +I+ AV +A+  +E
Sbjct  834  NLKSCINVAVDFVSPENVNECIRLTEEFRQLPRNHVAREDKLEVKNIIVRAVSQAVDHLE  893

Query  248  KLTLE*RDGNKLTPQTNCRLL  186
            K TL   +   +T  ++  L+
Sbjct  894  KTTLRHTESGIVTGSSSSILI  914



>ref|XP_004954497.1| PREDICTED: lysine-specific demethylase 3A-like isoform X3 [Setaria 
italica]
Length=581

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  388  RHIHCNPVKQVIHPIHDQTFYLTAEHKRKLKEEYGVEPWTFEQKLGEAVFIPAGCPHQVR  447

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPENI EC++LT  FR LP +H+A EDKLE+KKM + A+ E +  ++
Sbjct  448  NLKSCIKVALDFVSPENIGECVKLTGEFRRLPSSHKANEDKLEIKKMALHALNEVVNFLD  507

Query  248  KLTLE  234
              T E
Sbjct  508  PCTSE  512



>ref|XP_006348210.1| PREDICTED: uncharacterized protein LOC102601383 [Solanum tuberosum]
Length=1313

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH  C PV QV HPIHDQ+FYLT+EHK++LKEE+GIEPWTF Q+LG+AVFIPAGCPHQVR
Sbjct  1188  RHTFCCPVDQVFHPIHDQSFYLTMEHKRKLKEEFGIEPWTFEQRLGEAVFIPAGCPHQVR  1247

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC KVA DFVSPENI EC RLT  FRTLP+ H+A+EDKLE+KKM+I A+ + + D+E
Sbjct  1248  NLKSCTKVAADFVSPENIRECFRLTAEFRTLPKGHKAREDKLEIKKMVIHAINQVVTDLE  1307

Query  248   KLT  240
             +LT
Sbjct  1308  QLT  1310



>ref|XP_011002578.1| PREDICTED: lysine-specific demethylase JMJ25-like [Populus euphratica]
Length=1108

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +C PV QVVHPIHDQ FYLTVEHK++LKEE+G+E WTF Q+ G+AVFIPAGCPHQVR
Sbjct  982   RHNYCAPVEQVVHPIHDQCFYLTVEHKRKLKEEFGVEAWTFEQRGGEAVFIPAGCPHQVR  1041

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NL+SC KVAVDFVSPENI EC+RLTE FR LP NHRA+EDKLE+KKMII A+ +A+ D++
Sbjct  1042  NLQSCTKVAVDFVSPENIRECLRLTEEFRRLPVNHRAREDKLEIKKMIIYAIDKAIIDLQ  1101

Query  248   KLT  240
             +LT
Sbjct  1102  ELT  1104



>ref|XP_008803158.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103716776 
[Phoenix dactylifera]
Length=1448

 Score =   199 bits (505),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 88/120 (73%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH+HC  V QV+HPIHDQ+FYLT+EHK++LK+EYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  1268  RHVHCSQVEQVIHPIHDQSFYLTLEHKRKLKDEYGIEPWTFEQKLGEAVFIPAGCPHQVR  1327

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP+ HRAKEDKLEVKKM + A    ++D++
Sbjct  1328  NLKSCIKVALDFVSPENVRECIRLTEEFRVLPEEHRAKEDKLEVKKMALHAFIHVVEDLK  1387



>ref|XP_010940352.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X3 
[Elaeis guineensis]
Length=1256

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH+HC P+ QV+HPIHDQ+FYLT+EHK++LK EYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  1108  RHVHCSPIEQVIHPIHDQSFYLTLEHKRKLKNEYGIEPWTFEQKLGEAVFIPAGCPHQVR  1167

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP+ HRAKEDKLEVKKM + A    +K+++
Sbjct  1168  NLKSCIKVALDFVSPENVRECIRLTEEFRVLPEEHRAKEDKLEVKKMALHAFNHVVKELK  1227

Query  248   KLTLE*R  228
                 + R
Sbjct  1228  DYNFKSR  1234



>gb|AAC17616.1| Contains similarity to box helicases gb|U29097 from C. elegans 
and to the ENBP1 gene product gb|X95995 from Vicia sativa 
[Arabidopsis thaliana]
Length=851

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 112/129 (87%), Gaps = 4/129 (3%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYG----IEPWTFIQKLGDAVFIPAGCP  441
            RH +C  V +V HPIHDQ+++LTVEHK++LK E+G    IEPWTF+QKLG+AVFIPAGCP
Sbjct  721  RHTYCSRVTKVYHPIHDQSYFLTVEHKRKLKAEFGMVTWIEPWTFVQKLGEAVFIPAGCP  780

Query  440  HQVRNLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            HQVRNLKSC KVAVDFVSPENI EC+RLT+ FR LP+NH+A+EDKLE+KKM+I AV++AL
Sbjct  781  HQVRNLKSCTKVAVDFVSPENIDECLRLTDEFRQLPKNHKAREDKLEIKKMVIYAVEQAL  840

Query  260  KDIEKLTLE  234
            K++E L L+
Sbjct  841  KEVETLLLD  849



>ref|XP_010233683.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Brachypodium distachyon]
Length=1030

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +  PV QV HPIHDQ FYLT EHKK+LKEEYG+EPWTF QKLGDAVFIPAGCPHQVR
Sbjct  890   RHYNYEPVKQVAHPIHDQCFYLTNEHKKKLKEEYGVEPWTFEQKLGDAVFIPAGCPHQVR  949

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
             NLKSC+KVA+DFVSPEN+HEC+RLT+ FR LP+ HR  EDKLEVKKM + A+KEA+KD+
Sbjct  950   NLKSCIKVALDFVSPENVHECIRLTKEFRLLPKGHRVNEDKLEVKKMALYALKEAIKDL  1008



>ref|XP_004308619.1| PREDICTED: lysine-specific demethylase JMJ25-like [Fragaria vesca 
subsp. vesca]
Length=804

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI C P+ QVVHPIHDQ  YLTVEHK+ LK E GIEPWTFIQKLGDAVFIPAGCPHQVR
Sbjct  679  RHIQCRPLKQVVHPIHDQTIYLTVEHKRNLKAECGIEPWTFIQKLGDAVFIPAGCPHQVR  738

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVAVDFVSPE + +C RLTE FRTLP +HRA EDKLEVKKMI+ AV +A+K I 
Sbjct  739  NLKSCIKVAVDFVSPETVGQCFRLTEEFRTLPPDHRASEDKLEVKKMIVHAVSDAVKVIS  798

Query  248  KL  243
            K+
Sbjct  799  KV  800



>ref|XP_004486316.1| PREDICTED: uncharacterized protein LOC101504299 [Cicer arietinum]
Length=840

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI C PV QV HPIHDQ FYLT+EHKK+LKEE+G+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  712  RHIFCSPVQQVFHPIHDQCFYLTLEHKKKLKEEFGVEPWTFEQKLGEAVFIPAGCPHQVR  771

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPEN+H CM LT+ FR LP+NH+A+EDKLE+KKMI+ AV +A+++++
Sbjct  772  NLKSCTKVALDFVSPENVHMCMSLTDEFRRLPKNHKAREDKLEIKKMIVYAVDQAVQELK  831

Query  248  KLT  240
               
Sbjct  832  AFN  834



>gb|KHG27938.1| Lysine-specific demethylase 3B [Gossypium arboreum]
Length=892

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV +V+HPIHDQ+FYLT+EHK++LKEE+G+EPWTF Q LG+AVFIPAGCPHQVR
Sbjct  766  RHIYCSPVEKVIHPIHDQSFYLTMEHKRKLKEEFGVEPWTFEQNLGEAVFIPAGCPHQVR  825

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSP++I EC+RLTE FR LP+NHRA+EDKLE+ KMII  V+ A++++ 
Sbjct  826  NLKSCTKVAVDFVSPQSIKECLRLTEEFRQLPKNHRAREDKLEINKMIIYGVERAIRELS  885

Query  248  KL  243
             L
Sbjct  886  DL  887



>ref|XP_009773362.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Nicotiana sylvestris]
Length=1372

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+ QV HPIHD+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AVFIPAGCPHQ+R
Sbjct  774  RHIYGSPLLQVAHPIHDETFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVFIPAGCPHQIR  833

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDFVSPEN++EC+RLTE FR LP+NH A+EDKLEVK +I+ AV +A+  +E
Sbjct  834  NLKSCINVAVDFVSPENVNECIRLTEEFRQLPRNHVAREDKLEVKNIIVRAVSQAVDHLE  893

Query  248  KLTL  237
            K TL
Sbjct  894  KTTL  897



>ref|XP_010940351.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Elaeis guineensis]
Length=1371

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH+HC P+ QV+HPIHDQ+FYLT+EHK++LK EYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  1223  RHVHCSPIEQVIHPIHDQSFYLTLEHKRKLKNEYGIEPWTFEQKLGEAVFIPAGCPHQVR  1282

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP+ HRAKEDKLEVKKM + A    +K+++
Sbjct  1283  NLKSCIKVALDFVSPENVRECIRLTEEFRVLPEEHRAKEDKLEVKKMALHAFNHVVKELK  1342

Query  248   KLTLE*R  228
                 + R
Sbjct  1343  DYNFKSR  1349



>ref|XP_010493582.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Camelina sativa]
Length=860

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V HPIHDQ  +LTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  734  RHTYCSRVKKVYHPIHDQYCFLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  793

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENI EC+RLT+ FR LP+NH+A+EDKLE+KKM+I AV++ALK++E
Sbjct  794  NLKSCTKVAVDFVSPENIDECLRLTDEFRQLPKNHKAREDKLEIKKMVIYAVEQALKEVE  853

Query  248  KL  243
             L
Sbjct  854  TL  855



>ref|XP_010940350.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Elaeis guineensis]
Length=1411

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH+HC P+ QV+HPIHDQ+FYLT+EHK++LK EYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  1263  RHVHCSPIEQVIHPIHDQSFYLTLEHKRKLKNEYGIEPWTFEQKLGEAVFIPAGCPHQVR  1322

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP+ HRAKEDKLEVKKM + A    +K+++
Sbjct  1323  NLKSCIKVALDFVSPENVRECIRLTEEFRVLPEEHRAKEDKLEVKKMALHAFNHVVKELK  1382

Query  248   KLTLE*R  228
                 + R
Sbjct  1383  DYNFKSR  1389



>ref|XP_010493568.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Camelina sativa]
 ref|XP_010493574.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Camelina sativa]
Length=862

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C  V +V HPIHDQ  +LTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  736  RHTYCSRVKKVYHPIHDQYCFLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  795

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENI EC+RLT+ FR LP+NH+A+EDKLE+KKM+I AV++ALK++E
Sbjct  796  NLKSCTKVAVDFVSPENIDECLRLTDEFRQLPKNHKAREDKLEIKKMVIYAVEQALKEVE  855

Query  248  KL  243
             L
Sbjct  856  TL  857



>gb|KJB34769.1| hypothetical protein B456_006G082600 [Gossypium raimondii]
 gb|KJB34770.1| hypothetical protein B456_006G082600 [Gossypium raimondii]
Length=892

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV +V+HPIHDQ+FYLT+EHK++LKEE+G+EPWTF Q LG+AVFIPAGCPHQVR
Sbjct  766  RHIYCSPVERVIHPIHDQSFYLTMEHKRKLKEEFGVEPWTFEQNLGEAVFIPAGCPHQVR  825

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSP++I EC+RLTE FR LP+NHRA+EDKLE+ KMII  V+ A++++ 
Sbjct  826  NLKSCTKVAVDFVSPQSIKECLRLTEEFRQLPKNHRAREDKLEINKMIIYGVERAIRELS  885

Query  248  KL  243
             L
Sbjct  886  DL  887



>gb|AES62954.2| transcription factor jumonji (JmjC) domain protein [Medicago 
truncatula]
Length=1082

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH+HC P+ QV+HPIHDQ FYLT EHK++LKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR
Sbjct  917   RHVHCSPLKQVIHPIHDQTFYLTREHKRKLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  976

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KV +DFVSPEN+ EC RLTE FR LP NHR+ +D LEVKKM I A+ + +  +E
Sbjct  977   NLKSCIKVGLDFVSPENVGECFRLTEEFRKLPINHRSTKDSLEVKKMTIYAMLDVVNKLE  1036

Query  248   K  246
             K
Sbjct  1037  K  1037



>ref|XP_007220059.1| hypothetical protein PRUPE_ppa026232mg, partial [Prunus persica]
 gb|EMJ21258.1| hypothetical protein PRUPE_ppa026232mg, partial [Prunus persica]
Length=758

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C P+PQV+HPIHDQ FYLT+EHK++LKEEYGIEPWTFIQ LGDAV IPAGCPHQVR
Sbjct  651  RHTYCCPLPQVIHPIHDQTFYLTLEHKRKLKEEYGIEPWTFIQNLGDAVLIPAGCPHQVR  710

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMI  285
            NLKSC+KVA++FVSPEN+ EC+RLT+ FRTLPQNHRAKEDKLEV++++
Sbjct  711  NLKSCIKVALEFVSPENVGECIRLTDEFRTLPQNHRAKEDKLEVRRLL  758



>ref|XP_010935549.1| PREDICTED: lysine-specific demethylase JMJ25-like [Elaeis guineensis]
Length=1430

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH+HC PV QV+HPIHDQ+FYLT+EHK++LK+EYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  1268  RHVHCSPVEQVLHPIHDQSFYLTLEHKRKLKDEYGIEPWTFEQKLGEAVFIPAGCPHQVR  1327

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
             NLKSC+KVA+DFVSPEN+ +C+RLTE FR LP+ HRAKEDKLEVKKM + A    ++D+
Sbjct  1328  NLKSCIKVALDFVSPENVRQCIRLTEEFRVLPEEHRAKEDKLEVKKMALHAFIRVIQDL  1386



>gb|EYU33540.1| hypothetical protein MIMGU_mgv1a002212mg [Erythranthe guttata]
Length=700

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+   +P+V+HPIHDQ  YL  EHK+RLKEEYGIEPWTFIQ+LGDAVFIPAGCPHQVR
Sbjct  575  RHIYGNLLPEVIHPIHDQTVYLNAEHKRRLKEEYGIEPWTFIQRLGDAVFIPAGCPHQVR  634

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVAVDFVSPEN+  C +LTE FR LP NHRAKEDKLEVKKMII A++ A+ D++
Sbjct  635  NLKSCIKVAVDFVSPENVDSCFKLTEEFRMLPHNHRAKEDKLEVKKMIIHALRAAVDDVK  694



>ref|XP_010458615.1| PREDICTED: lysine-specific demethylase JMJ25-like [Camelina sativa]
Length=872

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH  C  V +V HPIHDQ  +LTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  746  RHTFCSRVKKVYHPIHDQYCFLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  805

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENI EC+RLT+ FR LP+NH+A+EDKLE+KKM+I AV++ALK++E
Sbjct  806  NLKSCTKVAVDFVSPENIDECLRLTDEFRQLPKNHKAREDKLEIKKMVIYAVEQALKEVE  865

Query  248  KL  243
             L
Sbjct  866  TL  867



>ref|XP_004954496.1| PREDICTED: lysine-specific demethylase 3A-like isoform X2 [Setaria 
italica]
Length=639

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  446  RHIHCNPVKQVIHPIHDQTFYLTAEHKRKLKEEYGVEPWTFEQKLGEAVFIPAGCPHQVR  505

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPENI EC++LT  FR LP +H+A EDKLE+KKM + A+ E +  ++
Sbjct  506  NLKSCIKVALDFVSPENIGECVKLTGEFRRLPSSHKANEDKLEIKKMALHALNEVVNFLD  565

Query  248  KLTLE  234
              T E
Sbjct  566  PCTSE  570



>ref|XP_010476145.1| PREDICTED: lysine-specific demethylase JMJ25-like [Camelina sativa]
Length=868

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH  C  V +V HPIHDQ  +LTVEHK++LK E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  742  RHTFCSRVKKVYHPIHDQYCFLTVEHKRKLKAEFGIEPWTFVQKLGEAVFIPAGCPHQVR  801

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPENI EC+RLT+ FR LP+NH+A+EDKLE+KKM+I AV++ALK++E
Sbjct  802  NLKSCTKVAVDFVSPENIDECLRLTDEFRQLPKNHKAREDKLEIKKMVIYAVEQALKEVE  861

Query  248  KL  243
             L
Sbjct  862  TL  863



>ref|XP_004954495.1| PREDICTED: lysine-specific demethylase 3A-like isoform X1 [Setaria 
italica]
Length=660

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  467  RHIHCNPVKQVIHPIHDQTFYLTAEHKRKLKEEYGVEPWTFEQKLGEAVFIPAGCPHQVR  526

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPENI EC++LT  FR LP +H+A EDKLE+KKM + A+ E +  ++
Sbjct  527  NLKSCIKVALDFVSPENIGECVKLTGEFRRLPSSHKANEDKLEIKKMALHALNEVVNFLD  586

Query  248  KLTLE  234
              T E
Sbjct  587  PCTSE  591



>dbj|BAD22935.1| putative DNA-binding protein PD3, chloroplast [Oryza sativa Japonica 
Group]
 dbj|BAD23073.1| putative DNA-binding protein PD3, chloroplast [Oryza sativa Japonica 
Group]
Length=868

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV+HPIHDQAFYLT EHK++LKEEYG+EPWTF QKLG+AV IPAGCPHQVR
Sbjct  725  RHIHCNPVKQVIHPIHDQAFYLTAEHKRKLKEEYGVEPWTFEQKLGEAVLIPAGCPHQVR  784

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPEN+ EC+RLT+ FR LP +HRAKEDKLE+KKM   A+ E L
Sbjct  785  NLKSCIKVALDFVSPENVGECVRLTKEFRRLPSSHRAKEDKLEIKKMAFHALNEVL  840



>ref|XP_006423930.1| hypothetical protein CICLE_v10030129mg [Citrus clementina]
 gb|ESR37170.1| hypothetical protein CICLE_v10030129mg [Citrus clementina]
Length=776

 Score =   194 bits (493),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 85/123 (69%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++C PV QVVHPIHDQ FYL + HKK+LKEE+G+EPW+F+Q+LG+AV IPAGCPHQVR
Sbjct  653  RHVYCSPVEQVVHPIHDQTFYLNMYHKKKLKEEFGVEPWSFVQQLGEAVLIPAGCPHQVR  712

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NL SC K+A+DFVSPENI+EC+RLT+ FRTLP+NHRAK+DKL+VKKM + A+   ++ +E
Sbjct  713  NLMSCTKIALDFVSPENINECIRLTDEFRTLPRNHRAKKDKLQVKKMCLHAIDYVVQGLE  772

Query  248  KLT  240
            KLT
Sbjct  773  KLT  775



>ref|XP_004233782.1| PREDICTED: lysine-specific demethylase JMJ25-like [Solanum lycopersicum]
Length=1317

 Score =   197 bits (500),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH  C PV QV HPIHDQ+FYLT+EHK++LKEE+GIEPWTF Q+LG++VFIPAGCPHQVR
Sbjct  1192  RHTFCCPVDQVFHPIHDQSFYLTLEHKRKLKEEFGIEPWTFEQRLGESVFIPAGCPHQVR  1251

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC KVA DFVSPENI EC RLT  FRTLP+ H+A+EDKLE+KKM++ A+ + + D+E
Sbjct  1252  NLKSCTKVAADFVSPENIRECFRLTAEFRTLPKGHKAREDKLEIKKMVLHAINQVVTDLE  1311

Query  248   KLT  240
             +LT
Sbjct  1312  QLT  1314



>gb|EEC74293.1| hypothetical protein OsI_09545 [Oryza sativa Indica Group]
Length=996

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV+HPIHDQAFYLT EHK++LKEEYG+EPWTF QKLG+AV IPAGCPHQVR
Sbjct  853  RHIHCNPVKQVIHPIHDQAFYLTAEHKRKLKEEYGVEPWTFEQKLGEAVLIPAGCPHQVR  912

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPEN+ EC+RLT+ FR LP +HRAKEDKLE+KKM   A+ E L
Sbjct  913  NLKSCIKVALDFVSPENVGECVRLTKEFRRLPSSHRAKEDKLEIKKMAFHALNEVL  968



>ref|NP_001048603.1| Os02g0828900 [Oryza sativa Japonica Group]
 dbj|BAD22934.1| putative DNA-binding protein PD3, chloroplast [Oryza sativa Japonica 
Group]
 dbj|BAD23072.1| putative DNA-binding protein PD3, chloroplast [Oryza sativa Japonica 
Group]
 dbj|BAF10517.1| Os02g0828900 [Oryza sativa Japonica Group]
Length=995

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV+HPIHDQAFYLT EHK++LKEEYG+EPWTF QKLG+AV IPAGCPHQVR
Sbjct  852  RHIHCNPVKQVIHPIHDQAFYLTAEHKRKLKEEYGVEPWTFEQKLGEAVLIPAGCPHQVR  911

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPEN+ EC+RLT+ FR LP +HRAKEDKLE+KKM   A+ E L
Sbjct  912  NLKSCIKVALDFVSPENVGECVRLTKEFRRLPSSHRAKEDKLEIKKMAFHALNEVL  967



>gb|EEE58101.1| hypothetical protein OsJ_08976 [Oryza sativa Japonica Group]
Length=996

 Score =   195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV+HPIHDQAFYLT EHK++LKEEYG+EPWTF QKLG+AV IPAGCPHQVR
Sbjct  853  RHIHCNPVKQVIHPIHDQAFYLTAEHKRKLKEEYGVEPWTFEQKLGEAVLIPAGCPHQVR  912

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPEN+ EC+RLT+ FR LP +HRAKEDKLE+KKM   A+ E L
Sbjct  913  NLKSCIKVALDFVSPENVGECVRLTKEFRRLPSSHRAKEDKLEIKKMAFHALNEVL  968



>ref|XP_003537382.1| PREDICTED: uncharacterized protein LOC100808936 isoform X1 [Glycine 
max]
Length=1106

 Score =   196 bits (498),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH+HC  V +V HPIHDQ FYLT  HK +LKEE+G+EPWTFIQ LG+AVFIPAGCPHQVR
Sbjct  983   RHLHCSQVEKVFHPIHDQVFYLTSYHKSKLKEEFGVEPWTFIQNLGEAVFIPAGCPHQVR  1042

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPENI EC+RLTE FR+LP+NH+AKEDKL VKKM + A+++A  D+E
Sbjct  1043  NLKSCIKVALDFVSPENIQECIRLTEEFRSLPKNHKAKEDKLGVKKMCLYALRKAADDLE  1102

Query  248   KL  243
             KL
Sbjct  1103  KL  1104



>ref|XP_009614455.1| PREDICTED: lysine-specific demethylase JMJ25-like [Nicotiana 
tomentosiformis]
 ref|XP_009614456.1| PREDICTED: lysine-specific demethylase JMJ25-like [Nicotiana 
tomentosiformis]
 ref|XP_009614457.1| PREDICTED: lysine-specific demethylase JMJ25-like [Nicotiana 
tomentosiformis]
Length=1200

 Score =   196 bits (498),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +C PV QV HPIHDQ FYLT+EHK++LKEE+GIEPWTF Q+LG+AVFIPAGCPHQVR
Sbjct  1075  RHTYCCPVDQVFHPIHDQTFYLTLEHKRKLKEEFGIEPWTFEQRLGEAVFIPAGCPHQVR  1134

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC KVA DFVSPENI EC+RLT  FR LP+ H+ +EDKLE+KKMII A+ + + D+E
Sbjct  1135  NLKSCTKVAADFVSPENIQECLRLTAEFRKLPRGHKVREDKLEIKKMIIHAINQVVTDLE  1194

Query  248   KLT  240
             +LT
Sbjct  1195  QLT  1197



>ref|XP_009801360.1| PREDICTED: lysine-specific demethylase JMJ25-like [Nicotiana 
sylvestris]
 ref|XP_009801361.1| PREDICTED: lysine-specific demethylase JMJ25-like [Nicotiana 
sylvestris]
Length=1185

 Score =   196 bits (498),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +C PV QV HPIHDQ FYLT+EHK++LKEE+GIEPWTF Q+LG+AVFIPAGCPHQVR
Sbjct  1060  RHTYCCPVDQVFHPIHDQTFYLTLEHKRKLKEEFGIEPWTFEQRLGEAVFIPAGCPHQVR  1119

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC KVA DFVSPENI EC+RLT  FR LP+ H+ +EDKLE+KKMII A+ + + D+E
Sbjct  1120  NLKSCTKVAADFVSPENIQECLRLTAEFRKLPRGHKVREDKLEIKKMIIHAINQVVTDLE  1179

Query  248   KLT  240
             +LT
Sbjct  1180  QLT  1182



>emb|CDP11593.1| unnamed protein product [Coffea canephora]
Length=958

 Score =   194 bits (494),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH+ C P+ QVVHPIHDQ  YLT+EHK++LKEEY IEPWTFIQKLGDAV++PAGCPHQVR
Sbjct  795  RHVCCRPLEQVVHPIHDQTIYLTMEHKRKLKEEYSIEPWTFIQKLGDAVYVPAGCPHQVR  854

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPEN+ E  R+TE FR LPQNHRAKEDKLEVKKM   A+++A+ D+E
Sbjct  855  NLKSCIKVALDFVSPENVGEGFRMTEEFRVLPQNHRAKEDKLEVKKMTYYAMRQAVLDLE  914



>ref|XP_006480383.1| PREDICTED: uncharacterized protein LOC102609204 [Citrus sinensis]
Length=724

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++C PV QVVHPIHDQ FYL + HKK+LKEE+G+EPW+F+Q+LG+AV IPAGCPHQVR
Sbjct  601  RHVYCSPVEQVVHPIHDQTFYLNMYHKKKLKEEFGVEPWSFVQQLGEAVLIPAGCPHQVR  660

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NL SC K+A+DFVSPENI+EC+RLT+ FRTLP+NHRAK+DKL+VKKM + A+   ++ +E
Sbjct  661  NLMSCTKIALDFVSPENINECIRLTDEFRTLPRNHRAKKDKLQVKKMCLHAIDYVVQGLE  720

Query  248  KLT  240
            KLT
Sbjct  721  KLT  723



>ref|XP_007043268.1| Transcription factor jumonji domain-containing protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOX99099.1| Transcription factor jumonji domain-containing protein, putative 
isoform 2 [Theobroma cacao]
Length=1146

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             R++HC PV QV HPIHDQ F+LT++HK +LK+EYGIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  1015  RYVHCCPVSQVFHPIHDQTFFLTLDHKAKLKKEYGIEPWTFVQKLGEAVFIPAGCPHQVR  1074

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
             N+KSC+KVA+DFVSPEN+ EC+RLTE FR LPQ+HRA+EDKLEVKKM + A+ EA+
Sbjct  1075  NIKSCIKVALDFVSPENVGECVRLTEEFRVLPQDHRAREDKLEVKKMTVHAICEAV  1130



>ref|XP_007043267.1| Transcription factor jumonji domain-containing protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX99098.1| Transcription factor jumonji domain-containing protein, putative 
isoform 1 [Theobroma cacao]
Length=1199

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             R++HC PV QV HPIHDQ F+LT++HK +LK+EYGIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  1068  RYVHCCPVSQVFHPIHDQTFFLTLDHKAKLKKEYGIEPWTFVQKLGEAVFIPAGCPHQVR  1127

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
             N+KSC+KVA+DFVSPEN+ EC+RLTE FR LPQ+HRA+EDKLEVKKM + A+ EA+
Sbjct  1128  NIKSCIKVALDFVSPENVGECVRLTEEFRVLPQDHRAREDKLEVKKMTVHAICEAV  1183



>gb|KDP27278.1| hypothetical protein JCGZ_21009 [Jatropha curcas]
Length=1190

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHI+C PV +VVHPIHDQ  YL   HK++LKEE+G+EPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  1066  RHIYCSPVDEVVHPIHDQTLYLDSNHKRKLKEEFGVEPWTFVQKLGEAVFIPAGCPHQVR  1125

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPENI EC RLTE FR LP NHRAKEDKLEVKKM + A+  A++++E
Sbjct  1126  NLKSCIKVALDFVSPENIPECTRLTEEFRMLPHNHRAKEDKLEVKKMCLHALSIAVEELE  1185

Query  248   KLTLE  234
             KL  E
Sbjct  1186  KLQDE  1190



>ref|XP_008680032.1| PREDICTED: uncharacterized protein LOC103654986 [Zea mays]
 gb|AFW66811.1| putative jumonji-like transcription factor family protein [Zea 
mays]
Length=999

 Score =   194 bits (494),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +  PV QV HPIHDQ FYLT+EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  866  RHCNFEPVKQVTHPIHDQCFYLTIEHKRKLKEEYGVEPWTFEQKLGEAVFIPAGCPHQVR  925

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
            NLKSC+KVA+DFVSPEN+ EC+RLTEGFR LP+ H+  EDKLEVKK+ + A  +A+KDI
Sbjct  926  NLKSCIKVALDFVSPENVRECIRLTEGFRLLPKWHKVNEDKLEVKKIALHAFNQAIKDI  984



>gb|AFW63902.1| putative jumonji-like transcription factor family protein [Zea 
mays]
Length=1148

 Score =   195 bits (496),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHI+C PV +V HPIHDQ+FYLT EHK++LKEEYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  987   RHIYCNPVKKVFHPIHDQSFYLTEEHKRKLKEEYGIEPWTFEQKLGEAVFIPAGCPHQVR  1046

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC++LTE FR LP  H+AKEDKLE+KKM + A+ EA+  ++
Sbjct  1047  NLKSCIKVALDFVSPENVGECVKLTEEFRRLPSFHKAKEDKLEIKKMAVHALNEAVNFLD  1106

Query  248   KLTLE  234
               + E
Sbjct  1107  PRSSE  1111



>ref|XP_006407817.1| hypothetical protein EUTSA_v10020080mg [Eutrema salsugineum]
 gb|ESQ49270.1| hypothetical protein EUTSA_v10020080mg [Eutrema salsugineum]
Length=817

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV QVVHPIHDQ FYLT  HK +LKEEYGIEPWTF+QKLGDAV IP GCPHQVR
Sbjct  693  RHIYCCPVSQVVHPIHDQCFYLTRYHKMKLKEEYGIEPWTFVQKLGDAVLIPVGCPHQVR  752

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPEN+ EC RLT+ +R LP NH +KEDKL++KKM+I AV +ALKD+ 
Sbjct  753  NLKSCTKVALDFVSPENVGECFRLTKEYRLLPPNHHSKEDKLQIKKMVIYAVDKALKDLN  812

Query  248  K  246
            +
Sbjct  813  R  813



>ref|XP_010107786.1| Lysine-specific demethylase 3B [Morus notabilis]
 gb|EXC16951.1| Lysine-specific demethylase 3B [Morus notabilis]
Length=2152

 Score =   196 bits (499),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +  PV QV+HPIHDQ  YLT+EHK++LKEEYGIEPWTF+QKLGDAV IPAGCPHQVR
Sbjct  2009  RHTYGCPVHQVIHPIHDQTMYLTMEHKRKLKEEYGIEPWTFVQKLGDAVLIPAGCPHQVR  2068

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
             NLKSC+KVA+DFVSPEN+ EC+RLTE FRTLP  H+AKEDKLEVKKM + A+KE ++ +
Sbjct  2069  NLKSCIKVALDFVSPENVDECVRLTEEFRTLPSGHKAKEDKLEVKKMALYAMKEVVETL  2127



>ref|XP_003614288.1| Lysine-specific demethylase 3B [Medicago truncatula]
 gb|AES97246.1| transcription factor jumonji (JmjC) domain protein [Medicago 
truncatula]
Length=830

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C P+ QV+HPIHDQ FYLT  HKKRLKEEYGIEPW+F+QKLGDAVFIPAGCPHQVR
Sbjct  676  RHIYCSPLKQVIHPIHDQTFYLTNNHKKRLKEEYGIEPWSFVQKLGDAVFIPAGCPHQVR  735

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVA+DFVSPEN+ EC RLTE  R LP NH   EDKL+VKKMII A+ + ++ +E
Sbjct  736  NLKSCTKVALDFVSPENVGECFRLTEEIRKLPVNHYFTEDKLQVKKMIIHAMLDVVEKLE  795

Query  248  KLTL  237
            K  L
Sbjct  796  KARL  799



>ref|XP_009123380.1| PREDICTED: uncharacterized protein LOC103848169 isoform X3 [Brassica 
rapa]
Length=878

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 109/124 (88%), Gaps = 2/124 (2%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGI--EPWTFIQKLGDAVFIPAGCPHQ  435
            RH +C PV +V HPIHDQ+ YLTVEHK++LK E+GI  EPWTF+QKLG+AVFIPAGCPHQ
Sbjct  746  RHAYCCPVTKVYHPIHDQSCYLTVEHKRKLKAEFGIWIEPWTFVQKLGEAVFIPAGCPHQ  805

Query  434  VRNLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKD  255
            VRNLKSC KVAVDFVSPENI EC+RLTE FR LP+NH+A+EDKLE+KKM+I A+++AL +
Sbjct  806  VRNLKSCTKVAVDFVSPENIKECLRLTEEFRQLPKNHKAREDKLEIKKMVIYAIEQALIE  865

Query  254  IEKL  243
            +E L
Sbjct  866  LETL  869



>ref|XP_007022639.1| Transcription factor jumonji domain-containing protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY14164.1| Transcription factor jumonji domain-containing protein, putative 
isoform 2 [Theobroma cacao]
Length=957

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PVPQVV PIHDQ  +LT+EHKK+LKEEYGIEPWTFIQKLG+AVFIPAGCPHQVR
Sbjct  825  RHIYCCPVPQVVDPIHDQTLFLTLEHKKKLKEEYGIEPWTFIQKLGEAVFIPAGCPHQVR  884

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            N+KSC+KVA+DFVSPEN  EC+RL E FR LPQ HRAKEDKLEV+KMI+ A+ E +
Sbjct  885  NIKSCIKVALDFVSPENTGECVRLAEEFRLLPQGHRAKEDKLEVRKMILHAMCETV  940



>ref|XP_003576493.2| PREDICTED: lysine-specific demethylase JMJ25-like [Brachypodium 
distachyon]
Length=898

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV ++ +P+HD+ FYLT EHK++LKEE+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  762  RHIYCSPVEKIFNPLHDETFYLTKEHKRKLKEEHGIEPWTFVQKLGEAVFIPAGCPHQVR  821

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC K+A+DFVSPEN++EC++LT+ FR LP+NHRAKEDKLEVKKMII AV++A++ ++
Sbjct  822  NLKSCTKIALDFVSPENVNECLKLTQQFRMLPKNHRAKEDKLEVKKMIIYAVEQAVRTLK  881



>ref|XP_007022640.1| Transcription factor jumonji domain-containing protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOY14165.1| Transcription factor jumonji domain-containing protein, putative 
isoform 3 [Theobroma cacao]
Length=967

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PVPQVV PIHDQ  +LT+EHKK+LKEEYGIEPWTFIQKLG+AVFIPAGCPHQVR
Sbjct  825  RHIYCCPVPQVVDPIHDQTLFLTLEHKKKLKEEYGIEPWTFIQKLGEAVFIPAGCPHQVR  884

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            N+KSC+KVA+DFVSPEN  EC+RL E FR LPQ HRAKEDKLEV+KMI+ A+ E +
Sbjct  885  NIKSCIKVALDFVSPENTGECVRLAEEFRLLPQGHRAKEDKLEVRKMILHAMCETV  940



>ref|XP_006650227.1| PREDICTED: uncharacterized protein LOC102706545 isoform X1 [Oryza 
brachyantha]
Length=801

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV HPIHDQ FYLT EHK++LK+EYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  622  RHIHCDPVKQVYHPIHDQTFYLTAEHKRKLKKEYGIEPWTFEQKLGEAVFIPAGCPHQVR  681

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPEN+ EC++LT  FR LP +HRAKEDKLE+KK+ + A+KE +  ++
Sbjct  682  NLKSCIKVALDFVSPENVSECVKLTGEFRRLPSHHRAKEDKLEIKKIALNALKEVVNFLD  741

Query  248  KLT  240
             L+
Sbjct  742  PLS  744



>ref|XP_006650228.1| PREDICTED: uncharacterized protein LOC102706545 isoform X2 [Oryza 
brachyantha]
Length=776

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV HPIHDQ FYLT EHK++LK+EYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  597  RHIHCDPVKQVYHPIHDQTFYLTAEHKRKLKKEYGIEPWTFEQKLGEAVFIPAGCPHQVR  656

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPEN+ EC++LT  FR LP +HRAKEDKLE+KK+ + A+KE +  ++
Sbjct  657  NLKSCIKVALDFVSPENVSECVKLTGEFRRLPSHHRAKEDKLEIKKIALNALKEVVNFLD  716

Query  248  KLT  240
             L+
Sbjct  717  PLS  719



>ref|XP_011021911.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Populus euphratica]
Length=1247

 Score =   195 bits (495),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+ +VVH IHDQ FY T+EHK++LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  1124  RHIHCCPLQKVVHSIHDQTFYFTLEHKRKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  1183

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
             NLKSC+KVA+DFVSPEN+ EC+ LTE FR LP NH+AKEDKLE+KKM++ A + A+
Sbjct  1184  NLKSCIKVALDFVSPENVGECIHLTEEFRQLPPNHQAKEDKLEIKKMLLHAARHAV  1239



>ref|XP_011021910.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Populus euphratica]
Length=1254

 Score =   195 bits (495),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+ +VVH IHDQ FY T+EHK++LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  1124  RHIHCCPLQKVVHSIHDQTFYFTLEHKRKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  1183

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
             NLKSC+KVA+DFVSPEN+ EC+ LTE FR LP NH+AKEDKLE+KKM++ A + A+
Sbjct  1184  NLKSCIKVALDFVSPENVGECIHLTEEFRQLPPNHQAKEDKLEIKKMLLHAARHAV  1239



>gb|EYU21033.1| hypothetical protein MIMGU_mgv1a019315mg, partial [Erythranthe 
guttata]
Length=346

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C  + QVVHPIHDQ  YL++EHK++LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  244  RHIYCNQLSQVVHPIHDQTVYLSMEHKRKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  303

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLE  300
            NLK C+KVA+DFVSPEN+ EC+RLT+ FR LPQNHRAKEDKLE
Sbjct  304  NLKPCIKVALDFVSPENVQECLRLTQEFRVLPQNHRAKEDKLE  346



>ref|XP_008677146.1| PREDICTED: putative jumonji-like transcription factor family 
protein isoform X1 [Zea mays]
Length=1219

 Score =   194 bits (494),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHI+C PV +V HPIHDQ+FYLT EHK++LKEEYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  1058  RHIYCNPVKKVFHPIHDQSFYLTEEHKRKLKEEYGIEPWTFEQKLGEAVFIPAGCPHQVR  1117

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC++LTE FR LP  H+AKEDKLE+KKM + A+ EA+  ++
Sbjct  1118  NLKSCIKVALDFVSPENVGECVKLTEEFRRLPSFHKAKEDKLEIKKMAVHALNEAVNFLD  1177

Query  248   KLTLE  234
               + E
Sbjct  1178  PRSSE  1182



>ref|XP_011021912.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X3 
[Populus euphratica]
Length=1182

 Score =   194 bits (493),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+ +VVH IHDQ FY T+EHK++LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  1052  RHIHCCPLQKVVHSIHDQTFYFTLEHKRKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  1111

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
             NLKSC+KVA+DFVSPEN+ EC+ LTE FR LP NH+AKEDKLE+KKM++ A + A+
Sbjct  1112  NLKSCIKVALDFVSPENVGECIHLTEEFRQLPPNHQAKEDKLEIKKMLLHAARHAV  1167



>gb|KJB31857.1| hypothetical protein B456_005G211300 [Gossypium raimondii]
Length=1049

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             R++HC PV QV HP+HDQ+FYLT++HK +LK+EYGIEPWTF+QKLG+AV IPAGCPHQVR
Sbjct  918   RYVHCCPVSQVFHPLHDQSFYLTMDHKAKLKQEYGIEPWTFVQKLGEAVLIPAGCPHQVR  977

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALK  258
             N+KSC+KVA+DFVSPEN+ EC+RLTE FR LP++HR KEDKLEVKKM + AV++A+K
Sbjct  978   NIKSCIKVALDFVSPENVGECVRLTEEFRLLPRDHREKEDKLEVKKMTVHAVQQAVK  1034



>gb|EEC75532.1| hypothetical protein OsI_12150 [Oryza sativa Indica Group]
Length=951

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV  V HPIHDQ FYLTVEHK++LKEE+G+EPWTF QKLGDAVFIPAGCPHQVR
Sbjct  782  RHIHCNPVKNVSHPIHDQTFYLTVEHKRKLKEEHGVEPWTFEQKLGDAVFIPAGCPHQVR  841

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+KVA+DFVSPEN+ EC++LT  FR LP +HRAKEDKLE+KK+ + A+KE +  ++
Sbjct  842  NLKSCIKVALDFVSPENVGECVKLTGEFRRLPSDHRAKEDKLEIKKIALNALKEVVNFLD  901

Query  248  KL  243
             L
Sbjct  902  PL  903



>ref|XP_006604048.1| PREDICTED: lysine-specific demethylase 3B-like isoform X1 [Glycine 
max]
Length=798

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH+HC P+ QV+HPIHDQ FYLT+EHK++LKEEYGIEPWTFIQKLGDAVFIP GCPHQVR
Sbjct  664  RHVHCCPLKQVIHPIHDQTFYLTMEHKRKLKEEYGIEPWTFIQKLGDAVFIPVGCPHQVR  723

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVK  294
            NLKSC+KVA+DFVSPEN+ EC RLTE FRTLP NHR+ EDKLE K
Sbjct  724  NLKSCIKVAMDFVSPENVGECFRLTEEFRTLPINHRSTEDKLECK  768



>gb|ABF96755.1| jmjC domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=1056

 Score =   193 bits (491),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC PV  V HPIHDQ FYLTVEHK++LKEE+G+EPWTF QKLGDAVFIPAGCPHQVR
Sbjct  883   RHIHCNPVKNVSHPIHDQTFYLTVEHKRKLKEEHGVEPWTFEQKLGDAVFIPAGCPHQVR  942

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC++LT  FR LP +HRAKEDKLE+KK+ + A+KE +  ++
Sbjct  943   NLKSCIKVALDFVSPENVGECVKLTGEFRRLPSDHRAKEDKLEIKKIALNALKEVVNFLD  1002

Query  248   KL  243
              L
Sbjct  1003  PL  1004



>ref|XP_010506391.1| PREDICTED: lysine-specific demethylase JMJ25-like [Camelina sativa]
Length=458

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C P+ QV HPIHDQ  YLT  H K+LKEEYGIEPWTF QKLGDAV IP GCPHQVR
Sbjct  202  RHFYCCPLSQVSHPIHDQTIYLTRYHIKKLKEEYGIEPWTFNQKLGDAVLIPVGCPHQVR  261

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
            NLKSC KVA+DFVSPENI EC+RLT+ FR LP NH AKEDKLEVKKMII AV ++L+D+
Sbjct  262  NLKSCTKVALDFVSPENISECLRLTKQFRLLPPNHFAKEDKLEVKKMIIHAVDKSLRDL  320



>gb|ABF96756.1| jmjC domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=1052

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC PV  V HPIHDQ FYLTVEHK++LKEE+G+EPWTF QKLGDAVFIPAGCPHQVR
Sbjct  883   RHIHCNPVKNVSHPIHDQTFYLTVEHKRKLKEEHGVEPWTFEQKLGDAVFIPAGCPHQVR  942

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC++LT  FR LP +HRAKEDKLE+KK+ + A+KE +  ++
Sbjct  943   NLKSCIKVALDFVSPENVGECVKLTGEFRRLPSDHRAKEDKLEIKKIALNALKEVVNFLD  1002

Query  248   KL  243
              L
Sbjct  1003  PL  1004



>ref|XP_004168323.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221956 
[Cucumis sativus]
Length=930

 Score =   192 bits (488),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            R+IH   VPQV HP+HDQ+FYLT+EHK+RLKEEYGIEPWTF+Q LGDAVFIPAGCPHQVR
Sbjct  798  RYIHAGTVPQVFHPVHDQSFYLTLEHKRRLKEEYGIEPWTFVQNLGDAVFIPAGCPHQVR  857

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPEN+ EC+ LTE FR LP NH AKEDKLEVKKM + A+K  +
Sbjct  858  NLKSCIKVAMDFVSPENVGECIHLTEEFRRLPSNHWAKEDKLEVKKMSVYAMKATI  913



>ref|XP_008463115.1| PREDICTED: uncharacterized protein LOC103501341 [Cucumis melo]
Length=1024

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIH   VPQV HP+HDQ+FYLT+EHK++LKEEYGIEPWTF+Q LGDAVFIPAGCPHQVR
Sbjct  871  RHIHAGTVPQVFHPVHDQSFYLTLEHKRKLKEEYGIEPWTFVQNLGDAVFIPAGCPHQVR  930

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPEN+ EC+ LTE FR LP NH AKEDKLEVKKM + A+K  +
Sbjct  931  NLKSCIKVAMDFVSPENVGECIHLTEEFRRLPSNHWAKEDKLEVKKMSVYAMKATI  986



>ref|XP_002453143.1| hypothetical protein SORBIDRAFT_04g000775 [Sorghum bicolor]
 gb|EES06119.1| hypothetical protein SORBIDRAFT_04g000775 [Sorghum bicolor]
Length=772

 Score =   191 bits (484),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +   V QV HPIHDQ FYLT EHK++LKEEYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  645  RHCNFETVKQVTHPIHDQCFYLTNEHKRKLKEEYGIEPWTFEQKLGEAVFIPAGCPHQVR  704

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
            NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP+ HR  EDKLEVKK+ + A+ +A+KDI
Sbjct  705  NLKSCIKVALDFVSPENVRECIRLTEQFRLLPKWHRVNEDKLEVKKIALHALNQAIKDI  763



>ref|XP_004150127.1| PREDICTED: uncharacterized protein LOC101221956 [Cucumis sativus]
Length=955

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            R+IH   VPQV HP+HDQ+FYLT+EHK+RLKEEYGIEPWTF+Q LGDAVFIPAGCPHQVR
Sbjct  798  RYIHAGTVPQVFHPVHDQSFYLTLEHKRRLKEEYGIEPWTFVQNLGDAVFIPAGCPHQVR  857

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPEN+ EC+ LTE FR LP NH AKEDKLEVKKM + A+K  +
Sbjct  858  NLKSCIKVAMDFVSPENVGECIHLTEEFRRLPSNHWAKEDKLEVKKMSVYAMKATI  913



>ref|XP_004301534.1| PREDICTED: lysine-specific demethylase JMJ25-like [Fragaria vesca 
subsp. vesca]
Length=876

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH+HC P+  V H IHDQ  YLT EHK++LKEE+GI+PWTF+QKLGDAVFIPAGCPHQVR
Sbjct  742  RHLHCNPLKSVTHAIHDQTVYLTAEHKRKLKEEFGIQPWTFVQKLGDAVFIPAGCPHQVR  801

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
            NLKSC+KVA+DFVSPEN+ EC RLTE FRTLP NHRA EDKLEVKKMI+  +  A+ +I
Sbjct  802  NLKSCIKVALDFVSPENVGECFRLTEEFRTLPTNHRASEDKLEVKKMIVHTLCNAVMEI  860



>dbj|BAK04490.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=602

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV +  +P+HD+ FYLT EHK+RLKEE+G+EPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  473  RHIYCSPVEKTFNPLHDETFYLTEEHKRRLKEEHGVEPWTFVQKLGEAVFIPAGCPHQVR  532

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALK  258
            NLKSC K+A+DFVSPEN+ EC++LT+ FR LP+NHRAKEDKLEVKKMII AV  A+ 
Sbjct  533  NLKSCTKIAIDFVSPENVQECVKLTQQFRVLPKNHRAKEDKLEVKKMIIYAVDHAVN  589



>ref|XP_009784763.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Nicotiana sylvestris]
Length=1110

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH    PV QVVHPIHDQ FYLTV HKK+LK+E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  968   RHTRGSPVDQVVHPIHDQVFYLTVYHKKKLKQEFGIEPWTFVQKLGEAVFIPAGCPHQVR  1027

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP  HRAKEDKLEVKK+ + A+++A+ D++
Sbjct  1028  NLKSCIKVALDFVSPENVGECIRLTEEFRILPPKHRAKEDKLEVKKLALYALEKAIADLK  1087

Query  248   KL  243
              L
Sbjct  1088  DL  1089



>ref|XP_009784765.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Nicotiana sylvestris]
Length=1107

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH    PV QVVHPIHDQ FYLTV HKK+LK+E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  968   RHTRGSPVDQVVHPIHDQVFYLTVYHKKKLKQEFGIEPWTFVQKLGEAVFIPAGCPHQVR  1027

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP  HRAKEDKLEVKK+ + A+++A+ D++
Sbjct  1028  NLKSCIKVALDFVSPENVGECIRLTEEFRILPPKHRAKEDKLEVKKLALYALEKAIADLK  1087

Query  248   KL  243
              L
Sbjct  1088  DL  1089



>ref|XP_011015684.1| PREDICTED: lysine-specific demethylase JMJ25-like [Populus euphratica]
 ref|XP_011015685.1| PREDICTED: lysine-specific demethylase JMJ25-like [Populus euphratica]
Length=1103

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH  C PV QV HPIHDQ FYL +EHK++LKEE+G+E WTF Q++G+AVFIPAGCPHQVR
Sbjct  977   RHTFCAPVEQVDHPIHDQCFYLNLEHKRKLKEEFGVEAWTFEQRVGEAVFIPAGCPHQVR  1036

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NL+SC KVAVDFVSPENI EC+RLTE FR LP NHRA+EDKLE+KKMII A+ +A+ D++
Sbjct  1037  NLQSCTKVAVDFVSPENIKECLRLTEEFRQLPMNHRAREDKLEIKKMIIYAIDKAIIDLQ  1096

Query  248   KL  243
             +L
Sbjct  1097  EL  1098



>gb|KHN01091.1| Lysine-specific demethylase 3B [Glycine soja]
Length=1132

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC P+ QV+HPIHDQ FYLT+EHKK+LKEEYGIEPWTF QKLGDAVFIPAGCPHQVR
Sbjct  878  RHIHCCPLKQVIHPIHDQTFYLTMEHKKKLKEEYGIEPWTFTQKLGDAVFIPAGCPHQVR  937

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEV  297
            NLKSC+KVA+DFVSPEN+ EC RLTE FRTLP NHR+ EDKLE+
Sbjct  938  NLKSCIKVALDFVSPENVGECFRLTEEFRTLPINHRSTEDKLEI  981



>gb|KHN23225.1| Lysine-specific demethylase 3B [Glycine soja]
Length=873

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH+HC P+ QV+HPIHDQ FYLT+EHK++LKEEYGIEPWTFIQKLGDAVFIP GCPHQVR
Sbjct  768  RHVHCCPLKQVIHPIHDQTFYLTMEHKRKLKEEYGIEPWTFIQKLGDAVFIPVGCPHQVR  827

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEV  297
            NLKSC+KVA+DFVSPEN+ EC RLTE FRTLP NHR+ EDKLEV
Sbjct  828  NLKSCIKVAMDFVSPENVGECFRLTEEFRTLPINHRSTEDKLEV  871



>gb|EMT12717.1| Lysine-specific demethylase 3B [Aegilops tauschii]
Length=1321

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 108/133 (81%), Gaps = 5/133 (4%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +  PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLGDAVFIPAGCPHQVR
Sbjct  877   RHYNYEPVKQVIHPIHDQCFYLTNEHKRKLKEEYGVEPWTFEQKLGDAVFIPAGCPHQVR  936

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC++LTE FR LP  HR  EDKLEVKK+   A+K A++DI 
Sbjct  937   NLKSCIKVALDFVSPENVKECIKLTEEFRLLPNWHRVNEDKLEVKKIAFHAIKRAIRDIT  996

Query  248   KLTLE*RDGNKLT  210
             K     +DG++ +
Sbjct  997   K-----KDGDRSS  1004



>ref|XP_004956737.1| PREDICTED: uncharacterized protein LOC101782484 [Setaria italica]
Length=1006

 Score =   191 bits (486),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++C PV +  +P+HD+ FYLT +HK++LKEEYGIEPWTF+Q+LG+AVFIPAGCPHQVR
Sbjct  874  RHMYCSPVEKTFNPVHDETFYLTNKHKRKLKEEYGIEPWTFVQRLGEAVFIPAGCPHQVR  933

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC K+A+DFVSPENI +C+ LTE FR LP+NHRAKEDKLEVKKMI+ AV+ AL+ +E
Sbjct  934  NLKSCTKIALDFVSPENIQQCLSLTEDFRRLPKNHRAKEDKLEVKKMIVYAVERALQILE  993

Query  248  K  246
            +
Sbjct  994  E  994



>gb|KHG20930.1| Lysine-specific demethylase 3B [Gossypium arboreum]
Length=1075

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             R++HC PV QV HPIHDQ+FYLT++HK +LK EYGIEPW+F+QKLG+AV IPAGCPHQVR
Sbjct  944   RYVHCCPVSQVFHPIHDQSFYLTMDHKAKLKLEYGIEPWSFVQKLGEAVLIPAGCPHQVR  1003

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALK  258
             N+KSC+KVA+DFVSPEN+ EC+RLTE FR LP++HR KEDKLEVKKM + AV++A+K
Sbjct  1004  NIKSCIKVALDFVSPENVGECVRLTEEFRLLPRDHREKEDKLEVKKMTVHAVQQAVK  1060



>dbj|BAJ94488.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=897

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV +  +P+HD+ FYLT EHK+RLKEE+G+EPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  768  RHIYCSPVEKTFNPLHDETFYLTEEHKRRLKEEHGVEPWTFVQKLGEAVFIPAGCPHQVR  827

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALK  258
            NLKSC K+A+DFVSPEN+ EC++LT+ FR LP+NHRAKEDKLEVKKMII AV  A+ 
Sbjct  828  NLKSCTKIAIDFVSPENVQECVKLTQQFRVLPKNHRAKEDKLEVKKMIIYAVDHAVN  884



>ref|XP_010688669.1| PREDICTED: lysine-specific demethylase JMJ25-like [Beta vulgaris 
subsp. vulgaris]
Length=1283

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+ QV+HPIHDQ FYLT  HK++LKEEYGIEPWT +QKLG+A+FIPAGCPHQVR
Sbjct  1143  RHIHCSPLSQVIHPIHDQTFYLTKAHKRKLKEEYGIEPWTIVQKLGEAIFIPAGCPHQVR  1202

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KV +DFVSPEN+ EC+RL   +RTLPQNHRAK  KLEV+K+II AV + ++++E
Sbjct  1203  NLKSCIKVGLDFVSPENVRECIRLAGEYRTLPQNHRAKVAKLEVQKIIIHAVDKTVRNLE  1262



>gb|KEH42473.1| transcription factor jumonji (JmjC) domain protein [Medicago 
truncatula]
Length=947

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  587  VPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVRNLKSCLK  408
            + +VVHPIHDQ FYLT+EHKKRLKEEYGIEPWTF+QKLGDAVFIPAGCPHQVRNLKSC K
Sbjct  824  LQRVVHPIHDQTFYLTIEHKKRLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVRNLKSCTK  883

Query  407  VAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIEK  246
            VA+DFVSPEN+ EC RLTE FR LP NH++ EDKLEVKKMII A+ + +K +EK
Sbjct  884  VALDFVSPENVGECFRLTEEFRKLPVNHKSAEDKLEVKKMIIYAMVDLVKKLEK  937



>ref|XP_010688671.1| PREDICTED: lysine-specific demethylase JMJ25-like [Beta vulgaris 
subsp. vulgaris]
Length=1318

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+ QV HPIHDQ FYLT EHK++LKEEYGIE WTF+Q LG+AVFIP GCPHQVR
Sbjct  1161  RHIHCNPLKQVFHPIHDQTFYLTEEHKRKLKEEYGIEAWTFVQNLGEAVFIPTGCPHQVR  1220

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
             NLKSC+KVA+DFVSPEN+ EC+RL   FR LPQNH+AKEDKLEVKKM +  V +A+
Sbjct  1221  NLKSCIKVALDFVSPENVGECIRLAGEFRILPQNHKAKEDKLEVKKMTLHGVNQAI  1276



>ref|XP_009765347.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009765348.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Nicotiana sylvestris]
Length=719

 Score =   189 bits (479),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 84/123 (68%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PVPQV+HPIHDQ FYLT +HK++LKE+YG EPWTF+QKLGDAVFIPAGCP+QVR
Sbjct  596  RHINCCPVPQVIHPIHDQTFYLTEDHKRKLKEKYGFEPWTFVQKLGDAVFIPAGCPYQVR  655

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ V + FVSPEN+ EC+RLT+  R L Q+  A EDKLEVKKMI+ A  EA++D+ 
Sbjct  656  NLKSCINVVLGFVSPENVGECIRLTQEVRLLSQDLVAAEDKLEVKKMILYATWEAIEDLA  715

Query  248  KLT  240
             L+
Sbjct  716  MLS  718



>ref|XP_006604041.1| PREDICTED: uncharacterized protein LOC100780803 isoform X2 [Glycine 
max]
Length=1008

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC P+ QV+HPIHDQ FYLT+EHKK+LKEEYGIEPWTF QKLGDAVFIPAGCPHQVR
Sbjct  885  RHIHCCPLKQVIHPIHDQTFYLTMEHKKKLKEEYGIEPWTFTQKLGDAVFIPAGCPHQVR  944

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEV  297
            NLKSC+KVA+DFVSPEN+ EC RLTE FRTLP NHR+ EDKLE+
Sbjct  945  NLKSCIKVALDFVSPENVGECFRLTEEFRTLPINHRSTEDKLEL  988



>ref|XP_009622213.1| PREDICTED: lysine-specific demethylase JMJ25-like [Nicotiana 
tomentosiformis]
Length=1085

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH    PV QVVHPIHDQ FYLT  HKK+LK+E+GIEPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  943   RHTLGSPVDQVVHPIHDQVFYLTAYHKKKLKQEFGIEPWTFVQKLGEAVFIPAGCPHQVR  1002

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP  HRAKEDKLEVKKM + A+++A+ D++
Sbjct  1003  NLKSCIKVALDFVSPENVGECIRLTEEFRLLPGKHRAKEDKLEVKKMALYALEKAVADLK  1062

Query  248   KL  243
              L
Sbjct  1063  DL  1064



>ref|XP_006360372.1| PREDICTED: uncharacterized protein LOC102592630 [Solanum tuberosum]
Length=734

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+PQVVHPI D+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AVF+PAGCPHQVR
Sbjct  611  RHIYGSPLPQVVHPILDETFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVFVPAGCPHQVR  670

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDF+SPEN++E +RLTE  R LP+NH A+EDKL VKK+I+ A+ +A+  +E
Sbjct  671  NLKSCINVAVDFISPENVNESIRLTEELRKLPRNHEAREDKLGVKKIIVHAMSQAVNQLE  730

Query  248  KLTL  237
            K  L
Sbjct  731  KTLL  734



>ref|NP_001146639.1| putative jumonji-like transcription factor family protein [Zea 
mays]
 gb|ACL54448.1| unknown [Zea mays]
 gb|AFW63899.1| putative jumonji-like transcription factor family protein [Zea 
mays]
Length=298

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PV +V HPIHDQ+FYLT EHK++LKEEYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  189  RHIYCNPVKKVFHPIHDQSFYLTEEHKRKLKEEYGIEPWTFEQKLGEAVFIPAGCPHQVR  248

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKM  288
            NLKSC+KVA+DFVSPEN+ EC++LTE FR LP  H+AKEDKLEV  +
Sbjct  249  NLKSCIKVALDFVSPENVGECVKLTEEFRRLPSFHKAKEDKLEVSNV  295



>ref|XP_007153397.1| hypothetical protein PHAVU_003G0315000g, partial [Phaseolus vulgaris]
 gb|ESW25391.1| hypothetical protein PHAVU_003G0315000g, partial [Phaseolus vulgaris]
Length=673

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH+HC P+ QV+HPIHDQ FYLT+EHK++LKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR
Sbjct  529  RHVHCCPLKQVIHPIHDQTFYLTMEHKRKLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  588

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLE  300
            NLKSC+KVA+DFVSPEN+ EC RLTE FRTLP NH++ EDKLE
Sbjct  589  NLKSCIKVALDFVSPENVGECFRLTEEFRTLPINHKSTEDKLE  631



>ref|XP_002453089.1| hypothetical protein SORBIDRAFT_04g038170 [Sorghum bicolor]
 gb|EES06065.1| hypothetical protein SORBIDRAFT_04g038170 [Sorghum bicolor]
Length=1051

 Score =   191 bits (484),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 87/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHI+C PV +V HPIHDQ+FYLT EHK++LKEEYGIEPWTF QKLG+AVFIPAGCPHQVR
Sbjct  897   RHIYCNPVKKVFHPIHDQSFYLTQEHKRKLKEEYGIEPWTFEQKLGEAVFIPAGCPHQVR  956

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC++LT  FR LP  H+AKEDKLE+KKM + A+ EA+  ++
Sbjct  957   NLKSCIKVALDFVSPENVGECVKLTGEFRRLPSFHKAKEDKLEIKKMALHALNEAVNFLD  1016

Query  248   KLTLE  234
               + E
Sbjct  1017  PCSSE  1021



>ref|XP_011046984.1| PREDICTED: uncharacterized protein LOC105141455 isoform X1 [Populus 
euphratica]
Length=1759

 Score =   192 bits (487),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH  C PV QV HPIHDQ FYL +EHK++LKEE+G+E WTF Q++G+AVFIPAGCPHQVR
Sbjct  1633  RHTFCAPVEQVDHPIHDQCFYLNLEHKRKLKEEFGVEAWTFEQRVGEAVFIPAGCPHQVR  1692

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NL+SC KVAVDFVSPENI EC+RLTE FR LP NHRA+EDKLE+KKMI+ A+ +A+ D++
Sbjct  1693  NLQSCTKVAVDFVSPENIKECLRLTEEFRQLPMNHRAREDKLEIKKMIVYAIDKAIIDLQ  1752

Query  248   KL  243
             +L
Sbjct  1753  EL  1754



>ref|XP_009765350.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X3 
[Nicotiana sylvestris]
Length=686

 Score =   188 bits (477),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 84/123 (68%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+C PVPQV+HPIHDQ FYLT +HK++LKE+YG EPWTF+QKLGDAVFIPAGCP+QVR
Sbjct  563  RHINCCPVPQVIHPIHDQTFYLTEDHKRKLKEKYGFEPWTFVQKLGDAVFIPAGCPYQVR  622

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ V + FVSPEN+ EC+RLT+  R L Q+  A EDKLEVKKMI+ A  EA++D+ 
Sbjct  623  NLKSCINVVLGFVSPENVGECIRLTQEVRLLSQDLVAAEDKLEVKKMILYATWEAIEDLA  682

Query  248  KLT  240
             L+
Sbjct  683  MLS  685



>gb|EMS49877.1| Lysine-specific demethylase 3B [Triticum urartu]
Length=1377

 Score =   191 bits (486),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 88/121 (73%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH +  PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLGDAVFIPAGCPHQVR
Sbjct  941   RHYNYEPVKQVIHPIHDQCFYLTDEHKRKLKEEYGVEPWTFEQKLGDAVFIPAGCPHQVR  1000

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP+ HR  EDKLEVKK+   A+K A+ D  
Sbjct  1001  NLKSCIKVALDFVSPENVQECIRLTEEFRLLPKGHRVNEDKLEVKKIAFHAIKRAIHDFN  1060

Query  248   K  246
             K
Sbjct  1061  K  1061



>ref|XP_010648867.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X3 
[Vitis vinifera]
Length=1132

 Score =   191 bits (484),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RH HC PV QVVHPIHDQ FYLT+ HK++LKEE+G+EPWTF+QKLG+AVFIPAGCPHQVR
Sbjct  1029  RHTHCSPVEQVVHPIHDQTFYLTLHHKRKLKEEFGVEPWTFVQKLGEAVFIPAGCPHQVR  1088

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLE  300
             NLKSC+KVA+DFVSPENIHEC+RLTE FR LP NHRAKEDKLE
Sbjct  1089  NLKSCIKVALDFVSPENIHECVRLTEEFRALPHNHRAKEDKLE  1131



>ref|XP_007147691.1| hypothetical protein PHAVU_006G146500g [Phaseolus vulgaris]
 gb|ESW19685.1| hypothetical protein PHAVU_006G146500g [Phaseolus vulgaris]
Length=837

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C PV +VVHPI+DQ FYLT+EHKK LK+E+G+EPWTF Q+LG+AVFIPAGC HQVR
Sbjct  714  RHTYCSPVEEVVHPINDQCFYLTLEHKKNLKKEFGVEPWTFEQQLGEAVFIPAGCAHQVR  773

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC KVAVDFVSPEN+H C+ LTE FR LP+NH+A+EDKLE++KMI+ AV  A+K+++
Sbjct  774  NLKSCTKVAVDFVSPENVHMCLHLTEEFRRLPKNHKAREDKLEIQKMILYAVDNAVKELQ  833

Query  248  KL  243
             L
Sbjct  834  AL  835



>tpg|DAA50229.1| TPA: putative jumonji-like transcription factor family protein 
[Zea mays]
Length=1050

 Score =   190 bits (483),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 84/116 (72%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI C PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  839  RHIFCNPVKQVIHPIHDQTFYLTEEHKRKLKEEYGVEPWTFEQKLGEAVFIPAGCPHQVR  898

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPE+++ECM+LT  FR LP +HRAKEDKLE+KK+ + A+ + +
Sbjct  899  NLKSCIKVAMDFVSPESVNECMKLTGEFRRLPPDHRAKEDKLEIKKIALHALNQVV  954



>ref|XP_002520404.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41959.1| conserved hypothetical protein [Ricinus communis]
Length=1099

 Score =   190 bits (483),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+ +VVHPIHDQ FYLT+EHK++LKEE+GIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  988   RHIHCCPLQKVVHPIHDQTFYLTLEHKRKLKEEFGIEPWTFVQKLGDAVFIPAGCPHQVR  1047

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLE  300
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP NHRAKEDKLE
Sbjct  1048  NLKSCIKVALDFVSPENVGECIRLTEEFRLLPPNHRAKEDKLE  1090



>ref|XP_010518064.1| PREDICTED: lysine-specific demethylase JMJ25-like [Camelina sativa]
Length=993

 Score =   189 bits (481),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C P+PQV HPIHDQ  YLT  H K+LKEEYGIEPWTF QKLGDAV IP GCPHQVR
Sbjct  737  RHFYCCPLPQVSHPIHDQTIYLTRYHIKKLKEEYGIEPWTFNQKLGDAVLIPVGCPHQVR  796

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
            NLKSC KVA+DFVSPENI EC+RLT+ FR LP NH AKEDKLEVKKMII AV ++L+D+
Sbjct  797  NLKSCTKVALDFVSPENISECLRLTKQFRLLPPNHFAKEDKLEVKKMIIHAVDKSLRDL  855



>ref|XP_011101207.1| PREDICTED: LOW QUALITY PROTEIN: lysine-specific demethylase JMJ25-like 
[Sesamum indicum]
Length=1246

 Score =   190 bits (483),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 90/124 (73%), Positives = 106/124 (85%), Gaps = 3/124 (2%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIH  PV QVVHPIHDQ+ YLT  HK +LKEE+G+EPWTF+QKLG+AVFI    PHQVR
Sbjct  1088  RHIHGCPVEQVVHPIHDQSLYLTSYHKAKLKEEFGVEPWTFVQKLGEAVFIX---PHQVR  1144

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             NLKSC+KVA+DFVSPEN+ EC+RLTEGFRTLPQNHRAKEDKLEVKKM I A+++A+  ++
Sbjct  1145  NLKSCIKVALDFVSPENLGECIRLTEGFRTLPQNHRAKEDKLEVKKMAIHALQDAVSHLK  1204

Query  248   KLTL  237
              L L
Sbjct  1205  DLFL  1208



>ref|XP_008665049.1| PREDICTED: uncharacterized protein LOC103643664 isoform X1 [Zea 
mays]
Length=1060

 Score =   189 bits (481),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 84/116 (72%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI C PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  849  RHIFCNPVKQVIHPIHDQTFYLTEEHKRKLKEEYGVEPWTFEQKLGEAVFIPAGCPHQVR  908

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPE+++ECM+LT  FR LP +HRAKEDKLE+KK+ + A+ + +
Sbjct  909  NLKSCIKVAMDFVSPESVNECMKLTGEFRRLPPDHRAKEDKLEIKKIALHALNQVV  964



>ref|XP_004982480.1| PREDICTED: uncharacterized protein LOC101776595 [Setaria italica]
Length=889

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGC HQVR
Sbjct  671  RHIHCNPVKQVIHPIHDQTFYLTEEHKRKLKEEYGVEPWTFEQKLGEAVFIPAGCAHQVR  730

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPEN+ EC++LTE FR LP  HRAKEDKLE+KK+ + A+ + +
Sbjct  731  NLKSCIKVAMDFVSPENVDECIKLTEEFRRLPSGHRAKEDKLEIKKIALHALNQVV  786



>ref|XP_008665051.1| PREDICTED: uncharacterized protein LOC103643664 isoform X3 [Zea 
mays]
Length=1055

 Score =   189 bits (480),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 84/116 (72%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI C PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  844  RHIFCNPVKQVIHPIHDQTFYLTEEHKRKLKEEYGVEPWTFEQKLGEAVFIPAGCPHQVR  903

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPE+++ECM+LT  FR LP +HRAKEDKLE+KK+ + A+ + +
Sbjct  904  NLKSCIKVAMDFVSPESVNECMKLTGEFRRLPPDHRAKEDKLEIKKIALHALNQVV  959



>ref|XP_008665050.1| PREDICTED: uncharacterized protein LOC103643664 isoform X2 [Zea 
mays]
Length=1057

 Score =   189 bits (480),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 84/116 (72%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI C PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  846  RHIFCNPVKQVIHPIHDQTFYLTEEHKRKLKEEYGVEPWTFEQKLGEAVFIPAGCPHQVR  905

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPE+++ECM+LT  FR LP +HRAKEDKLE+KK+ + A+ + +
Sbjct  906  NLKSCIKVAMDFVSPESVNECMKLTGEFRRLPPDHRAKEDKLEIKKIALHALNQVV  961



>ref|XP_003592704.1| Lysine-specific demethylase 3B [Medicago truncatula]
 ref|XP_003636728.1| Lysine-specific demethylase 3B [Medicago truncatula]
Length=1153

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  578   VVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVRNLKSCLKVAV  399
             V+HPIHDQ FYLT+EHKKRLKEEYGIEPWTF QKLGDAVFIPAGCPHQVRNLKSC KVA+
Sbjct  1033  VIHPIHDQHFYLTIEHKKRLKEEYGIEPWTFFQKLGDAVFIPAGCPHQVRNLKSCTKVAL  1092

Query  398   DFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIEK  246
             DFVSPEN+ EC RLTE FR LP NHR+ EDKLEVKKMII A+ E ++ +EK
Sbjct  1093  DFVSPENVGECFRLTEEFRKLPVNHRSTEDKLEVKKMIIYAMLELVEKLEK  1143



>ref|XP_002306344.2| hypothetical protein POPTR_0005s08460g [Populus trichocarpa]
 gb|EEE93340.2| hypothetical protein POPTR_0005s08460g [Populus trichocarpa]
Length=1203

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHIHC P+ +VVH IHDQ FYLT+EHK++LKEEYGIEPWTF+QKLGDAVFIPAGCPHQVR
Sbjct  1086  RHIHCCPLQKVVHSIHDQTFYLTLEHKRKLKEEYGIEPWTFVQKLGDAVFIPAGCPHQVR  1145

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEV  297
             NLKSC+KVA+DFVSPEN+ EC+RLTE FR LP NH+AKEDKLEV
Sbjct  1146  NLKSCIKVALDFVSPENVGECIRLTEEFRLLPPNHQAKEDKLEV  1189



>gb|KDP30574.1| hypothetical protein JCGZ_16953 [Jatropha curcas]
Length=2143

 Score =   189 bits (481),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 82/125 (66%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -3

Query  608   RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
             RHI    V  V+HPIHDQ FYL   HK+ LKEE+ +EPWTF Q LG+AVFIPAGCPHQVR
Sbjct  2004  RHISNLAVNSVIHPIHDQTFYLNERHKRLLKEEFNVEPWTFEQHLGEAVFIPAGCPHQVR  2063

Query  428   NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
             N +SC+KVA+DFVSP+N+ EC+RLTE FR LP+NHRAKEDKLEVKKM + AV+ A+ + +
Sbjct  2064  NRQSCIKVALDFVSPDNVQECIRLTEEFRMLPKNHRAKEDKLEVKKMTLYAVRAAVSEAK  2123

Query  248   KLTLE  234
              +T E
Sbjct  2124  NMTFE  2128



>ref|XP_006296905.1| hypothetical protein CARUB_v10012897mg [Capsella rubella]
 gb|EOA29803.1| hypothetical protein CARUB_v10012897mg [Capsella rubella]
Length=983

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++C PV QVVHPIHDQ FYLT  H  +LKEEYGIEPWTF QKLGDAV IP GCPHQVR
Sbjct  732  RHLYCSPVSQVVHPIHDQNFYLTRYHIMKLKEEYGIEPWTFNQKLGDAVLIPVGCPHQVR  791

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
            NLKSC KVA+DFVSPENI EC+RLT+ +R LP NH AKEDKL VKKMII AV +AL+D+
Sbjct  792  NLKSCTKVALDFVSPENIGECLRLTKQYRLLPPNHFAKEDKLAVKKMIIHAVDKALRDL  850



>ref|XP_004247948.2| PREDICTED: lysine-specific demethylase JMJ25-like [Solanum lycopersicum]
Length=1131

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHI+  P+PQVVHPI D+ FYL+ EHK+RLKEEYGIEPWTF+QKLG+AV +PAGCPHQVR
Sbjct  639  RHIYGSPLPQVVHPILDETFYLSTEHKRRLKEEYGIEPWTFVQKLGEAVIVPAGCPHQVR  698

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDIE  249
            NLKSC+ VAVDF+SPEN++E +RLTE  R LP+NH A+EDKL VKK+I+ A+ +A+  +E
Sbjct  699  NLKSCINVAVDFISPENVNESIRLTEELRKLPRNHEAREDKLGVKKIIVHAMSQAVNQLE  758

Query  248  KLTL  237
            K  L
Sbjct  759  KTLL  762



>ref|XP_002462335.1| hypothetical protein SORBIDRAFT_02g024010 [Sorghum bicolor]
 gb|EER98856.1| hypothetical protein SORBIDRAFT_02g024010 [Sorghum bicolor]
Length=613

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH++C PV ++ +P+HD+ FYLT +HK+ LK+EYGIEPWTF+Q LGDAVFIPAGCPHQVR
Sbjct  485  RHMYCCPVEKIFNPVHDEKFYLTNKHKRELKKEYGIEPWTFVQGLGDAVFIPAGCPHQVR  544

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC K+A+DFVSPENI +C+ LTE FR LP  HRAKEDKLEVKKMI+ AV+ AL
Sbjct  545  NLKSCTKIALDFVSPENIQQCLSLTEDFRRLPVGHRAKEDKLEVKKMIVYAVEHAL  600



>ref|XP_010238030.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X3 
[Brachypodium distachyon]
Length=905

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  756  RHIHCNPVKQVIHPIHDQTFYLTAEHKRKLKEEYGVEPWTFEQKLGEAVFIPAGCPHQVR  815

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPEN+ E ++LT  FR LP  HRAKEDKLE+KKM I A+   +
Sbjct  816  NLKSCVKVALDFVSPENVGEFVKLTNEFRRLPSTHRAKEDKLEIKKMAIHALTNVI  871



>ref|XP_010238028.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Brachypodium distachyon]
Length=918

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  769  RHIHCNPVKQVIHPIHDQTFYLTAEHKRKLKEEYGVEPWTFEQKLGEAVFIPAGCPHQVR  828

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPEN+ E ++LT  FR LP  HRAKEDKLE+KKM I A+   +
Sbjct  829  NLKSCVKVALDFVSPENVGEFVKLTNEFRRLPSTHRAKEDKLEIKKMAIHALTNVI  884



>ref|XP_010238029.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X2 
[Brachypodium distachyon]
Length=916

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RHIHC PV QV+HPIHDQ FYLT EHK++LKEEYG+EPWTF QKLG+AVFIPAGCPHQVR
Sbjct  767  RHIHCNPVKQVIHPIHDQTFYLTAEHKRKLKEEYGVEPWTFEQKLGEAVFIPAGCPHQVR  826

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEAL  261
            NLKSC+KVA+DFVSPEN+ E ++LT  FR LP  HRAKEDKLE+KKM I A+   +
Sbjct  827  NLKSCVKVALDFVSPENVGEFVKLTNEFRRLPSTHRAKEDKLEIKKMAIHALTNVI  882



>ref|XP_010508274.1| PREDICTED: lysine-specific demethylase JMJ25-like isoform X1 
[Camelina sativa]
Length=983

 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -3

Query  608  RHIHCYPVPQVVHPIHDQAFYLTVEHKKRLKEEYGIEPWTFIQKLGDAVFIPAGCPHQVR  429
            RH +C P+ QV HPIHDQ  YLT  H K+LKEEYGIEPWTF QKLGDAV IP GCPHQVR
Sbjct  724  RHFYCCPLSQVSHPIHDQTIYLTRYHIKKLKEEYGIEPWTFNQKLGDAVLIPVGCPHQVR  783

Query  428  NLKSCLKVAVDFVSPENIHECMRLTEGFRTLPQNHRAKEDKLEVKKMIICAVKEALKDI  252
            NLKSC KVA+DFVSPENI EC+RLT+ FR LP NH AKEDKLEVKKMII AV ++L+D+
Sbjct  784  NLKSCTKVALDFVSPENISECLRLTKQFRLLPPNHFAKEDKLEVKKMIIHAVDKSLRDL  842



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230