BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF048M09

Length=575
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACU19049.1|  unknown                                                 190   1e-57   Glycine max [soybeans]
gb|KDO53115.1|  hypothetical protein CISIN_1g0170092mg                  189   4e-57   Citrus sinensis [apfelsine]
ref|XP_004157153.1|  PREDICTED: peptide chain release factor 2-like     187   1e-55   
ref|XP_006428672.1|  hypothetical protein CICLE_v10012132mg             186   6e-54   
ref|XP_003534498.1|  PREDICTED: peptide chain release factor 2-like     189   6e-54   Glycine max [soybeans]
ref|XP_008443661.1|  PREDICTED: peptide chain release factor 1, m...    187   9e-54   
ref|XP_010038617.1|  PREDICTED: peptide chain release factor 1-li...    188   9e-54   Eucalyptus grandis [rose gum]
ref|XP_006480480.1|  PREDICTED: peptide chain release factor 1, m...    188   1e-53   Citrus sinensis [apfelsine]
ref|XP_008443660.1|  PREDICTED: peptide chain release factor 1, m...    187   1e-53   
ref|XP_004139158.1|  PREDICTED: peptide chain release factor 2-like     188   2e-53   
gb|KGN66643.1|  hypothetical protein Csa_1G652260                       188   2e-53   
emb|CAG25777.1|  putative translation releasing factor 2                188   2e-53   Cucumis sativus [cucumbers]
ref|XP_011084675.1|  PREDICTED: peptide chain release factor PrfB...    188   2e-53   Sesamum indicum [beniseed]
ref|XP_011006754.1|  PREDICTED: peptide chain release factor PrfB...    187   2e-53   Populus euphratica
ref|XP_010101235.1|  Peptide chain release factor 2                     188   2e-53   Morus notabilis
gb|KDP26898.1|  hypothetical protein JCGZ_18056                         187   3e-53   Jatropha curcas
ref|XP_008370935.1|  PREDICTED: putative peptide chain release fa...    181   4e-53   
ref|XP_010528652.1|  PREDICTED: peptide chain release factor 1, m...    187   4e-53   Tarenaya hassleriana [spider flower]
ref|XP_011006686.1|  PREDICTED: peptide chain release factor PrfB...    187   5e-53   Populus euphratica
ref|XP_002312196.2|  hypothetical protein POPTR_0008s07570g             187   5e-53   
emb|CBI17600.3|  unnamed protein product                                186   5e-53   Vitis vinifera
ref|XP_002276037.1|  PREDICTED: peptide chain release factor PrfB...    186   6e-53   Vitis vinifera
ref|XP_008443659.1|  PREDICTED: peptide chain release factor 1, m...    186   6e-53   Cucumis melo [Oriental melon]
ref|XP_010258507.1|  PREDICTED: peptide chain release factor 1-li...    186   1e-52   Nelumbo nucifera [Indian lotus]
emb|CDP04172.1|  unnamed protein product                                186   1e-52   Coffea canephora [robusta coffee]
ref|XP_009791270.1|  PREDICTED: putative peptide chain release fa...    186   1e-52   Nicotiana sylvestris
ref|XP_009598882.1|  PREDICTED: putative peptide chain release fa...    186   1e-52   Nicotiana tomentosiformis
ref|XP_009598881.1|  PREDICTED: putative peptide chain release fa...    186   1e-52   
ref|XP_004492862.1|  PREDICTED: peptide chain release factor 2-like     185   3e-52   Cicer arietinum [garbanzo]
ref|XP_003624209.1|  Peptide chain release factor                       185   3e-52   Medicago truncatula
ref|XP_007029207.1|  High chlorophyll fluorescent 109 isoform 2         184   4e-52   
ref|XP_002514811.1|  peptide chain release factor, putative             184   6e-52   Ricinus communis
ref|XP_004304824.1|  PREDICTED: peptide chain release factor PrfB...    184   8e-52   Fragaria vesca subsp. vesca
ref|XP_007205352.1|  hypothetical protein PRUPE_ppa007171mg             181   1e-51   
ref|XP_010435491.1|  PREDICTED: putative peptide chain release fa...    181   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_007139703.1|  hypothetical protein PHAVU_008G052200g             182   2e-51   Phaseolus vulgaris [French bean]
ref|XP_004237247.1|  PREDICTED: peptide chain release factor 1-li...    182   4e-51   Solanum lycopersicum
ref|XP_008218473.1|  PREDICTED: putative peptide chain release fa...    181   5e-51   Prunus mume [ume]
gb|AFW72874.1|  hypothetical protein ZEAMMB73_942412                    175   6e-51   
ref|XP_009393515.1|  PREDICTED: peptide chain release factor 1-li...    181   8e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008679207.1|  PREDICTED: peptide chain release factor 1, m...    174   1e-50   
ref|XP_010435490.1|  PREDICTED: peptide chain release factor 1-li...    181   1e-50   
ref|XP_008673688.1|  PREDICTED: peptide chain release factor 1, m...    174   1e-50   
ref|XP_010450443.1|  PREDICTED: peptide chain release factor 1-li...    181   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010435494.1|  PREDICTED: peptide chain release factor 1-li...    181   1e-50   Camelina sativa [gold-of-pleasure]
gb|KHG10328.1|  Peptide chain release factor 2                          181   1e-50   Gossypium arboreum [tree cotton]
ref|XP_006354686.1|  PREDICTED: putative peptide chain release fa...    181   1e-50   Solanum tuberosum [potatoes]
ref|XP_008656094.1|  PREDICTED: peptide chain release factor 1, m...    175   1e-50   
ref|XP_006858849.1|  hypothetical protein AMTR_s00066p00184560          180   1e-50   Amborella trichopoda
ref|XP_006354685.1|  PREDICTED: putative peptide chain release fa...    181   1e-50   Solanum tuberosum [potatoes]
ref|XP_008670401.1|  PREDICTED: peptide chain release factor 1, m...    175   1e-50   
ref|XP_004957951.1|  PREDICTED: peptide chain release factor 1, m...    180   1e-50   Setaria italica
ref|XP_009361583.1|  PREDICTED: peptide chain release factor 1, m...    180   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_008388820.1|  PREDICTED: peptide chain release factor 1, m...    180   2e-50   Malus domestica [apple tree]
ref|XP_008665395.1|  PREDICTED: peptide chain release factor 1, m...    175   3e-50   
ref|XP_008665392.1|  PREDICTED: peptide chain release factor 1, m...    175   4e-50   
ref|XP_008788225.1|  PREDICTED: peptide chain release factor 1-li...    179   6e-50   Phoenix dactylifera
ref|XP_002870470.1|  HCF109                                             178   6e-50   
ref|XP_008665391.1|  PREDICTED: peptide chain release factor 1, m...    175   6e-50   
ref|XP_008665390.1|  PREDICTED: peptide chain release factor 1, m...    175   7e-50   
ref|XP_010908923.1|  PREDICTED: peptide chain release factor PrfB...    178   9e-50   Elaeis guineensis
ref|XP_008656092.1|  PREDICTED: peptide chain release factor 1, m...    175   9e-50   
ref|XP_008656091.1|  PREDICTED: peptide chain release factor 1, m...    175   1e-49   
gb|KJB26869.1|  hypothetical protein B456_004G264100                    177   1e-49   Gossypium raimondii
ref|NP_851097.1|  protein high chlorophyll fluorescent 109              177   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851096.1|  protein high chlorophyll fluorescent 109              177   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283633.1|  hypothetical protein CARUB_v10004691mg             178   2e-49   
dbj|BAJ85383.1|  predicted protein                                      171   2e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008650160.1|  PREDICTED: peptide chain release factor 1, m...    172   3e-49   
ref|XP_007029206.1|  High chlorophyll fluorescent 109 isoform 1         176   1e-48   
ref|NP_001152654.1|  peptide chain release factor 2                     175   1e-48   Zea mays [maize]
ref|XP_010673888.1|  PREDICTED: peptide chain release factor PrfB...    174   2e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001059924.1|  Os07g0546600                                       173   6e-48   
ref|XP_006395914.1|  hypothetical protein EUTSA_v10004205mg             173   7e-48   Eutrema salsugineum [saltwater cress]
gb|EAZ04247.1|  hypothetical protein OsI_26391                          173   7e-48   Oryza sativa Indica Group [Indian rice]
gb|EEE67361.1|  hypothetical protein OsJ_24645                          173   1e-47   Oryza sativa Japonica Group [Japonica rice]
gb|KFK30645.1|  hypothetical protein AALP_AA6G008900                    172   2e-47   Arabis alpina [alpine rockcress]
ref|XP_003560113.2|  PREDICTED: peptide chain release factor 1-li...    171   2e-47   
gb|EPS67120.1|  hypothetical protein M569_07654                         170   2e-47   Genlisea aurea
ref|XP_009144652.1|  PREDICTED: putative peptide chain release fa...    171   3e-47   Brassica rapa
emb|CDY68504.1|  BnaAnng27520D                                          171   3e-47   Brassica napus [oilseed rape]
emb|CDY06442.1|  BnaC06g12020D                                          171   4e-47   
dbj|BAJ87733.1|  predicted protein                                      172   4e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT33004.1|  Peptide chain release factor 2                          170   8e-47   
ref|XP_006658669.1|  PREDICTED: peptide chain release factor 1, m...    171   1e-46   
gb|EMS47820.1|  Peptide chain release factor 2                          169   5e-46   Triticum urartu
ref|XP_001765227.1|  predicted protein                                  147   2e-38   
ref|XP_002992014.1|  hypothetical protein SELMODRAFT_134701             142   7e-37   
ref|XP_002500878.1|  predicted protein                                  142   2e-36   Micromonas commoda
ref|XP_002964513.1|  hypothetical protein SELMODRAFT_64370              141   2e-36   
gb|KIY99518.1|  Peptide chain release factor 2                          132   1e-35   Monoraphidium neglectum
ref|WP_044170898.1|  peptide chain release factor 2                     137   2e-35   
ref|WP_035999252.1|  peptide chain release factor 2                     135   6e-35   
ref|WP_041233567.1|  peptide chain release factor 2                     135   6e-35   
ref|WP_041642024.1|  peptide chain release factor 2                     135   7e-35   
ref|WP_035150658.1|  peptide chain release factor 2                     135   7e-35   
ref|XP_005647849.1|  peptide chain release factor 2                     136   8e-35   Coccomyxa subellipsoidea C-169
gb|ACC80054.1|  peptide chain release factor 2                          134   1e-34   Nostoc punctiforme PCC 73102
ref|WP_041565957.1|  peptide chain release factor 2                     134   1e-34   
ref|WP_016950467.1|  peptide chain release factor 2                     133   3e-34   
ref|XP_002993180.1|  hypothetical protein SELMODRAFT_431302             131   4e-34   
ref|XP_005852064.1|  hypothetical protein CHLNCDRAFT_133064             135   4e-34   Chlorella variabilis
ref|WP_026099974.1|  peptide chain release factor 2                     133   4e-34   
ref|WP_027402514.1|  peptide chain release factor 2                     133   5e-34   
ref|XP_002992038.1|  hypothetical protein SELMODRAFT_430253             137   5e-34   
ref|WP_010994450.1|  peptide chain release factor 2                     132   6e-34   
ref|WP_027840186.1|  peptide chain release factor 2                     132   7e-34   
ref|WP_041457741.1|  peptide chain release factor 2                     132   7e-34   
ref|WP_019494544.1|  peptide chain release factor 2                     134   8e-34   Calothrix sp. PCC 7103
ref|XP_002462979.1|  hypothetical protein SORBIDRAFT_02g035755          134   8e-34   
ref|WP_042341660.1|  peptide chain release factor 2                     132   1e-33   
ref|WP_017315492.1|  peptide chain release factor 2                     132   1e-33   
ref|WP_041555177.1|  peptide chain release factor 2                     132   1e-33   
gb|AFW93922.1|  peptide chain release factor 2                          132   1e-33   Anabaena sp. 90
ref|WP_044292100.1|  peptide chain release factor 2                     131   2e-33   
ref|WP_011319537.1|  peptide chain release factor 2                     131   2e-33   
ref|WP_044258393.1|  peptide chain release factor 2                     131   2e-33   
ref|WP_006196707.1|  peptide chain release factor 2                     131   2e-33   
ref|WP_015110363.1|  peptide chain release factor 2                     132   2e-33   Cyanobium gracile
ref|WP_044304591.1|  peptide chain release factor 2                     131   2e-33   
ref|XP_003059463.1|  predicted protein                                  130   3e-33   Micromonas pusilla CCMP1545
ref|WP_028090244.1|  peptide chain release factor 2                     130   3e-33   
ref|WP_028084219.1|  peptide chain release factor 2                     130   3e-33   
ref|WP_039750927.1|  peptide chain release factor 2                     130   3e-33   
gb|KIJ82722.1|  peptide chain release factor 2                          130   4e-33   
gb|AFZ02946.1|  bacterial peptide chain release factor 2 (bRF-2)        132   4e-33   Calothrix sp. PCC 6303
ref|WP_039738347.1|  peptide chain release factor 2                     130   4e-33   
ref|WP_041739789.1|  peptide chain release factor 2                     132   4e-33   
gb|KEF42545.1|  peptide chain release factor 2                          131   5e-33   Cyanobium sp. CACIAM 14
ref|WP_006277582.1|  peptide chain release factor 2                     130   5e-33   
gb|EFA72166.1|  Peptide chain release factor 2                          130   5e-33   Raphidiopsis brookii D9
ref|WP_040554039.1|  peptide chain release factor 2                     130   5e-33   
gb|AFY36237.1|  peptide chain release factor 2                          132   5e-33   Calothrix sp. PCC 7507
ref|WP_033378427.1|  MULTISPECIES: peptide chain release factor 2       130   5e-33   
emb|CCH64884.1|  Peptide chain release factor 2; programmed frame...    131   6e-33   Richelia intracellularis HM01
ref|WP_038315956.1|  peptide chain release factor 2                     130   6e-33   
ref|WP_035115821.1|  peptide chain release factor 2                     130   6e-33   
emb|CAK29151.1|  Protein chain release factor B                         131   6e-33   Synechococcus sp. RCC307
ref|WP_029637589.1|  peptide chain release factor 2 [                   130   7e-33   
ref|WP_035830559.1|  peptide chain release factor 2                     131   7e-33   
ref|WP_036046350.1|  peptide chain release factor 2                     129   7e-33   
ref|WP_041779882.1|  peptide chain release factor 2                     129   9e-33   
ref|WP_039990712.1|  MULTISPECIES: peptide chain release factor 2       129   9e-33   
ref|WP_043738389.1|  peptide chain release factor 2                     131   9e-33   Synechococcus sp. RCC307
emb|CCH67058.1|  Peptide chain release factor 2; programmed frame...    131   9e-33   Richelia intracellularis HH01
ref|WP_042466153.1|  peptide chain release factor 2                     129   1e-32   
gb|KIE08023.1|  peptide chain release factor 2                          129   1e-32   
ref|WP_010305233.1|  peptide chain release factor 2                     130   1e-32   
ref|WP_006911018.1|  peptide chain release factor 2                     130   1e-32   Cyanobium sp. PCC 7001
ref|WP_041268845.1|  peptide chain release factor 2                     129   1e-32   
ref|WP_044500335.1|  peptide chain release factor 2                     129   1e-32   
ref|WP_035138436.1|  peptide chain release factor 2                     129   1e-32   
ref|WP_039714401.1|  peptide chain release factor 2                     129   1e-32   
ref|WP_041463592.1|  peptide chain release factor 2                     129   1e-32   
ref|WP_006173289.1|  peptide chain release factor 2                     130   1e-32   Synechococcus sp. WH 5701
ref|WP_010313445.1|  peptide chain release factor 2                     130   1e-32   Synechococcus sp. CB0205
ref|WP_041041546.1|  peptide chain release factor 2                     129   1e-32   
ref|WP_011056377.1|  peptide chain release factor 2                     129   1e-32   Thermosynechococcus elongatus
ref|WP_011934212.1|  peptide chain release factor 2                     130   2e-32   Synechococcus sp. WH 7803
ref|WP_026732904.1|  peptide chain release factor 2                     129   2e-32   
ref|WP_007099168.1|  peptide chain release factor 2                     129   2e-32   Synechococcus sp. RS9916
ref|WP_040687545.1|  peptide chain release factor 2                     128   2e-32   
ref|WP_036923394.1|  peptide chain release factor 2                     129   3e-32   
ref|WP_007101349.1|  peptide chain release factor 2                     129   4e-32   
ref|WP_041429945.1|  peptide chain release factor 2                     127   4e-32   
gb|EHC18025.1|  Peptide chain release factor 2                          129   5e-32   Fischerella thermalis
ref|WP_041918812.1|  peptide chain release factor 2                     127   5e-32   
gb|AFZ60017.1|  Peptide chain release factor 2                          129   5e-32   Anabaena cylindrica PCC 7122
gb|AFY37549.1|  bacterial peptide chain release factor 2 (bRF-2)        129   5e-32   Leptolyngbya sp. PCC 7376
ref|WP_041763200.1|  peptide chain release factor 2                     129   5e-32   
ref|WP_019475510.1|  peptide chain release factor 2                     128   7e-32   
tpg|DAA51264.1|  TPA: hypothetical protein ZEAMMB73_478053              127   7e-32   
ref|WP_041226096.1|  peptide chain release factor 2                     127   8e-32   
ref|WP_041426759.1|  peptide chain release factor 2                     128   8e-32   
ref|WP_006854038.1|  peptide chain release factor 2                     128   8e-32   
ref|WP_041443307.1|  peptide chain release factor 2                     128   9e-32   
ref|WP_030007901.1|  peptide chain release factor 2                     128   9e-32   
ref|WP_012194754.1|  peptide chain release factor 2                     128   9e-32   
gb|ABI46074.1|  peptide chain release factor 2, programmed frames...    128   9e-32   Synechococcus sp. CC9311
gb|ELS33558.1|  bacterial peptide chain release factor 2 (bRF-2)        128   1e-31   Pseudanabaena biceps PCC 7429
ref|WP_038552613.1|  peptide chain release factor 2                     128   1e-31   Synechococcus sp. KORDI-52
ref|WP_038547201.1|  peptide chain release factor 2                     128   1e-31   
ref|WP_028953014.1|  peptide chain release factor 2                     128   1e-31   Synechococcus sp. CC9616
ref|WP_019476940.1|  peptide chain release factor 2                     127   1e-31   
ref|WP_042503956.1|  peptide chain release factor 2                     128   1e-31   
ref|WP_006042963.1|  peptide chain release factor 2                     128   1e-31   Synechococcus sp. WH 7805
sp|Q7U3W6.1|RF2_SYNPX  RecName: Full=Peptide chain release factor...    128   1e-31   Synechococcus sp. WH 8102
ref|WP_033374401.1|  peptide chain release factor 2                     127   1e-31   
ref|WP_044076357.1|  peptide chain release factor 2                     126   2e-31   
gb|ACA98201.1|  peptide chain release factor 2                          127   2e-31   Synechococcus sp. PCC 7002
ref|WP_043693362.1|  peptide chain release factor 2                     127   2e-31   Synechococcus sp. KORDI-49
ref|WP_009788764.1|  peptide chain release factor 2                     127   2e-31   Synechococcus sp. BL107
ref|WP_011360865.1|  peptide chain release factor 2                     127   2e-31   Synechococcus sp. CC9902
ref|WP_025970098.1|  hypothetical protein                               122   2e-31   
ref|WP_010474139.1|  peptide chain release factor 2                     126   2e-31   
ref|WP_012164078.1|  peptide chain release factor 2                     126   2e-31   
ref|WP_017741315.1|  peptide chain release factor 2                     125   2e-31   
ref|WP_039755868.1|  MULTISPECIES: peptide chain release factor 2       125   3e-31   
gb|AFW81292.1|  hypothetical protein ZEAMMB73_079544                    127   3e-31   
ref|WP_017293282.1|  peptide chain release factor 2                     126   3e-31   
ref|WP_009631870.1|  peptide chain release factor 2                     127   3e-31   
gb|ABB56436.1|  bacterial peptide chain release factor 2 (bRF-2)        125   4e-31   Synechococcus elongatus PCC 7942
ref|WP_041237479.1|  peptide chain release factor 2                     125   4e-31   
gb|AIE74280.1|  Peptide chain release factor 2; programmed frames...    125   4e-31   Synechocystis sp. PCC 6714
ref|WP_038027728.1|  peptide chain release factor 2                     125   5e-31   
ref|WP_010873201.1|  peptide chain release factor 2                     124   6e-31   
ref|WP_041677104.1|  peptide chain release factor 2                     124   6e-31   
ref|WP_011124360.1|  MULTISPECIES: peptide chain release factor 2       125   7e-31   Prochlorococcus
ref|WP_041430218.1|  peptide chain release factor 2                     124   8e-31   
ref|WP_038530504.1|  peptide chain release factor 2                     125   8e-31   
dbj|BAD79302.1|  peptide chain release factor RF-2                      124   8e-31   Synechococcus elongatus PCC 6301
gb|ACL47458.1|  peptide chain release factor 2                          125   9e-31   Cyanothece sp. PCC 7425
ref|WP_041699372.1|  peptide chain release factor 2                     124   1e-30   
ref|WP_026032519.1|  peptide chain release factor 2                     125   1e-30   
gb|KDR55030.1|  peptide chain release factor 2                          124   1e-30   Arthrospira platensis str. Paraca
ref|WP_014407126.1|  peptide chain release factor 2                     124   1e-30   
dbj|BAI91190.1|  peptide chain release factor 2                         124   1e-30   Arthrospira platensis NIES-39
ref|WP_036901568.1|  peptide chain release factor 2                     124   2e-30   
ref|WP_041235354.1|  peptide chain release factor 2                     124   2e-30   
ref|WP_041430920.1|  peptide chain release factor 2                     123   2e-30   
ref|WP_011823039.1|  peptide chain release factor 2                     124   2e-30   
ref|WP_006626197.1|  MULTISPECIES: peptide chain release factor 2       124   2e-30   
ref|WP_038650950.1|  peptide chain release factor 2                     124   2e-30   
sp|P74476.2|RF2_SYNY3  RecName: Full=Peptide chain release factor...    124   2e-30   Synechocystis sp. PCC 6803 substr. Kazusa
ref|WP_035737831.1|  peptide chain release factor 2                     124   2e-30   
ref|WP_036904659.1|  peptide chain release factor 2                     124   2e-30   
ref|XP_003079791.1|  putative translation releasing factor2 (ISS)       125   3e-30   Ostreococcus tauri
ref|WP_036946388.1|  peptide chain release factor 2                     123   3e-30   
ref|WP_025956439.1|  hypothetical protein                               119   3e-30   
ref|YP_002048991.1|  peptide chain release factor 2                     124   3e-30   Paulinella chromatophora
gb|ELR96896.1|  peptide chain release factor 2                          123   4e-30   Gloeocapsa sp. PCC 73106
gb|AFZ49839.1|  peptide chain release factor 2                          124   4e-30   Dactylococcopsis salina PCC 8305
ref|WP_029979375.1|  peptide chain release factor 2                     122   4e-30   
ref|WP_029960129.1|  peptide chain release factor 2                     123   5e-30   
ref|WP_029979862.1|  peptide chain release factor 2                     121   5e-30   
tpg|DAA36556.1|  TPA: hypothetical protein ZEAMMB73_481691              127   5e-30   
ref|WP_025965215.1|  peptide chain release factor 2                     122   5e-30   
gb|AFZ47489.1|  bacterial peptide chain release factor 2 (bRF-2)        123   6e-30   Cyanobacterium stanieri PCC 7202
ref|WP_041234579.1|  peptide chain release factor 2                     123   6e-30   
ref|WP_041550043.1|  peptide chain release factor 2                     122   6e-30   
ref|WP_034937480.1|  peptide chain release factor 2                     122   7e-30   
gb|AHF64859.1|  peptide chain release factor 2                          123   7e-30   Synechococcus sp. WH 8109
ref|WP_036031067.1|  peptide chain release factor 2                     123   8e-30   
ref|WP_011294181.1|  peptide chain release factor 2                     122   9e-30   
ref|WP_029976895.1|  peptide chain release factor 2                     122   1e-29   
ref|WP_025782220.1|  peptide chain release factor 2                     122   1e-29   
ref|WP_011365370.1|  peptide chain release factor 2                     122   1e-29   Synechococcus sp. CC9605
gb|KGG16757.1|  Peptide chain release factor 2                          122   1e-29   Prochlorococcus sp. MIT 0602
gb|KGG18269.1|  Peptide chain release factor 2                          122   1e-29   Prochlorococcus sp. MIT 0603
ref|WP_029948385.1|  peptide chain release factor 2                     121   1e-29   
ref|WP_029981727.1|  peptide chain release factor 2                     122   1e-29   
ref|WP_029972797.1|  peptide chain release factor 2                     122   1e-29   
ref|WP_011817673.1|  peptide chain release factor 2                     122   1e-29   
emb|CDM94570.1|  Peptide chain release factor 2                         122   1e-29   Arthrospira sp. PCC 8005
ref|WP_029976385.1|  MULTISPECIES: peptide chain release factor 2       122   1e-29   
ref|WP_029953603.1|  MULTISPECIES: peptide chain release factor 2       122   2e-29   
ref|WP_032522895.1|  peptide chain release factor 2                     122   2e-29   Prochlorococcus marinus
ref|WP_029960872.1|  MULTISPECIES: peptide chain release factor 2       122   2e-29   
ref|XP_007513294.1|  peptide chain release factor 2                     122   2e-29   Bathycoccus prasinos
ref|WP_012006987.1|  peptide chain release factor 2                     122   2e-29   
ref|WP_032526521.1|  peptide chain release factor 2                     122   2e-29   Prochlorococcus marinus
ref|WP_032523952.1|  peptide chain release factor 2                     122   2e-29   
gb|AFY96407.1|  peptide chain release factor 2                          122   2e-29   Chamaesiphon minutus PCC 6605
ref|WP_029977937.1|  peptide chain release factor 2                     122   2e-29   
ref|WP_032517289.1|  peptide chain release factor 2                     122   2e-29   
ref|WP_002806280.1|  peptide chain release factor 2                     122   2e-29   Prochlorococcus marinus
ref|WP_036916466.1|  MULTISPECIES: peptide chain release factor 2       121   2e-29   
ref|WP_029984262.1|  peptide chain release factor 2                     121   2e-29   
ref|WP_029976604.1|  MULTISPECIES: peptide chain release factor 2       121   2e-29   
ref|WP_032514638.1|  peptide chain release factor 2                     121   3e-29   Prochlorococcus marinus
ref|WP_029983947.1|  peptide chain release factor 2                     121   3e-29   
ref|WP_029978489.1|  MULTISPECIES: peptide chain release factor 2       121   3e-29   
ref|WP_029954501.1|  MULTISPECIES: peptide chain release factor 2       121   3e-29   
ref|WP_029959102.1|  peptide chain release factor 2                     121   3e-29   
ref|WP_029952344.1|  peptide chain release factor 2                     119   3e-29   
ref|WP_029984604.1|  peptide chain release factor 2                     121   4e-29   
ref|XP_002955354.1|  hypothetical protein VOLCADRAFT_106758             119   5e-29   Volvox carteri f. nagariensis
ref|WP_025929666.1|  peptide chain release factor 2                     120   5e-29   
ref|WP_039886925.1|  peptide chain release factor 2                     119   5e-29   
ref|WP_011375748.1|  peptide chain release factor 2                     120   6e-29   
ref|WP_032515818.1|  peptide chain release factor 2                     120   6e-29   
ref|XP_001418196.1|  predicted protein                                  119   6e-29   
ref|WP_032519709.1|  peptide chain release factor 2                     120   7e-29   
ref|WP_029976143.1|  peptide chain release factor 2                     120   7e-29   
ref|WP_029980478.1|  peptide chain release factor 2                     120   8e-29   
ref|WP_025937945.1|  peptide chain release factor 2                     120   8e-29   
ref|WP_042849681.1|  peptide chain release factor 2                     120   8e-29   
ref|WP_029968739.1|  peptide chain release factor 2                     120   8e-29   
ref|WP_011862225.1|  peptide chain release factor 2                     120   9e-29   
ref|WP_025893911.1|  MULTISPECIES: peptide chain release factor 2       120   9e-29   
ref|WP_025924095.1|  peptide chain release factor 2                     120   9e-29   
ref|WP_041596271.1|  peptide chain release factor 2                     119   9e-29   
ref|WP_029979009.1|  peptide chain release factor 2                     119   1e-28   
gb|AFZ44956.1|  bacterial peptide chain release factor 2 (bRF-2)        119   1e-28   
gb|EGK88668.1|  peptide chain release factor 2                          119   1e-28   
ref|XP_002182112.1|  predicted protein                                  120   2e-28   
ref|WP_012362370.1|  MULTISPECIES: peptide chain release factor 2       119   2e-28   
ref|WP_036486021.1|  peptide chain release factor 2                     118   3e-28   
ref|WP_041622529.1|  peptide chain release factor 2                     117   4e-28   
ref|WP_041922477.1|  peptide chain release factor 2                     117   7e-28   
gb|AFZ54053.1|  bacterial peptide chain release factor 2 (bRF-2)        117   7e-28   
ref|WP_041244026.1|  peptide chain release factor 2                     116   9e-28   
ref|WP_035988272.1|  peptide chain release factor 2                     115   2e-27   
gb|AGY59770.1|  peptide chain release factor 2                          116   2e-27   
ref|WP_021833602.1|  Peptide chain release factor 2; programmed f...    111   3e-27   
ref|XP_005712526.1|  Peptide chain release factor RF2, Rhodoplastic     115   3e-27   
ref|WP_008274575.1|  peptide chain release factor 2                     115   7e-27   
ref|WP_011141233.1|  peptide chain release factor 2                     114   1e-26   
ref|WP_044196941.1|  peptide chain release factor 2                     114   1e-26   
ref|WP_038016819.1|  peptide chain release factor 2                     114   1e-26   
gb|EDX84703.1|  peptide chain release factor 2                          114   1e-26   
ref|WP_022796714.1|  peptide chain release factor 2                     113   2e-26   
dbj|BAP17612.1|  peptide chain release factor 2                         113   2e-26   
ref|WP_044106341.1|  peptide chain release factor 2                     113   2e-26   
ref|WP_015954728.1|  peptide chain release factor 2                     112   4e-26   
ref|WP_036614249.1|  peptide chain release factor 2                     111   6e-26   
ref|WP_006703541.1|  peptide chain release factor 2                     111   8e-26   
ref|WP_040470236.1|  peptide chain release factor 2                     111   8e-26   
ref|WP_007308928.1|  peptide chain release factor 2                     111   1e-25   
ref|WP_007303325.1|  peptide chain release factor 2                     111   1e-25   
ref|WP_041391930.1|  peptide chain release factor 2                     111   1e-25   
ref|WP_021830842.1|  Peptide chain release factor 2; programmed f...    111   1e-25   
ref|WP_011827311.1|  peptide chain release factor 2                     110   2e-25   
emb|CBJ29181.1|  peptide chain release factor                           113   2e-25   
ref|WP_041229668.1|  MULTISPECIES: peptide chain release factor 2       110   3e-25   
ref|WP_036800638.1|  peptide chain release factor 2                     109   3e-25   
ref|XP_011395849.1|  Peptide chain release factor 2                     110   4e-25   
gb|EWM25973.1|  peptide chain release factor 2                          111   4e-25   
gb|ACV01554.1|  hypothetical protein Cyan8802_2694                      110   4e-25   
sp|B7K0A6.1|RF2_CYAP8  RecName: Full=Peptide chain release factor...    110   4e-25   
ref|WP_044206207.1|  peptide chain release factor 2                     109   5e-25   
gb|EDX76448.1|  peptide chain release factor 2                          109   5e-25   
ref|WP_041384733.1|  peptide chain release factor 2                     109   5e-25   
ref|WP_036913011.1|  MULTISPECIES: peptide chain release factor 2       109   5e-25   
ref|WP_011611725.1|  peptide chain release factor 2                     108   6e-25   
emb|CAE22237.1|  peptide-chain-release factor RF-2                      109   6e-25   
ref|WP_036020517.1|  peptide chain release factor 2                     108   7e-25   
ref|WP_031293152.1|  peptide chain release factor 2                     108   8e-25   
ref|WP_041933401.1|  peptide chain release factor 2                     108   8e-25   
gb|ESA35409.1|  peptide chain release factor 2                          108   9e-25   
ref|WP_005604928.1|  peptide chain release factor 2                     108   1e-24   
gb|ADN17436.1|  hypothetical protein Cyan7822_5564                      108   1e-24   
ref|WP_007357534.1|  MULTISPECIES: peptide chain release factor 2       108   1e-24   
ref|WP_006917003.1|  peptide chain release factor 2                     108   1e-24   
ref|WP_035717721.1|  peptide chain release factor 2                     107   2e-24   
ref|XP_003059056.1|  predicted protein                                  107   2e-24   
gb|EAW37658.1|  Peptide chain release factor 2                          107   3e-24   
ref|WP_039895756.1|  peptide chain release factor 2                     107   3e-24   
ref|WP_034881596.1|  peptide chain release factor 2                     107   3e-24   
ref|WP_041823611.1|  peptide chain release factor 2                     106   4e-24   
ref|WP_019051291.1|  hypothetical protein                               107   4e-24   
gb|EOR29605.1|  peptide chain release factor 2                          107   4e-24   
ref|WP_007121886.1|  peptide chain release factor 2                     107   4e-24   
ref|WP_035029995.1|  peptide chain release factor 2                     106   5e-24   
gb|ADQ17854.1|  bacterial peptide chain release factor 2 (bRF-2)        106   6e-24   
ref|WP_044492919.1|  peptide chain release factor 2                     105   7e-24   
gb|EGJ33000.1|  bacterial peptide chain release factor 2                105   7e-24   
ref|WP_041619478.1|  peptide chain release factor 2                     106   7e-24   
ref|WP_042720912.1|  peptide chain release factor 2                     106   1e-23   
ref|WP_002778359.1|  peptide chain release factor 2                     105   1e-23   
ref|WP_024970009.1|  peptide chain release factor 2                     105   1e-23   
gb|ERT04595.1|  peptide chain release factor 2                          105   1e-23   
ref|WP_008288893.1|  peptide chain release factor RF-2                  105   1e-23   
ref|WP_002789880.1|  peptide chain release factor 2                     105   1e-23   
ref|WP_029294300.1|  peptide chain release factor 2                     105   1e-23   
ref|WP_002687112.1|  peptide chain release factor 2                     105   1e-23   
ref|WP_002662604.1|  peptide chain release factor 2                     105   1e-23   
ref|WP_002739073.1|  peptide chain release factor 2                     105   1e-23   
ref|WP_002756106.1|  peptide chain release factor 2                     105   1e-23   
emb|CCI01036.1|  Peptide chain release factor 2                         105   1e-23   
dbj|GAL94922.1|  peptide chain release factor 2; programmed frame...    105   1e-23   
ref|WP_014465561.1|  peptide chain release factor 2                     105   1e-23   
ref|XP_003252002.2|  PREDICTED: peptide chain release factor 1-li...    104   1e-23   
ref|WP_040484606.1|  peptide chain release factor 2                     105   1e-23   
ref|WP_043996449.1|  peptide chain release factor 2                     105   1e-23   
ref|WP_022403398.1|  peptide chain release factor 2                     105   1e-23   
ref|WP_002747774.1|  peptide chain release factor 2                     105   1e-23   
ref|WP_008341129.1|  peptide chain release factor 2                     105   1e-23   
ref|WP_041707593.1|  peptide chain release factor 2                     105   1e-23   
ref|XP_010246248.1|  PREDICTED: peptide chain release factor 1-li...    105   1e-23   
gb|ACV59557.1|  conserved hypothetical protein                          105   2e-23   
ref|WP_025283407.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_003626019.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_038693292.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_041991105.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_041808787.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_025005158.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_003633432.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_044011191.1|  peptide chain release factor 2                     105   2e-23   
emb|CDI64336.1|  Peptide chain release factor RF2                       105   2e-23   
emb|CDI61610.1|  Peptide chain release factor RF2                       105   2e-23   
ref|WP_009388896.1|  peptide chain release factor 2                     105   2e-23   
gb|KIO97242.1|  Peptide chain release factor 2                          105   2e-23   
gb|AFR22436.1|  peptide chain release factor 2                          105   2e-23   
gb|AFR36771.1|  Protein chain release factor B                          105   2e-23   
ref|WP_007125239.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_025016628.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_042521607.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_003130963.1|  peptide chain release factor 2                     105   2e-23   
gb|EKB08709.1|  peptide chain release factor 2 [Myroides                104   2e-23   
ref|XP_010246247.1|  PREDICTED: peptide chain release factor 1-li...    105   2e-23   
ref|WP_007546056.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_036462595.1|  MULTISPECIES: peptide chain release factor 2       104   2e-23   
ref|XP_005535649.1|  chloroplast peptide chain release factor RF-2      106   2e-23   
ref|WP_037249374.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_002758735.1|  peptide chain release factor 2                     104   2e-23   
ref|WP_028291663.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_004163719.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_043022159.1|  peptide chain release factor 2                     105   2e-23   
emb|CEN33745.1|  Peptide chain release factor 2                         105   2e-23   
gb|ADQ83018.1|  bacterial peptide chain release factor 2 (bRF-2)        105   2e-23   
ref|WP_014158987.1|  peptide chain release factor 2                     105   2e-23   
ref|WP_018676723.1|  hypothetical protein                               105   2e-23   
gb|EHN59095.1|  Peptide chain release factor 2                          104   3e-23   
ref|WP_039105004.1|  peptide chain release factor 2                     104   3e-23   
ref|WP_024525623.1|  peptide chain release factor 2                     104   3e-23   
ref|WP_011667406.1|  peptide chain release factor 2                     104   3e-23   
ref|WP_003546555.1|  peptide chain release factor 2                     104   3e-23   
ref|WP_015473425.1|  Peptide chain release factor 2                     104   3e-23   
gb|ERK41208.1|  peptide chain release factor 2                          104   3e-23   
gb|KID44422.1|  Peptide chain release factor 2                          104   3e-23   
ref|WP_038521898.1|  peptide chain release factor 2                     104   3e-23   
ref|WP_040478755.1|  peptide chain release factor 2                     104   3e-23   
dbj|BAQ57546.1|  peptide chain release factor 2                         104   3e-23   
gb|EHQ41420.1|  bacterial peptide chain release factor 2 (bRF-2)        104   3e-23   
ref|WP_039366286.1|  peptide chain release factor 2                     104   3e-23   
ref|WP_039729031.1|  MULTISPECIES: peptide chain release factor 2       104   3e-23   
ref|WP_035801283.1|  peptide chain release factor 2                     104   3e-23   
gb|AJP46106.1|  peptide chain release factor 2                          104   3e-23   
ref|WP_043945536.1|  peptide chain release factor 2                     104   3e-23   
ref|WP_025773752.1|  peptide chain release factor 2                     104   4e-23   
ref|WP_034538798.1|  peptide chain release factor 2                     104   4e-23   
ref|WP_008199910.1|  peptide chain release factor 2                     104   4e-23   
ref|WP_011391774.1|  peptide chain release factor 2                     104   4e-23   
ref|WP_036843087.1|  peptide chain release factor 2                     103   4e-23   
gb|ELS01952.1|  peptide chain release factor 2                          103   4e-23   
ref|WP_042157910.1|  peptide chain release factor 2                     103   4e-23   
ref|WP_036833952.1|  MULTISPECIES: peptide chain release factor 2       103   4e-23   
ref|WP_040448000.1|  peptide chain release factor 2                     104   4e-23   
ref|WP_003554600.1|  peptide chain release factor 2                     104   4e-23   
gb|ERE52934.1|  hypothetical protein N036_55165                       99.0    4e-23   
ref|WP_032949978.1|  peptide chain release factor 2                     104   4e-23   
ref|WP_035179424.1|  peptide chain release factor 2                     104   4e-23   
gb|EMS35153.1|  Peptide chain release factor 2                          103   4e-23   
gb|AGY81003.1|  hypothetical protein Q783_01340                         104   4e-23   
ref|WP_021165190.1|  peptide chain release factor 2                     104   4e-23   
gb|EHR37907.1|  peptide chain release factor 2                          104   4e-23   
ref|WP_003560978.1|  MULTISPECIES: peptide chain release factor 2       104   4e-23   
ref|WP_011675981.1|  peptide chain release factor 2                     104   4e-23   
ref|WP_029276756.1|  MULTISPECIES: peptide chain release factor 2       103   4e-23   
ref|WP_011835386.1|  peptide chain release factor 2                     104   4e-23   
ref|WP_043734800.1|  peptide chain release factor 2                     104   5e-23   
gb|KEI68881.1|  PrfB                                                    103   5e-23   
ref|WP_041556769.1|  peptide chain release factor 2                     103   5e-23   
ref|WP_026193804.1|  peptide chain release factor 2                     103   5e-23   
ref|WP_040898480.1|  peptide chain release factor 2                     103   5e-23   
ref|WP_026786272.1|  peptide chain release factor 2                     103   5e-23   
gb|AEB29083.1|  peptide chain release factor 2                          103   5e-23   
ref|WP_035024055.1|  peptide chain release factor 2                     103   5e-23   
ref|WP_012460023.1|  peptide chain release factor 2                     103   6e-23   
ref|WP_034977460.1|  peptide chain release factor 2                     103   6e-23   
gb|EDP68848.1|  peptide chain release factor 2, programmed frames...    103   6e-23   
ref|WP_013437478.1|  MULTISPECIES: peptide chain release factor 2       103   6e-23   
ref|WP_025014489.1|  peptide chain release factor 2                     103   6e-23   
ref|WP_034685501.1|  peptide chain release factor 2                     103   6e-23   
ref|WP_007842649.1|  MULTISPECIES: peptide chain release factor 2       103   6e-23   
ref|WP_041808394.1|  peptide chain release factor 2                     103   6e-23   
ref|WP_037369979.1|  peptide chain release factor 2                     103   6e-23   
ref|WP_006192335.1|  peptide chain release factor 2                     103   6e-23   
emb|CEN40284.1|  Peptide chain release factor 2                         103   6e-23   
ref|WP_036930359.1|  peptide chain release factor 2                     103   7e-23   
gb|ADU31828.1|  hypothetical protein Bcell_3587                         103   7e-23   
emb|CAE18639.1|  peptide chain release factor RF-2                      103   7e-23   
ref|WP_035134849.1|  peptide chain release factor 2                     103   7e-23   
ref|WP_014856633.1|  peptide chain release factor 2                     103   7e-23   
ref|WP_029233504.1|  peptide chain release factor 2                     103   7e-23   
gb|AEC00136.1|  Peptide chain release factor 2                          103   8e-23   
ref|WP_041095409.1|  peptide chain release factor 2                     103   8e-23   
ref|WP_015806359.1|  peptide chain release factor 2                     103   8e-23   
ref|WP_026493586.1|  MULTISPECIES: peptide chain release factor 2       103   8e-23   
dbj|BAG26670.1|  peptide chain release factor 2                         103   9e-23   
ref|WP_027376441.1|  peptide chain release factor 2                     103   9e-23   
ref|WP_040359951.1|  peptide chain release factor 2                     103   9e-23   
ref|WP_035147004.1|  peptide chain release factor 2                     103   9e-23   
gb|EJU28372.1|  peptide chain release factor 2                          103   9e-23   
ref|WP_034566960.1|  peptide chain release factor 2                     102   9e-23   
ref|WP_041807942.1|  peptide chain release factor 2                     103   1e-22   
ref|WP_040356984.1|  peptide chain release factor 2                     102   1e-22   
ref|WP_034541343.1|  peptide chain release factor 2                     103   1e-22   
ref|WP_042481529.1|  peptide chain release factor 2                     102   1e-22   
ref|WP_026488761.1|  peptide chain release factor 2                     103   1e-22   
gb|EHM00635.1|  peptide chain release factor 2                          103   1e-22   
ref|WP_040537521.1|  peptide chain release factor 2                     103   1e-22   
ref|WP_027386178.1|  peptide chain release factor 2                     103   1e-22   
ref|WP_027378258.1|  peptide chain release factor 2                     103   1e-22   
ref|WP_026516639.1|  peptide chain release factor 2                     103   1e-22   
ref|WP_002408900.1|  peptide chain release factor 2                     102   1e-22   
ref|WP_013281707.1|  peptide chain release factor 2                     103   1e-22   
ref|WP_038333054.1|  peptide chain release factor 2                     102   1e-22   
gb|ESS01908.1|  peptide chain release factor 2                          102   1e-22   



>gb|ACU19049.1| unknown [Glycine max]
Length=155

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKI+ALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  55   EERSQLANKIRALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  114

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRTG+ET+DITSVMDGELDPFI+S+LK+KY+MS+S+ G
Sbjct  115  DVRTGHETTDITSVMDGELDPFIKSYLKHKYNMSLSTSG  153



>gb|KDO53115.1| hypothetical protein CISIN_1g0170092mg, partial [Citrus sinensis]
 gb|KDO53116.1| hypothetical protein CISIN_1g0170092mg, partial [Citrus sinensis]
Length=163

 Score =   189 bits (479),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  63   EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  122

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG+ETSDI SVMDGEL+PFI+S+LKYKYSMS+S+
Sbjct  123  DVRTGHETSDIVSVMDGELEPFIKSYLKYKYSMSLSA  159



>ref|XP_004157153.1| PREDICTED: peptide chain release factor 2-like, partial [Cucumis 
sativus]
Length=237

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  139  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  198

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSG  280
            DVRTGYETSDI SVMDGEL+PFI+++LKYKYS+++S+G
Sbjct  199  DVRTGYETSDIVSVMDGELEPFIKAYLKYKYSIALSTG  236



>ref|XP_006428672.1| hypothetical protein CICLE_v10012132mg [Citrus clementina]
 gb|ESR41912.1| hypothetical protein CICLE_v10012132mg [Citrus clementina]
Length=341

 Score =   186 bits (473),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALS+LKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  241  EERSQLANKIKALSQLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  300

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG+ETSDI SVMDGEL+PFI+S+LKYKYSMS+S+
Sbjct  301  DVRTGHETSDIVSVMDGELEPFIKSYLKYKYSMSLSA  337



>ref|XP_003534498.1| PREDICTED: peptide chain release factor 2-like [Glycine max]
 gb|KHN29252.1| Peptide chain release factor 2 [Glycine soja]
Length=456

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKI+ALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  356  EERSQLANKIRALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  415

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRTG+ET+DITSVMDGELDPFI+S+LK+KY+MS+S+ G
Sbjct  416  DVRTGHETTDITSVMDGELDPFIKSYLKHKYNMSLSTSG  454



>ref|XP_008443661.1| PREDICTED: peptide chain release factor 1, mitochondrial isoform 
X3 [Cucumis melo]
Length=377

 Score =   187 bits (474),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  279  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  338

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSG  280
            DVRTGYETSDI SVMDGEL+PFI+++LKYKY M++ +G
Sbjct  339  DVRTGYETSDIVSVMDGELEPFIKAYLKYKYCMALPTG  376



>ref|XP_010038617.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Eucalyptus grandis]
 gb|KCW84636.1| hypothetical protein EUGRSUZ_B01462 [Eucalyptus grandis]
Length=451

 Score =   188 bits (478),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  350  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDVVKAEWGQQIRNYVFHPYKLVK  409

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTGYETSDI+SVMDGELDPFI+++LKYKYSMS S+
Sbjct  410  DVRTGYETSDISSVMDGELDPFIKTYLKYKYSMSQSA  446



>ref|XP_006480480.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Citrus sinensis]
Length=460

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  360  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  419

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG+ETSDI SVMDGEL+PFI+S+LKYKYSMS+S+
Sbjct  420  DVRTGHETSDIVSVMDGELEPFIKSYLKYKYSMSLSA  456



>ref|XP_008443660.1| PREDICTED: peptide chain release factor 1, mitochondrial isoform 
X2 [Cucumis melo]
Length=402

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  304  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  363

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSG  280
            DVRTGYETSDI SVMDGEL+PFI+++LKYKY M++ +G
Sbjct  364  DVRTGYETSDIVSVMDGELEPFIKAYLKYKYCMALPTG  401



>ref|XP_004139158.1| PREDICTED: peptide chain release factor 2-like [Cucumis sativus]
Length=450

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  352  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  411

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSG  280
            DVRTGYETSDI SVMDGEL+PFI+++LKYKYS+++S+G
Sbjct  412  DVRTGYETSDIVSVMDGELEPFIKAYLKYKYSIALSTG  449



>gb|KGN66643.1| hypothetical protein Csa_1G652260 [Cucumis sativus]
Length=453

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  355  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  414

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSG  280
            DVRTGYETSDI SVMDGEL+PFI+++LKYKYS+++S+G
Sbjct  415  DVRTGYETSDIVSVMDGELEPFIKAYLKYKYSIALSTG  452



>emb|CAG25777.1| putative translation releasing factor 2 [Cucumis sativus]
Length=453

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  355  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  414

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSG  280
            DVRTGYETSDI SVMDGEL+PFI+++LKYKYS+++S+G
Sbjct  415  DVRTGYETSDIVSVMDGELEPFIKAYLKYKYSIALSTG  452



>ref|XP_011084675.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
[Sesamum indicum]
Length=473

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKA+SRLKAKLLVIAEEQRASEIKQI+GDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  372  EERSQLANKIKAMSRLKAKLLVIAEEQRASEIKQIKGDAVKAEWGQQIRNYVFHPYKLVK  431

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGGE  274
            DVRTG+ETSDI SVMDGELDPFI+++LKYKYS SMS+ GE
Sbjct  432  DVRTGHETSDIASVMDGELDPFIKAYLKYKYSTSMSNIGE  471



>ref|XP_011006754.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
isoform X2 [Populus euphratica]
Length=436

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL+NKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  336  EERSQLSNKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  395

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG+ETSDI SVMDGELDPFIR++LK+KYSM++S+
Sbjct  396  DVRTGHETSDIASVMDGELDPFIRAYLKHKYSMTLSA  432



>ref|XP_010101235.1| Peptide chain release factor 2 [Morus notabilis]
 gb|EXB88159.1| Peptide chain release factor 2 [Morus notabilis]
Length=464

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  361  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  420

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRTG ETSDI SVMDGEL+PFI++FLKYKYSM++S+ G
Sbjct  421  DVRTGLETSDIVSVMDGELEPFIKAFLKYKYSMAVSTSG  459



>gb|KDP26898.1| hypothetical protein JCGZ_18056 [Jatropha curcas]
Length=460

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  360  EERSQLANKIKALSRLKAKLLVIAVEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  419

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRTG+ETSDI SVMDGEL+PFI+++LKYKYSM+MS+ G
Sbjct  420  DVRTGFETSDINSVMDGELEPFIKAYLKYKYSMAMSASG  458



>ref|XP_008370935.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
[Malus domestica]
Length=227

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKAL+RLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  132  EERSQLANKIKALARLKAKLLVIAEEQRASEIKQIRGDVVKAEWGQQIRNYVFHPYKLVK  191

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            DVRTG+ETSDITSVMDG+L+P+I+++LKYKYSM +S
Sbjct  192  DVRTGHETSDITSVMDGDLEPYIKAYLKYKYSMKVS  227



>ref|XP_010528652.1| PREDICTED: peptide chain release factor 1, mitochondrial [Tarenaya 
hassleriana]
Length=463

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EERTQLANK +A+SRLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  361  EERTQLANKTRAMSRLKAKLLVIAEEQRASEIKQIRGDVVKAEWGQQIRNYVFHPYKLVK  420

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTGYETSDITSVMDGELDPFI+++LK+KY++SMSS
Sbjct  421  DVRTGYETSDITSVMDGELDPFIKTYLKHKYTLSMSS  457



>ref|XP_011006686.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
isoform X1 [Populus euphratica]
Length=464

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL+NKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  364  EERSQLSNKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  423

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG+ETSDI SVMDGELDPFIR++LK+KYSM++S+
Sbjct  424  DVRTGHETSDIASVMDGELDPFIRAYLKHKYSMTLSA  460



>ref|XP_002312196.2| hypothetical protein POPTR_0008s07570g [Populus trichocarpa]
 gb|EEE89563.2| hypothetical protein POPTR_0008s07570g [Populus trichocarpa]
Length=466

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL+NKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  366  EERSQLSNKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  425

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG+ETSDI SVMDGELDPFIR++LK+KYSM++S+
Sbjct  426  DVRTGHETSDIASVMDGELDPFIRAYLKHKYSMTLSA  462



>emb|CBI17600.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  353  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  412

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            DVRTGYETSDITSVMDGEL+PFI+++LK+K+SM++S
Sbjct  413  DVRTGYETSDITSVMDGELEPFIKAYLKFKFSMTLS  448



>ref|XP_002276037.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
[Vitis vinifera]
Length=454

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  356  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  415

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            DVRTGYETSDITSVMDGEL+PFI+++LK+K+SM++S
Sbjct  416  DVRTGYETSDITSVMDGELEPFIKAYLKFKFSMTLS  451



>ref|XP_008443659.1| PREDICTED: peptide chain release factor 1, mitochondrial isoform 
X1 [Cucumis melo]
Length=453

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  355  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  414

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSG  280
            DVRTGYETSDI SVMDGEL+PFI+++LKYKY M++ +G
Sbjct  415  DVRTGYETSDIVSVMDGELEPFIKAYLKYKYCMALPTG  452



>ref|XP_010258507.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Nelumbo nucifera]
Length=449

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  350  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  409

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSG  280
            DVRTG+ETSDI SVMDGEL+PFI+++LKYKYS +M+ G
Sbjct  410  DVRTGFETSDIASVMDGELEPFIKAYLKYKYSRTMTGG  447



>emb|CDP04172.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EERTQLANKIKAL RLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  384  EERTQLANKIKALGRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  443

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGGE  274
            DVRTGYETSDITSVMDGELD FI+S+LKYKYS S+S+  E
Sbjct  444  DVRTGYETSDITSVMDGELDLFIKSYLKYKYSTSVSNNQE  483



>ref|XP_009791270.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
[Nicotiana sylvestris]
Length=467

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  367  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  426

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTGYETSDITSVMDG+LDPFI+S+LK+KYS++ ++
Sbjct  427  DVRTGYETSDITSVMDGDLDPFIKSYLKHKYSLAANT  463



>ref|XP_009598882.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
isoform X2 [Nicotiana tomentosiformis]
Length=464

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  364  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  423

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTGYETSDITSVMDG+LDPFI+S+LK+KYS++ ++
Sbjct  424  DVRTGYETSDITSVMDGDLDPFIKSYLKHKYSLAANT  460



>ref|XP_009598881.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
isoform X1 [Nicotiana tomentosiformis]
Length=470

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  370  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  429

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTGYETSDITSVMDG+LDPFI+S+LK+KYS++ ++
Sbjct  430  DVRTGYETSDITSVMDGDLDPFIKSYLKHKYSLAANT  466



>ref|XP_004492862.1| PREDICTED: peptide chain release factor 2-like [Cicer arietinum]
Length=461

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            E+R+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  361  EQRSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDTVKAEWGQQIRNYVFHPYKLVK  420

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRTG++T DI SVMDGELDPFI+S+LK+KYSM+MS+ G
Sbjct  421  DVRTGHDTPDIASVMDGELDPFIKSYLKHKYSMTMSTSG  459



>ref|XP_003624209.1| Peptide chain release factor [Medicago truncatula]
 gb|AES80427.1| peptide chain release factor 2 [Medicago truncatula]
Length=475

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRA+E KQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  375  EERSQLANKIKALSRLKAKLLVIAEEQRATEFKQIRGDVVKAEWGQQIRNYVFHPYKLVK  434

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRTG+ET DITSV+DGELDPFI+S+LK+KYSM+MS+ G
Sbjct  435  DVRTGHETPDITSVIDGELDPFIKSYLKHKYSMTMSTSG  473



>ref|XP_007029207.1| High chlorophyll fluorescent 109 isoform 2 [Theobroma cacao]
 gb|EOY09709.1| High chlorophyll fluorescent 109 isoform 2 [Theobroma cacao]
Length=465

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  363  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  422

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG+ETSDI SVMDGELD FI+++LK+KYSMS+S+
Sbjct  423  DVRTGFETSDIASVMDGELDAFIKAYLKHKYSMSVSA  459



>ref|XP_002514811.1| peptide chain release factor, putative [Ricinus communis]
 gb|EEF47365.1| peptide chain release factor, putative [Ricinus communis]
Length=458

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  361  EERSQLANKIKALSRLKAKLLVIAVEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  420

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTGYETSD+TSVMDGEL+ FI+++LKYKYSM++SS
Sbjct  421  DVRTGYETSDVTSVMDGELEAFIKAYLKYKYSMTLSS  457



>ref|XP_004304824.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=456

 Score =   184 bits (466),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLAN+IKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  356  EERSQLANRIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  415

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGGE  274
            DVRTGYETSDITSVMDG+L+P+I+++LK+KYSM +S+  +
Sbjct  416  DVRTGYETSDITSVMDGDLEPYIKAYLKHKYSMKISASSQ  455



>ref|XP_007205352.1| hypothetical protein PRUPE_ppa007171mg [Prunus persica]
 gb|EMJ06551.1| hypothetical protein PRUPE_ppa007171mg [Prunus persica]
Length=379

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  279  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDVVKAEWGQQIRNYVFHPYKLVK  338

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRTGYETSDIT VMDG+L+P+I+++LK+KYSM +++ G
Sbjct  339  DVRTGYETSDITCVMDGDLEPYIKAYLKHKYSMKVTAAG  377



>ref|XP_010435491.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
isoform X2 [Camelina sativa]
Length=379

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANK +ALSRLKAKLLVIAEEQRA+EIK+IRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  279  EERSQLANKTRALSRLKAKLLVIAEEQRATEIKEIRGDAVKAEWGQQIRNYVFHPYKLVK  338

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG+ETSDITSVMDG+LDPFI+++LK+KY+++M+S
Sbjct  339  DVRTGHETSDITSVMDGDLDPFIKAYLKHKYTLAMAS  375



>ref|XP_007139703.1| hypothetical protein PHAVU_008G052200g [Phaseolus vulgaris]
 gb|ESW11697.1| hypothetical protein PHAVU_008G052200g [Phaseolus vulgaris]
Length=456

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKI+ALSRLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  356  EERSQLANKIRALSRLKAKLLVIAEEQRASEIKQIRGDVVKAEWGQQIRNYVFHPYKLVK  415

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTGYET+D+ SVMDGELDPF++S+LK+K++MS+S+
Sbjct  416  DVRTGYETTDVISVMDGELDPFVKSYLKFKFNMSLST  452



>ref|XP_004237247.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Solanum lycopersicum]
Length=469

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  369  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDTVKAEWGQQIRNYVFHPYKLVK  428

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRT YET DITSVMDGELDPFI+++LK+KYS++ +  G
Sbjct  429  DVRTAYETCDITSVMDGELDPFIKAYLKHKYSLAANPSG  467



>ref|XP_008218473.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
[Prunus mume]
Length=456

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  356  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDVVKAEWGQQIRNYVFHPYKLVK  415

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRTGYETSDIT VMDG+L+P+I+++LK+KYSM +++ G
Sbjct  416  DVRTGYETSDITCVMDGDLEPYIKAYLKHKYSMKVTAAG  454



>gb|AFW72874.1| hypothetical protein ZEAMMB73_942412 [Zea mays]
Length=227

 Score =   175 bits (444),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  131  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  190

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR++LKYK + + +S
Sbjct  191  DVRTGCETSDITGVMDGELDPFIRAYLKYKLTAAATS  227



>ref|XP_009393515.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=467

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  367  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  426

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            DVRTGYETSDI+SVMDG+L+ FI+++LKYKY+ S+S
Sbjct  427  DVRTGYETSDISSVMDGDLESFIKAYLKYKYTTSVS  462



>ref|XP_008679207.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Zea mays]
Length=233

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  137  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  196

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR++LKYK + + +S
Sbjct  197  DVRTGCETSDITGVMDGELDPFIRAYLKYKLTAAATS  233



>ref|XP_010435490.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
isoform X1 [Camelina sativa]
 ref|XP_010435493.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
isoform X3 [Camelina sativa]
Length=459

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANK +ALSRLKAKLLVIAEEQRA+EIK+IRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  359  EERSQLANKTRALSRLKAKLLVIAEEQRATEIKEIRGDAVKAEWGQQIRNYVFHPYKLVK  418

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSG  280
            DVRTG+ETSDITSVMDG+LDPFI+++LK+KY+++M+S 
Sbjct  419  DVRTGHETSDITSVMDGDLDPFIKAYLKHKYTLAMASA  456



>ref|XP_008673688.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Zea mays]
Length=233

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  137  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  196

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR++LKYK + + +S
Sbjct  197  DVRTGCETSDITGVMDGELDPFIRAYLKYKLTAAATS  233



>ref|XP_010450443.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Camelina sativa]
Length=459

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANK +ALSRLKAKLLVIAEEQRA+EIK+IRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  359  EERSQLANKTRALSRLKAKLLVIAEEQRATEIKEIRGDAVKAEWGQQIRNYVFHPYKLVK  418

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG+ETSDITSVMDG+LDPFI+++LK+KY+++M+S
Sbjct  419  DVRTGHETSDITSVMDGDLDPFIKAYLKHKYTLAMAS  455



>ref|XP_010435494.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
isoform X4 [Camelina sativa]
Length=458

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANK +ALSRLKAKLLVIAEEQRA+EIK+IRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  358  EERSQLANKTRALSRLKAKLLVIAEEQRATEIKEIRGDAVKAEWGQQIRNYVFHPYKLVK  417

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSG  280
            DVRTG+ETSDITSVMDG+LDPFI+++LK+KY+++M+S 
Sbjct  418  DVRTGHETSDITSVMDGDLDPFIKAYLKHKYTLAMASA  455



>gb|KHG10328.1| Peptide chain release factor 2 [Gossypium arboreum]
Length=467

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  360  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  419

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            DVRTG+ETSDI SVMDGELD FI+++LKYK+S+++S
Sbjct  420  DVRTGFETSDIVSVMDGELDAFIKAYLKYKHSINVS  455



>ref|XP_006354686.1| PREDICTED: putative peptide chain release factor 1, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=469

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  369  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDTVKAEWGQQIRNYVFHPYKLVK  428

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRT  ETSDITSVMDGELDPFI+++LK+KYS++ +  G
Sbjct  429  DVRTACETSDITSVMDGELDPFIKAYLKHKYSLAANPSG  467



>ref|XP_008656094.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X3 [Zea mays]
Length=260

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  164  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  223

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR++LKYK + + +S
Sbjct  224  DVRTGCETSDITGVMDGELDPFIRAYLKYKLTAAATS  260



>ref|XP_006858849.1| hypothetical protein AMTR_s00066p00184560 [Amborella trichopoda]
 gb|ERN20316.1| hypothetical protein AMTR_s00066p00184560 [Amborella trichopoda]
Length=458

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/92 (92%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  361  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  420

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYS  298
            DVRTG ETSDI+S+MDGELDPFI+++LK+KYS
Sbjct  421  DVRTGNETSDISSIMDGELDPFIKAYLKFKYS  452



>ref|XP_006354685.1| PREDICTED: putative peptide chain release factor 1, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=472

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  372  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDTVKAEWGQQIRNYVFHPYKLVK  431

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRT  ETSDITSVMDGELDPFI+++LK+KYS++ +  G
Sbjct  432  DVRTACETSDITSVMDGELDPFIKAYLKHKYSLAANPSG  470



>ref|XP_008670401.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X5 [Zea mays]
 ref|XP_008646096.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X5 [Zea mays]
 ref|XP_008656095.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X4 [Zea mays]
Length=251

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  155  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  214

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR++LKYK + + +S
Sbjct  215  DVRTGCETSDITGVMDGELDPFIRAYLKYKLTAAATS  251



>ref|XP_004957951.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Setaria italica]
Length=448

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  352  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDMVKAEWGQQIRNYVFHPYKLVK  411

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR++LKYK + + SS
Sbjct  412  DVRTGCETSDITGVMDGELDPFIRAYLKYKLTAAASS  448



>ref|XP_009361583.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009340366.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009340373.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Pyrus x bretschneideri]
Length=455

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKAL+RLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  360  EERSQLANKIKALARLKAKLLVIAEEQRASEIKQIRGDVVKAEWGQQIRNYVFHPYKLVK  419

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            DVRTG+ETSDITSVMDG+L+P+I+++LKYKYSM +S
Sbjct  420  DVRTGHETSDITSVMDGDLEPYIKAYLKYKYSMKVS  455



>ref|XP_008388820.1| PREDICTED: peptide chain release factor 1, mitochondrial [Malus 
domestica]
Length=456

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKAL+RLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  356  EERSQLANKIKALARLKAKLLVIAEEQRASEIKQIRGDVVKAEWGQQIRNYVFHPYKLVK  415

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG+ETSDITSVMDG+L+P+I+++LKYKYSM +++
Sbjct  416  DVRTGHETSDITSVMDGDLEPYIKAYLKYKYSMKVTA  452



>ref|XP_008665395.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X4 [Zea mays]
 ref|XP_008670400.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X4 [Zea mays]
 ref|XP_008646095.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X4 [Zea mays]
Length=291

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  195  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  254

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR++LKYK + + +S
Sbjct  255  DVRTGCETSDITGVMDGELDPFIRAYLKYKLTAAATS  291



>ref|XP_008665392.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X3 [Zea mays]
 ref|XP_008665394.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X3 [Zea mays]
 ref|XP_008670396.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X3 [Zea mays]
 ref|XP_008670397.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X3 [Zea mays]
 ref|XP_008670398.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X3 [Zea mays]
 ref|XP_008670399.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X3 [Zea mays]
 ref|XP_008646091.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X3 [Zea mays]
 ref|XP_008646092.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X3 [Zea mays]
 ref|XP_008646093.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X3 [Zea mays]
 ref|XP_008646094.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X3 [Zea mays]
Length=296

 Score =   175 bits (444),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  200  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  259

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR++LKYK + + +S
Sbjct  260  DVRTGCETSDITGVMDGELDPFIRAYLKYKLTAAATS  296



>ref|XP_008788225.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Phoenix dactylifera]
Length=470

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  370  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  429

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            DVRTG ETSDITSVMDG L+ FI+++L+YKY+ SMS
Sbjct  430  DVRTGCETSDITSVMDGGLEAFIKAYLRYKYTTSMS  465



>ref|XP_002870470.1| HCF109 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46729.1| HCF109 [Arabidopsis lyrata subsp. lyrata]
Length=453

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANK +AL RLKAKLLVIAEEQRA+EIK+IRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  353  EERSQLANKTRALIRLKAKLLVIAEEQRATEIKEIRGDAVKAEWGQQIRNYVFHPYKLVK  412

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG+ETSDITSVMDG+LDPFI+++LK+KY+++M+S
Sbjct  413  DVRTGHETSDITSVMDGDLDPFIKAYLKHKYTLAMAS  449



>ref|XP_008665391.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X2 [Zea mays]
 ref|XP_008670395.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X2 [Zea mays]
 ref|XP_008646090.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X2 [Zea mays]
Length=322

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  226  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  285

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR++LKYK + + +S
Sbjct  286  DVRTGCETSDITGVMDGELDPFIRAYLKYKLTAAATS  322



>ref|XP_008665390.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
 ref|XP_008670394.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
 ref|XP_008646077.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
 ref|XP_008646079.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
 ref|XP_008646080.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
 ref|XP_008646081.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
 ref|XP_008646082.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
 ref|XP_008646083.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
 ref|XP_008646084.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
 ref|XP_008646085.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
 ref|XP_008646086.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
 ref|XP_008646087.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
 ref|XP_008646088.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
 ref|XP_008646089.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
Length=327

 Score =   175 bits (444),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  231  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  290

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR++LKYK + + +S
Sbjct  291  DVRTGCETSDITGVMDGELDPFIRAYLKYKLTAAATS  327



>ref|XP_010908923.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
[Elaeis guineensis]
Length=460

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  360  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  419

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSG  280
            DVRTG  TSD+TSVMDG+L+ FI+++LKYKY+ SM  G
Sbjct  420  DVRTGCGTSDVTSVMDGDLEAFIKAYLKYKYTSSMGEG  457



>ref|XP_008656092.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X2 [Zea mays]
Length=321

 Score =   175 bits (443),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  225  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  284

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR++LKYK + + +S
Sbjct  285  DVRTGCETSDITGVMDGELDPFIRAYLKYKLTAAATS  321



>ref|XP_008656091.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
isoform X1 [Zea mays]
Length=326

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  230  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  289

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR++LKYK + + +S
Sbjct  290  DVRTGCETSDITGVMDGELDPFIRAYLKYKLTAAATS  326



>gb|KJB26869.1| hypothetical protein B456_004G264100 [Gossypium raimondii]
Length=463

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKAL+RLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  360  EERSQLANKIKALTRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  419

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            DVRTG+ETSDI SVMDGELD FI+++LKYK+S++
Sbjct  420  DVRTGFETSDIVSVMDGELDAFIKAYLKYKHSIN  453



>ref|NP_851097.1| protein high chlorophyll fluorescent 109 [Arabidopsis thaliana]
 emb|CAC36322.1| translation releasing factor2 [Arabidopsis thaliana]
 gb|AED94053.1| protein high chlorophyll fluorescent 109 [Arabidopsis thaliana]
Length=455

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANK +AL RLKAKL+VIAEEQRA+EIK+IRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  355  EERSQLANKTRALIRLKAKLMVIAEEQRATEIKEIRGDAVKAEWGQQIRNYVFHPYKLVK  414

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG+ETSDITSVMDG+LDPFI+++LK+KY+++M+S
Sbjct  415  DVRTGHETSDITSVMDGDLDPFIKAYLKHKYTLAMAS  451



>ref|NP_851096.1| protein high chlorophyll fluorescent 109 [Arabidopsis thaliana]
 sp|Q9LVY0.1|PRFB1_ARATH RecName: Full=Peptide chain release factor PrfB1, chloroplastic; 
Short=AtPrfB1; AltName: Full=AtPrfB; AltName: Full=Protein 
HIGH CHLOROPHYLL FLUORESCENCE 109; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAA96892.1| translation releasing factor RF-2 [Arabidopsis thaliana]
 gb|AAL07083.1| putative translation releasing factor RF-2 [Arabidopsis thaliana]
 gb|AAM51328.1| putative translation releasing factor RF-2 [Arabidopsis thaliana]
 gb|AAM61285.1| translation releasing factor RF-2 [Arabidopsis thaliana]
 gb|AED94051.1| protein high chlorophyll fluorescent 109 [Arabidopsis thaliana]
Length=456

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANK +AL RLKAKL+VIAEEQRA+EIK+IRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  356  EERSQLANKTRALIRLKAKLMVIAEEQRATEIKEIRGDAVKAEWGQQIRNYVFHPYKLVK  415

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG+ETSDITSVMDG+LDPFI+++LK+KY+++M+S
Sbjct  416  DVRTGHETSDITSVMDGDLDPFIKAYLKHKYTLAMAS  452



>ref|XP_006283633.1| hypothetical protein CARUB_v10004691mg [Capsella rubella]
 gb|EOA16531.1| hypothetical protein CARUB_v10004691mg [Capsella rubella]
Length=485

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANK +AL RLKAKLLVIAEEQRA+EIK+IRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  385  EERSQLANKTRALIRLKAKLLVIAEEQRATEIKEIRGDAVKAEWGQQIRNYVFHPYKLVK  444

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRTG+ETSDITSVMDG+LDPFI+++LK+KY+++M+S  
Sbjct  445  DVRTGHETSDITSVMDGDLDPFIKAYLKHKYTLAMASAA  483



>dbj|BAJ85383.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=236

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKAL RLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  136  EERSQLANKIKALRRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  195

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRT  ETSDI+ VMDGELDPFI+++L+YK S +    G
Sbjct  196  DVRTACETSDISGVMDGELDPFIKAYLQYKLSAAAEEQG  234



>ref|XP_008650160.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Zea mays]
Length=276

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYK VK
Sbjct  180  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKFVK  239

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR+++KYK + + +S
Sbjct  240  DVRTGCETSDITGVMDGELDPFIRAYIKYKLTAAATS  276



>ref|XP_007029206.1| High chlorophyll fluorescent 109 isoform 1 [Theobroma cacao]
 gb|EOY09708.1| High chlorophyll fluorescent 109 isoform 1 [Theobroma cacao]
Length=537

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/92 (91%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  395  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  454

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYS  298
            DVRTG+ETSDI SVMDGELD FI+++LK+KYS
Sbjct  455  DVRTGFETSDIASVMDGELDAFIKAYLKHKYS  486



>ref|NP_001152654.1| peptide chain release factor 2 [Zea mays]
 gb|ACG48772.1| peptide chain release factor 2 [Zea mays]
 gb|ACN29186.1| unknown [Zea mays]
 tpg|DAA63045.1| TPA: peptide chain release factor 2 [Zea mays]
Length=449

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  353  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  412

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRTG ETSDIT VMDGELDPFIR++LKYK + + +S
Sbjct  413  DVRTGCETSDITGVMDGELDPFIRAYLKYKLTAAATS  449



>ref|XP_010673888.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=454

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+Q+ NK+KAL+RLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  356  EERSQIQNKVKALNRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  415

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRT YETSDI SVMDG+LDPFI+S+LK+KY+  +++
Sbjct  416  DVRTSYETSDIASVMDGDLDPFIKSYLKHKYTQMLTT  452



>ref|NP_001059924.1| Os07g0546600 [Oryza sativa Japonica Group]
 dbj|BAC79675.1| putative translation releasing factor2 [Oryza sativa Japonica 
Group]
 dbj|BAF21838.1| Os07g0546600 [Oryza sativa Japonica Group]
Length=460

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  360  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  419

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            DVRT  ETSDIT VMDGELD FIR++LKYK S +
Sbjct  420  DVRTACETSDITGVMDGELDTFIRAYLKYKLSAA  453



>ref|XP_006395914.1| hypothetical protein EUTSA_v10004205mg [Eutrema salsugineum]
 gb|ESQ33200.1| hypothetical protein EUTSA_v10004205mg [Eutrema salsugineum]
Length=450

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+Q ANK + LSRLKAKLLVIAEEQRA+EIK+IRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  350  EERSQSANKTRGLSRLKAKLLVIAEEQRATEIKEIRGDVVKAEWGQQIRNYVFHPYKLVK  409

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSG  280
            DVRT +ETSDITSVMDG+LDPFI+++LK+KYS++M+S 
Sbjct  410  DVRTSHETSDITSVMDGDLDPFIKAYLKHKYSLAMASA  447



>gb|EAZ04247.1| hypothetical protein OsI_26391 [Oryza sativa Indica Group]
Length=457

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  357  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  416

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            DVRT  ETSDIT VMDGELD FIR++LKYK S +
Sbjct  417  DVRTACETSDITGVMDGELDTFIRAYLKYKLSAA  450



>gb|EEE67361.1| hypothetical protein OsJ_24645 [Oryza sativa Japonica Group]
Length=498

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  398  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  457

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            DVRT  ETSDIT VMDGELD FIR++LKYK S +
Sbjct  458  DVRTACETSDITGVMDGELDTFIRAYLKYKLSAA  491



>gb|KFK30645.1| hypothetical protein AALP_AA6G008900 [Arabis alpina]
Length=453

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+Q ANK + LSRLKAKLLVIAEEQRA+EIK+IRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  353  EERSQSANKTRGLSRLKAKLLVIAEEQRATEIKEIRGDVVKAEWGQQIRNYVFHPYKLVK  412

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSG  280
            DVRT +ETSDITSVMDG+LDPFI+++LK+KY+++M+S 
Sbjct  413  DVRTSHETSDITSVMDGDLDPFIKAYLKHKYTLAMASA  450



>ref|XP_003560113.2| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Brachypodium distachyon]
Length=447

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKAL RLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  347  EERSQLANKIKALRRLKAKLLVIAEEQRASEIKQIRGDVVKAEWGQQIRNYVFHPYKLVK  406

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            DVRT  ETSDI+ VMDGELDPFIR++L+YK S++
Sbjct  407  DVRTACETSDISGVMDGELDPFIRAYLQYKLSVA  440



>gb|EPS67120.1| hypothetical protein M569_07654, partial [Genlisea aurea]
Length=396

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKA+SRLKAKLLVIAEEQRA EIK I+GDAVKAEWGQQIRNYVFHPYKL K
Sbjct  299  EERSQLANKIKAMSRLKAKLLVIAEEQRAGEIKMIKGDAVKAEWGQQIRNYVFHPYKLAK  358

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYK  304
            DVRTGYETSD++SVMDGELDPFI+++LK+K
Sbjct  359  DVRTGYETSDVSSVMDGELDPFIKAYLKHK  388



>ref|XP_009144652.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
isoform X1 [Brassica rapa]
Length=452

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+Q ANK + L+RLKAKLLVIAEEQRA+EIK+IRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  352  EERSQSANKTRGLARLKAKLLVIAEEQRATEIKEIRGDVVKAEWGQQIRNYVFHPYKLVK  411

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRT +ETSDITSVMDG+LDPFI+++LK+KY+++M+S
Sbjct  412  DVRTSHETSDITSVMDGDLDPFIKAYLKHKYTLAMAS  448



>emb|CDY68504.1| BnaAnng27520D [Brassica napus]
Length=452

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+Q ANK + L+RLKAKLLVIAEEQRA+EIK+IRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  352  EERSQSANKTRGLARLKAKLLVIAEEQRATEIKEIRGDVVKAEWGQQIRNYVFHPYKLVK  411

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRT +ETSDITSVMDG+LDPFI+++LK+KY+++M+S
Sbjct  412  DVRTSHETSDITSVMDGDLDPFIKAYLKHKYTLAMAS  448



>emb|CDY06442.1| BnaC06g12020D [Brassica napus]
Length=450

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+Q ANK + L+RLKAKLLVIAEEQRA+EIK+IRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  350  EERSQSANKTRGLARLKAKLLVIAEEQRATEIKEIRGDVVKAEWGQQIRNYVFHPYKLVK  409

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRT +ETSDITSVMDG+LDPFI+++LK+KY+++M+S
Sbjct  410  DVRTSHETSDITSVMDGDLDPFIKAYLKHKYTLAMAS  446



>dbj|BAJ87733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKAL RLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  417  EERSQLANKIKALRRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  476

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            DVRT  ETSDI+ VMDGELDPFI+++L+YK S +    G
Sbjct  477  DVRTACETSDISGVMDGELDPFIKAYLQYKLSAAAEEQG  515



>gb|EMT33004.1| Peptide chain release factor 2 [Aegilops tauschii]
Length=459

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKAL RLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  359  EERSQLANKIKALRRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  418

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            DVRT  ETSDI+ VMDGELDPFI+++L+YK S +
Sbjct  419  DVRTACETSDISGVMDGELDPFIKAYLQYKLSAA  452



>ref|XP_006658669.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Oryza brachyantha]
Length=520

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  417  EERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  476

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYS  298
            DVRTG ETSD+  VMDGELD F+R++LK+K S
Sbjct  477  DVRTGCETSDVAGVMDGELDAFVRAYLKHKLS  508



>gb|EMS47820.1| Peptide chain release factor 2 [Triticum urartu]
Length=539

 Score =   169 bits (429),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKAL RLKAKLLVIAEEQRASEI+QIRGDAVKAEWGQQIRNYVFHPYKLVK
Sbjct  439  EERSQLANKIKALRRLKAKLLVIAEEQRASEIRQIRGDAVKAEWGQQIRNYVFHPYKLVK  498

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            DVRT  ETSDI+ VMDGELDPFI+++L+YK S +
Sbjct  499  DVRTACETSDISGVMDGELDPFIKAYLQYKLSAA  532



>ref|XP_001765227.1| predicted protein [Physcomitrella patens]
 gb|EDQ69955.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIK L  LKAKLLVIA EQ+AS++K+IRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  307  EERSQLANKIKGLRLLKAKLLVIALEQKASDLKEIRGDVVKAEWGQQIRNYVFHPYKLVK  366

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            DVRT  ETSD+  VMDGEL  FI +FL++K ++S SS
Sbjct  367  DVRTATETSDVAGVMDGELGSFITAFLRWK-TLSESS  402



>ref|XP_002992014.1| hypothetical protein SELMODRAFT_134701 [Selaginella moellendorffii]
 gb|EFJ06863.1| hypothetical protein SELMODRAFT_134701 [Selaginella moellendorffii]
Length=382

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NKIKA++ LK+KLLVI E+QRA+EIK+IRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  284  EERSQLQNKIKAIALLKSKLLVILEDQRAAEIKEIRGDVVKAEWGQQIRNYVFHPYKLVK  343

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            D+RT  ETSDI+ +MDG L+P + ++L  K S S
Sbjct  344  DLRTNVETSDISGIMDGNLEPLLTAYLMSKQSSS  377



>ref|XP_002500878.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62136.1| predicted protein [Micromonas sp. RCC299]
Length=428

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+Q ANK K L+RLKAKL+ +AEEQRA+++  IRGDAV+AEWGQQIRNYVFHPYK+VK
Sbjct  324  EERSQAANKAKGLARLKAKLVAVAEEQRAADVAAIRGDAVRAEWGQQIRNYVFHPYKMVK  383

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYK  304
            DVRTG ETSD+  VM G+LD F+  FL++K
Sbjct  384  DVRTGKETSDVDGVMSGDLDEFMDEFLRWK  413



>ref|XP_002964513.1| hypothetical protein SELMODRAFT_64370, partial [Selaginella moellendorffii]
 gb|EFJ34846.1| hypothetical protein SELMODRAFT_64370, partial [Selaginella moellendorffii]
Length=366

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NKIKA++ LK+KLLVI EEQRA+EIK+IRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  277  EERSQLQNKIKAIALLKSKLLVILEEQRAAEIKEIRGDVVKAEWGQQIRNYVFHPYKLVK  336

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYK  304
            D+RT  ETSDI+ +MDG L+P + ++L  K
Sbjct  337  DLRTNVETSDISGIMDGNLEPLLTAYLMSK  366



>gb|KIY99518.1| Peptide chain release factor 2 [Monoraphidium neglectum]
Length=122

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ERTQLAN+  AL RL+AKLLV+ EEQRA+ + +++GD VKAEWGQQIRNYV HPYKL K
Sbjct  20   QERTQLANRAIALQRLRAKLLVVLEEQRAAALAELKGDIVKAEWGQQIRNYVLHPYKLAK  79

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYK  304
            D RTG+ET+D+ +V+DG L+PF+ ++L+++
Sbjct  80   DTRTGHETADVGAVLDGGLEPFMTAWLRHR  109



>ref|WP_044170898.1| peptide chain release factor 2 [Oscillatoria sp. PCC 10802]
Length=291

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+ LKAKLL++A EQRA EI QIRGD V+A WG QIRNYVFHPY+LVK
Sbjct  193  EERSQLQNKEKALAILKAKLLIVAVEQRAKEIAQIRGDMVEAAWGNQIRNYVFHPYQLVK  252

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            D+RTG ET+ IT VM+GELDPFI ++L+ +  ++ S
Sbjct  253  DLRTGVETTAITDVMNGELDPFIEAYLRQENQIAES  288



>ref|WP_035999252.1| peptide chain release factor 2 [Leptolyngbya sp. JSC-1]
Length=308

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI  IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  210  EERSQLQNKEKALARLKAKLLVIAQEQRAKEIADIRGDIVEAAWGNQIRNYVFHPYQLVK  269

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RTG ET+ IT VM+G+LD FI S L+ +  +  SS
Sbjct  270  DLRTGTETTAITDVMNGDLDQFIESCLRQENQLVESS  306



>ref|WP_041233567.1| peptide chain release factor 2 [Cylindrospermum stagnale]
Length=298

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  200  EERSQLQNKEKALARLKAKLLVIAQEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  259

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GELDPFI+++L+
Sbjct  260  DLRTNTETTGIIDVMNGELDPFIQAYLR  287



>ref|WP_041642024.1| peptide chain release factor 2 [Trichormus azollae]
Length=291

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  193  EERSQLQNKEKALARLKAKLLVIAQEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  252

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            D+RT  ET+ IT +M+GE+D FI+++L+ +  +  S+ G
Sbjct  253  DLRTNTETTAITDIMNGEIDAFIQAYLRQENQLVDSNSG  291



>ref|WP_035150658.1| peptide chain release factor 2 [Calothrix sp. 336/3]
 gb|KFB82393.1| peptide chain release factor 2 [Calothrix sp. 336/3]
Length=287

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKA+LLVIA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALARLKARLLVIAQEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GE+DPFI+S+L+
Sbjct  250  DLRTNVETTAIADVMNGEIDPFIQSYLR  277



>ref|XP_005647849.1| peptide chain release factor 2 [Coccomyxa subellipsoidea C-169]
 gb|EIE23305.1| peptide chain release factor 2 [Coccomyxa subellipsoidea C-169]
Length=368

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            ++R+QL NK  A+ +LKAKL+V+ +EQ+A EI +IRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  273  QQRSQLQNKALAMEQLKAKLVVVQQEQQAREIAEIRGDIVKAEWGQQIRNYVFHPYKLVK  332

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            DVRTG ETSD+  VMDG++D F++++L++K  +S
Sbjct  333  DVRTGMETSDVPGVMDGDIDQFVQAYLRHKGRLS  366



>gb|ACC80054.1| peptide chain release factor 2 [Nostoc punctiforme PCC 73102]
Length=289

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  191  EERSQLQNKEKALNRLKAKLLVIAKEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  250

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GELDPFI+++L+
Sbjct  251  DLRTNTETTAIGDVMNGELDPFIQAYLR  278



>ref|WP_041565957.1| peptide chain release factor 2 [Nostoc punctiforme]
Length=288

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALNRLKAKLLVIAKEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GELDPFI+++L+
Sbjct  250  DLRTNTETTAIGDVMNGELDPFIQAYLR  277



>ref|WP_016950467.1| peptide chain release factor 2 [Anabaena sp. PCC 7108]
Length=279

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLL+IA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  181  EERSQLQNKEKALARLKAKLLIIAKEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  240

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            D+RT  ET+ IT +M+GE+D FI+++L+ +  +  S+ G
Sbjct  241  DLRTNTETTAITDIMNGEIDAFIQAYLRQENQLVDSNPG  279



>ref|XP_002993180.1| hypothetical protein SELMODRAFT_431302 [Selaginella moellendorffii]
 gb|EFJ05820.1| hypothetical protein SELMODRAFT_431302 [Selaginella moellendorffii]
Length=221

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NKIKA++ LK+KLLVI EEQ+A+EIK+IRGD VKAEWGQ+IRNYVFHPY+LV 
Sbjct  18   KERSQLENKIKAIALLKSKLLVILEEQKAAEIKEIRGDVVKAEWGQEIRNYVFHPYRLVH  77

Query  393  DVRTGYETSDITSVMDGELDPFIRSFL  313
            D+RT  ETSDI+ +MDG ++P + ++L
Sbjct  78   DLRTNVETSDISGIMDGNVEPLLTAYL  104



>ref|XP_005852064.1| hypothetical protein CHLNCDRAFT_133064 [Chlorella variabilis]
 gb|EFN59962.1| hypothetical protein CHLNCDRAFT_133064 [Chlorella variabilis]
Length=426

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -3

Query  570  ERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVKD  391
            ER+Q  NK  AL  LKAKLLV+A+EQ+  E+ +IRGD VKAEWGQQIRNYVFHPYKLVKD
Sbjct  319  ERSQAQNKSIALGMLKAKLLVVAQEQQLQEVAEIRGDLVKAEWGQQIRNYVFHPYKLVKD  378

Query  390  VRTGYETSDITSVMDGELDPFIRSFLKYK  304
            VRTG ETSD+  VMDGEL PF++++L+++
Sbjct  379  VRTGQETSDVAGVMDGELQPFMQAYLQHR  407



>ref|WP_026099974.1| peptide chain release factor 2 [Microchaete sp. PCC 7126]
Length=292

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  EERSQLQNKEKALARLKAKLLVIAQEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I+ VMDG+LD FI+++L+
Sbjct  254  DLRTNTETTAISDVMDGDLDTFIQAYLR  281



>ref|WP_027402514.1| peptide chain release factor 2 [Aphanizomenon flos-aquae]
Length=285

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALARLKAKLLVIAKEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ IT VM+GELD FI+++L+
Sbjct  250  DLRTNIETTAITDVMNGELDMFIQAYLR  277



>ref|XP_002992038.1| hypothetical protein SELMODRAFT_430253 [Selaginella moellendorffii]
 gb|EFJ06887.1| hypothetical protein SELMODRAFT_430253 [Selaginella moellendorffii]
Length=654

 Score =   137 bits (345),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 64/94 (68%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            E+R+QL NKIKA+  LK+KLLVI E+QRA+EIK+IRGD VKAEWGQQIRNYVFHPYKLV 
Sbjct  220  EKRSQLQNKIKAIVLLKSKLLVILEDQRAAEIKEIRGDVVKAEWGQQIRNYVFHPYKLVM  279

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            D+RT  ETSDI+ +MDG+L+P + ++L  K S S
Sbjct  280  DLRTNVETSDISGIMDGKLEPLLTAYLMSKQSSS  313



>ref|WP_010994450.1| peptide chain release factor 2 [Nostoc sp. PCC 7120]
 dbj|BAB77797.1| peptide chain release factor [Nostoc sp. PCC 7120]
Length=292

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ+A EI QIRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  EERSQLQNKEKALARLKAKLLVIAQEQKAQEIAQIRGDMVEASWGNQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GELD FI+S+L+
Sbjct  254  DLRTNVETTAIADVMNGELDMFIQSYLR  281



>ref|WP_027840186.1| peptide chain release factor 2 [Mastigocoleus testarum]
Length=298

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  200  EERSQLQNKEKALTRLKAKLLVIAQEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  259

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+ I  VM+GELD FI+++L+ +  +  S+
Sbjct  260  DLRTEVETTAINDVMNGELDSFIQAYLRQENQLVEST  296



>ref|WP_041457741.1| peptide chain release factor 2 [Anabaena sp. 90]
Length=276

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLL+IA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  181  EERSQLQNKEKALARLKAKLLIIAKEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  240

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ IT VM+GELD FI+++L+
Sbjct  241  DLRTNIETTAITDVMNGELDMFIQAYLR  268



>ref|WP_019494544.1| peptide chain release factor 2 [Calothrix sp. PCC 7103]
Length=361

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA++QRA EI +IRGD   A WG QIRNYVFHPY+LVK
Sbjct  266  EERSQLQNKDKALARLKAKLLVIAQQQRAKEIAEIRGDIADASWGNQIRNYVFHPYQLVK  325

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GELDPFI+S+L+
Sbjct  326  DLRTNLETTAINDVMNGELDPFIQSYLR  353



>ref|XP_002462979.1| hypothetical protein SORBIDRAFT_02g035755 [Sorghum bicolor]
 gb|EER99500.1| hypothetical protein SORBIDRAFT_02g035755 [Sorghum bicolor]
Length=363

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKAL+RLKAKLLVIAEEQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  295  EERSQLANKIKALNRLKAKLLVIAEEQRASEIKQIRGDMVKAEWGQQIRNYVFHPYKLVK  354

Query  393  DVRTGYETS  367
            DVRTG ETS
Sbjct  355  DVRTGCETS  363



>ref|WP_042341660.1| peptide chain release factor 2 [Calothrix sp. PCC 7507]
Length=289

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  EERSQLQNKEKALARLKAKLLVIAQEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I+ VM+G+LD FI+++L+
Sbjct  254  DLRTNTETTGISDVMNGDLDTFIQAYLR  281



>ref|WP_017315492.1| peptide chain release factor 2 [Mastigocladopsis repens]
Length=287

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ A EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALARLKAKLLVIAQEQHAKEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RTG ET+ I  VM+GE+D FI+++L+ +  +  +S
Sbjct  250  DLRTGAETTAIADVMNGEIDMFIQAYLRQENQLVEAS  286



>ref|WP_041555177.1| peptide chain release factor 2 [Nostoc sp. PCC 7524]
Length=290

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ+A EI QIRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  EERSQLQNKEKALARLKAKLLVIAQEQKAQEIAQIRGDMVEASWGNQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+ I  +M+GELD FI+++L+ +  +  S+
Sbjct  254  DLRTNAETTAIADIMNGELDMFIQAYLRQENQLVESA  290



>gb|AFW93922.1| peptide chain release factor 2 [Anabaena sp. 90]
Length=315

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLL+IA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  220  EERSQLQNKEKALARLKAKLLIIAKEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  279

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ IT VM+GELD FI+++L+
Sbjct  280  DLRTNIETTAITDVMNGELDMFIQAYLR  307



>ref|WP_044292100.1| peptide chain release factor 2 [Rivularia sp. PCC 7116]
Length=286

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLV+A+EQ A EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALARLKAKLLVVAQEQHAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ IT VM+GELD FI+++L+
Sbjct  250  DLRTNIETTAITDVMNGELDSFIQAYLR  277



>ref|WP_011319537.1| peptide chain release factor 2 [Anabaena variabilis]
 gb|ABA22397.1| bacterial peptide chain release factor 2 (bRF-2) [Anabaena variabilis 
ATCC 29413]
Length=292

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ+A EI QIRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  EERSQLQNKEKALARLKAKLLVIAQEQKAQEIAQIRGDMVEASWGNQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GELD FI+++L+
Sbjct  254  DLRTNAETTAIADVMNGELDMFIQAYLR  281



>ref|WP_044258393.1| peptide chain release factor 2 [Richelia intracellularis]
Length=288

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KA++RLKAKLLVIA+EQ+A EI QIRGD V+A WG QIRNYVFHPY++V+
Sbjct  190  EERSQLQNKEKAIARLKAKLLVIAQEQKAQEISQIRGDIVEASWGNQIRNYVFHPYQIVR  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            D+RT  ET+ IT VM+G+LD FI+++L+ +  +  S
Sbjct  250  DLRTNLETAAITDVMNGDLDEFIKAYLRQQTQLVKS  285



>ref|WP_006196707.1| peptide chain release factor 2 [Nodularia spumigena]
 gb|EAW45154.1| peptide chain release factor 2 [Nodularia spumigena CCY9414]
 gb|AHJ28913.1| Peptide chain release factor 2; programmed frameshift-containing 
[Nodularia spumigena CCY9414]
Length=288

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA EQ+A E+ +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKDKALARLKAKLLVIAREQKAQEVAEIRGDMVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+ I+ VMDG+LD FI+++L+ +  +  S+
Sbjct  250  DLRTNVETTAISDVMDGDLDSFIQAYLRQESQLVEST  286



>ref|WP_015110363.1| peptide chain release factor 2 [Cyanobium gracile]
 gb|AFY29928.1| peptide chain release factor 2 [Cyanobium gracile PCC 6307]
Length=355

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ L AKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLMAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RTG ET+D+  VMDG+LDPFI+S L+
Sbjct  317  DLRTGEETTDVQGVMDGDLDPFIQSLLR  344



>ref|WP_044304591.1| peptide chain release factor 2 [Richelia intracellularis]
Length=288

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KA++RLKAKLLVIA+EQ+A EI QIRGD V+A WG QIRNYVFHPY++V+
Sbjct  190  EERSQLQNKEKAIARLKAKLLVIAQEQKAQEISQIRGDIVEASWGNQIRNYVFHPYQIVR  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            D+RT  ET+ IT VM+G+LD FI+++L+ +  +  S
Sbjct  250  DLRTNLETAAITDVMNGDLDEFIKAYLRQQTQLVKS  285



>ref|XP_003059463.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56595.1| predicted protein [Micromonas pusilla CCMP1545]
Length=289

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+Q  N+ KA++RLKAKL  +AEE+R +++  +RGD VKAEWGQQIRNYVFHPYK+VK
Sbjct  192  EERSQAMNRAKAIARLKAKLAAVAEERRLADVAAVRGDVVKAEWGQQIRNYVFHPYKMVK  251

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYS  298
            DVRTG ETSD+  VM+G+LD F  ++L+++ S
Sbjct  252  DVRTGMETSDVEGVMNGKLDEFQNAWLRWRAS  283



>ref|WP_028090244.1| peptide chain release factor 2 [Dolichospermum circinale]
Length=285

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLL+IA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALARLKAKLLIIAKEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ IT +M+GE+D FI+++L+
Sbjct  250  DLRTNVETTAITDIMNGEIDMFIQAYLR  277



>ref|WP_028084219.1| peptide chain release factor 2 [Dolichospermum circinale]
Length=285

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLL+IA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALARLKAKLLIIAKEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ IT +M+GE+D FI+++L+
Sbjct  250  DLRTNVETTAITDIMNGEIDMFIQAYLR  277



>ref|WP_039750927.1| peptide chain release factor 2 [Chlorogloeopsis fritschii]
Length=287

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALARLKAKLLVIAQEQRAKEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GE+D FI+S+L+
Sbjct  250  DLRTDVETTAIMDVMNGEIDIFIQSYLR  277



>gb|KIJ82722.1| peptide chain release factor 2 [Scytonema tolypothrichoides VB-61278]
Length=288

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ A E+ +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  191  EERSQLQNKEKALARLKAKLLVIAQEQHAKEVAEIRGDMVEASWGNQIRNYVFHPYQMVK  250

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RTG ET+ I  VM+GE+D FI+++L+ +  +  +S
Sbjct  251  DLRTGEETTAIADVMNGEIDMFIQAYLRQENQLVEAS  287



>gb|AFZ02946.1| bacterial peptide chain release factor 2 (bRF-2) [Calothrix sp. 
PCC 6303]
Length=372

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V A WG QIRNYVFHPY+LVK
Sbjct  275  EERSQLQNKEKALARLKAKLLVIAKEQRAKEIAEIRGDMVDASWGNQIRNYVFHPYQLVK  334

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+ I  VM+GELD FI+++L+ +  +  S+
Sbjct  335  DLRTNVETTAIGDVMNGELDQFIQTYLRQENQLVESA  371



>ref|WP_039738347.1| peptide chain release factor 2 [Hassallia byssoidea]
 gb|KIF38323.1| peptide chain release factor 2 [Hassallia byssoidea VB512170]
Length=286

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ A EI QIRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALARLKAKLLVIAKEQHAQEIAQIRGDMVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GE+D FI+S+L+
Sbjct  250  DLRTNVETTAIGDVMNGEIDMFIQSYLR  277



>ref|WP_041739789.1| peptide chain release factor 2 [Calothrix parietina]
Length=363

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V A WG QIRNYVFHPY+LVK
Sbjct  266  EERSQLQNKEKALARLKAKLLVIAKEQRAKEIAEIRGDMVDASWGNQIRNYVFHPYQLVK  325

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+ I  VM+GELD FI+++L+ +  +  S+
Sbjct  326  DLRTNVETTAIGDVMNGELDQFIQTYLRQENQLVESA  362



>gb|KEF42545.1| peptide chain release factor 2 [Cyanobium sp. CACIAM 14]
Length=318

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ L AKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  220  QERSQLQNKEKAMALLMAKLLVIAQEQRAAEIADIRGDMVEAAWGNQIRNYVFHPYQMVK  279

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RTG ET+D+  VM+G+LDPFI+S L+
Sbjct  280  DLRTGEETTDVQGVMNGDLDPFIQSLLR  307



>ref|WP_006277582.1| peptide chain release factor 2 [Cylindrospermopsis raciborskii]
 gb|EFA69537.1| Peptide chain release factor 2 [Cylindrospermopsis raciborskii 
CS-505]
Length=291

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  EERSQLQNKEKALARLKAKLLVIAREQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQIVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+ I  VM+G+LD FI+++L+ +  +  S 
Sbjct  254  DLRTNLETTAIGDVMNGDLDNFIQAYLRQENQLVTSG  290



>gb|EFA72166.1| Peptide chain release factor 2 [Raphidiopsis brookii D9]
Length=290

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  193  EERSQLQNKEKALARLKAKLLVIAREQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQIVK  252

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+ I  VM+G+LD FI+++L+ +  +  S 
Sbjct  253  DLRTNLETTAIIDVMNGDLDNFIQAYLRQENQLVTSG  289



>ref|WP_040554039.1| peptide chain release factor 2 [Raphidiopsis brookii]
Length=287

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALARLKAKLLVIAREQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQIVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+ I  VM+G+LD FI+++L+ +  +  S 
Sbjct  250  DLRTNLETTAIIDVMNGDLDNFIQAYLRQENQLVTSG  286



>gb|AFY36237.1| peptide chain release factor 2 [Calothrix sp. PCC 7507]
Length=370

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  275  EERSQLQNKEKALARLKAKLLVIAQEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  334

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I+ VM+G+LD FI+++L+
Sbjct  335  DLRTNTETTGISDVMNGDLDTFIQAYLR  362



>ref|WP_033378427.1| MULTISPECIES: peptide chain release factor 2 [Fischerella]
Length=287

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ A EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALARLKAKLLVIAQEQHAKEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GELD FI+++L+
Sbjct  250  DLRTNVETTAIADVMNGELDTFIQAYLR  277



>emb|CCH64884.1| Peptide chain release factor 2; programmed frameshift-containing 
[Richelia intracellularis HM01]
Length=338

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KA++RLKAKLLVIA+EQ+A EI QIRGD V+A WG QIRNYVFHPY++V+
Sbjct  240  EERSQLQNKEKAIARLKAKLLVIAQEQKAQEISQIRGDIVEASWGNQIRNYVFHPYQIVR  299

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            D+RT  ET+ IT VM+G+LD FI+++L+ +  +  S
Sbjct  300  DLRTNLETAAITDVMNGDLDEFIKAYLRQQTQLVKS  335



>ref|WP_038315956.1| peptide chain release factor 2 [cyanobacterium PCC 7702]
Length=287

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ+A EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALARLKAKLLVIAQEQKAQEIAEIRGDIVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+ I  VM+G++D FI+++L+ ++  + ++
Sbjct  250  DLRTNVETTAIADVMNGDIDLFIQAYLRQEHQTAQAT  286



>ref|WP_035115821.1| peptide chain release factor 2 [Fischerella sp. PCC 9339]
Length=287

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ A EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALARLKAKLLVIAQEQHAKEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GELD FI+++L+
Sbjct  250  DLRTNIETTAIADVMNGELDTFIQAYLR  277



>emb|CAK29151.1| Protein chain release factor B, partial [Synechococcus sp. RCC307]
Length=349

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LK+KLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  251  QERSQLQNKEKAMALLKSKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  310

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+  VMDG+LDPFI+S L+
Sbjct  311  DLRTNEETTDVQGVMDGDLDPFIQSLLR  338



>ref|WP_029637589.1| peptide chain release factor 2 [[Scytonema hofmanni] UTEX B 1581]
Length=286

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKA+LLVIA+EQ A EI QIRGD V+A WG QIRNYVFHPY++VK
Sbjct  190  EERSQLQNKEKALARLKARLLVIAKEQHAQEIAQIRGDMVEASWGNQIRNYVFHPYQMVK  249

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+ I  VM+GE+D FI+S+L+ +  +  S+
Sbjct  250  DLRTNVETTAIGDVMNGEIDMFIQSYLRQENQLVESN  286



>ref|WP_035830559.1| peptide chain release factor 2 [Cyanobium sp. CACIAM 14]
Length=345

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ L AKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  247  QERSQLQNKEKAMALLMAKLLVIAQEQRAAEIADIRGDMVEAAWGNQIRNYVFHPYQMVK  306

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RTG ET+D+  VM+G+LDPFI+S L+
Sbjct  307  DLRTGEETTDVQGVMNGDLDPFIQSLLR  334



>ref|WP_036046350.1| peptide chain release factor 2 [Leptolyngbya boryana]
Length=281

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+ LKAKLL+IAEEQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  186  EERSQLQNKEKALAYLKAKLLIIAEEQRAKEIAEIRGDMVEAAWGMQIRNYVFHPYQMVK  245

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ +  VM+GELDPFI + L+
Sbjct  246  DLRTNVETTAVQDVMNGELDPFIEACLR  273



>ref|WP_041779882.1| peptide chain release factor 2 [Microcoleus sp. PCC 7113]
Length=286

 Score =   129 bits (325),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+ LKAKLL+IA+EQRA E+ +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  193  EERSQLQNKEKALAILKAKLLIIAQEQRAKEVAEIRGDMVEAAWGNQIRNYVFHPYQMVK  252

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ +  VMDG+LDPFI ++L+
Sbjct  253  DLRTNVETTAVGDVMDGDLDPFIEAYLR  280



>ref|WP_039990712.1| MULTISPECIES: peptide chain release factor 2 [Fischerella]
Length=278

 Score =   129 bits (325),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ A EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  181  EERSQLQNKEKALARLKAKLLVIAQEQHAKEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  240

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GELD FI+++L+
Sbjct  241  DLRTNVETTAIADVMNGELDMFIQAYLR  268



>ref|WP_043738389.1| peptide chain release factor 2 [Synechococcus sp. RCC307]
Length=360

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LK+KLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  262  QERSQLQNKEKAMALLKSKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  321

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+  VMDG+LDPFI+S L+
Sbjct  322  DLRTNEETTDVQGVMDGDLDPFIQSLLR  349



>emb|CCH67058.1| Peptide chain release factor 2; programmed frameshift-containing 
[Richelia intracellularis HH01]
Length=364

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KA++RLKAKLLVIA+EQ+A EI QIRGD V+A WG QIRNYVFHPY++V+
Sbjct  266  EERSQLQNKEKAIARLKAKLLVIAQEQKAQEISQIRGDIVEASWGNQIRNYVFHPYQIVR  325

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ IT VM+G+LD FI+++L+
Sbjct  326  DLRTNLETAAITDVMNGDLDEFIKAYLR  353



>ref|WP_042466153.1| peptide chain release factor 2 [Anabaena cylindrica]
Length=292

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  EERSQLQNKEKALARLKAKLLVIAKEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  +M+GE+D FI+++L+
Sbjct  254  DLRTNTETTAIGDIMNGEIDAFIQAYLR  281



>gb|KIE08023.1| peptide chain release factor 2 [Tolypothrix bouteillei VB521301]
Length=290

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ A EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  EERSQLQNKEKALARLKAKLLVIAQEQHAKEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+ I  +M+GE+D FI+++L+ +  +  +S
Sbjct  254  DLRTNEETTAIADIMNGEIDSFIQAYLRQENQLVANS  290



>ref|WP_010305233.1| peptide chain release factor 2 [Synechococcus sp. CB0101]
Length=356

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ L AKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLMAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFL  313
            D+RT +ET+D+  VMDG+LDPFI+S L
Sbjct  317  DLRTQHETTDVQGVMDGDLDPFIQSLL  343



>ref|WP_006911018.1| peptide chain release factor 2 [Cyanobium sp. PCC 7001]
 gb|EDY39105.1| peptide chain release factor 2 [Cyanobium sp. PCC 7001]
Length=358

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ L AKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  257  QERSQLQNKEKAMALLMAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQLVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSSGG  277
            D+RT +ET+D+  VMDG+LDPFI+S L     +     G
Sbjct  317  DLRTQHETTDVQGVMDGDLDPFIQSLLHAGVEVGSGEDG  355



>ref|WP_041268845.1| peptide chain release factor 2 [Geitlerinema sp. PCC 7407]
Length=308

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLL+IA+EQRA EI  IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  210  QERSQLQNKEKAMAILKAKLLIIAQEQRAKEIADIRGDMVEAAWGNQIRNYVFHPYQLVK  269

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSM  295
            D+RT  ET+ I  VM+GELDPFI+S L+ +  M
Sbjct  270  DLRTNLETTAIEDVMNGELDPFIQSCLRQENQM  302



>ref|WP_044500335.1| peptide chain release factor 2 [Nostoc sp. PCC 7107]
Length=292

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA EQ+A EI QIRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  EERSQLQNKEKALARLKAKLLVIAREQKAQEIAQIRGDMVEASWGNQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+G+LD FI+++L+
Sbjct  254  DLRTNSETTAIADVMNGDLDMFIQAYLR  281



>ref|WP_035138436.1| peptide chain release factor 2 [Fischerella muscicola]
Length=297

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ A EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  200  EERSQLQNKEKALARLKAKLLVIAQEQHAKEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  259

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GELD FI+++L+
Sbjct  260  DLRTNVETTAIVDVMNGELDMFIQAYLR  287



>ref|WP_039714401.1| peptide chain release factor 2 [Scytonema millei]
 gb|KIF22135.1| peptide chain release factor 2 [Scytonema millei VB511283]
Length=289

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL+IA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  QERSQLQNKEKALAILKAKLLIIAQEQRAQEIAEIRGDMVEAAWGTQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            D+RT  ET+ IT VM+GELD FI S+L+ +  +  S
Sbjct  254  DLRTNVETTAITDVMNGELDTFIESYLRQEKQLVAS  289



>ref|WP_041463592.1| peptide chain release factor 2 [Chroococcidiopsis thermalis]
Length=289

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL+IA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  QERSQLQNKEKALAILKAKLLIIAQEQRAQEIAEIRGDMVEAAWGTQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            D+RT  ET+ IT VM+GELD FI S+L+ +  +  S
Sbjct  254  DLRTNLETTAITDVMNGELDTFIESYLRQEKQLVAS  289



>ref|WP_006173289.1| peptide chain release factor 2 [Synechococcus sp. WH 5701]
 gb|EAQ76671.1| peptide chain release factor 2 [Synechococcus sp. WH 5701]
Length=355

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ L AKLLVIA+EQRASEI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLMAKLLVIAQEQRASEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+  VMDG+LDPFI++ L+
Sbjct  317  DLRTAVETTDVQGVMDGDLDPFIQALLR  344



>ref|WP_010313445.1| peptide chain release factor 2 [Synechococcus sp. CB0205]
Length=356

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ L AKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLMAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT +ET+D+  VMDG+LDPFI+S L     ++ +S
Sbjct  317  DLRTQHETTDVQGVMDGDLDPFIQSLLHAGVEVAGAS  353



>ref|WP_041041546.1| peptide chain release factor 2 [Tolypothrix campylonemoides]
 gb|KIJ74191.1| peptide chain release factor 2 [Tolypothrix campylonemoides VB511288]
Length=291

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ A EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  EERSQLQNKEKALARLKAKLLVIAQEQHAKEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+ I  VM+GE+D FI+++L+ +  +  +S
Sbjct  254  DLRTAAETTAIADVMNGEIDMFIQAYLRQENQLVEAS  290



>ref|WP_011056377.1| peptide chain release factor 2 [Thermosynechococcus elongatus]
 ref|NP_681317.1| peptide chain release factor 2 [Thermosynechococcus elongatus 
BP-1]
 dbj|BAC08079.1| peptide chain release factor 2 [Thermosynechococcus elongatus 
BP-1]
Length=290

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLLVIA+EQ+A EI  IRG+AV+A WG QIRNYVFHPY+LVK
Sbjct  197  QERSQLQNKEKALAILKAKLLVIAQEQKAKEIADIRGEAVEAAWGNQIRNYVFHPYQLVK  256

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            D+RT  ET+ I  VMDG LDPFI+++L+ + + S
Sbjct  257  DLRTEVETTAIQDVMDGNLDPFIQAYLRQQTAAS  290



>ref|WP_011934212.1| peptide chain release factor 2 [Synechococcus sp. WH 7803]
 emb|CAK24751.1| Protein chain release factor B [Synechococcus sp. WH 7803]
Length=356

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+  VMDG+LDPFI++ L+
Sbjct  317  DLRTQEETNDVQGVMDGDLDPFIQALLR  344



>ref|WP_026732904.1| peptide chain release factor 2 [Fischerella sp. PCC 9605]
Length=291

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  EERSQLQNKEKALARLKAKLLVIAREQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GE+D FI+++L+
Sbjct  254  DLRTEVETTAIADVMNGEIDMFIQAYLR  281



>ref|WP_007099168.1| peptide chain release factor 2 [Synechococcus sp. RS9916]
 gb|EAU75071.1| peptide chain release factor 2 [Synechococcus sp. RS9916]
Length=356

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ L AKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLMAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFL  313
            D+RT +ET+D+  VMDG+LDPFI+S L
Sbjct  317  DLRTQHETNDVQGVMDGDLDPFIQSLL  343



>ref|WP_040687545.1| peptide chain release factor 2 [Pseudanabaena biceps]
Length=293

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK  A+  LKAKLL+IA+EQRA +I  IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  200  QERSQLQNKENAMRLLKAKLLIIAQEQRAQKIADIRGDMVEAAWGNQIRNYVFHPYQLVK  259

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RTG ET++I +VMDG+L+PFI+S+L+
Sbjct  260  DLRTGEETTNIQNVMDGDLEPFIQSYLR  287



>ref|WP_036923394.1| peptide chain release factor 2 [Prochlorococcus marinus]
Length=313

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KA++ LKAKLLVIA+EQRA+EI +I+GD V+A WG QIRNYVFHPY++VK
Sbjct  220  EERSQLKNKEKAMNLLKAKLLVIAKEQRAAEISEIKGDIVEAAWGTQIRNYVFHPYQMVK  279

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYS  298
            D+RT  ET+D+ SV++G+LDPFI   L+   S
Sbjct  280  DLRTKQETNDLDSVLNGDLDPFINKLLRLNIS  311



>ref|WP_007101349.1| peptide chain release factor 2 [Synechococcus sp. RS9917]
 gb|EAQ70538.1| Peptide chain release factor 2 [Synechococcus sp. RS9917]
Length=356

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+  VMDG LDPFI++ L+
Sbjct  317  DLRTQEETTDVQGVMDGHLDPFIQALLR  344



>ref|WP_041429945.1| peptide chain release factor 2 [Thermosynechococcus sp. NK55a]
Length=287

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLLVIA+EQ+A EI  IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  193  QERSQLQNKEKALAILKAKLLVIAQEQKAKEIADIRGDVVEAAWGNQIRNYVFHPYQLVK  252

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VMDG+LDPFI ++L+
Sbjct  253  DLRTEVETTAIQDVMDGDLDPFIHAYLR  280



>gb|EHC18025.1| Peptide chain release factor 2 [Fischerella sp. JSC-11]
Length=372

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQ A EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  275  EERSQLQNKEKALARLKAKLLVIAQEQHAKEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  334

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GELD FI+++L+
Sbjct  335  DLRTNVETTAIADVMNGELDMFIQAYLR  362



>ref|WP_041918812.1| peptide chain release factor 2 [Gloeocapsa sp. PCC 7428]
Length=292

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL++A+EQRA EI QIRGD V+A WG QIRNYVFHPY+LVK
Sbjct  194  QERSQLQNKEKALAILKAKLLIVAQEQRAQEIAQIRGDMVEAAWGNQIRNYVFHPYQLVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+ I  VM+GE+D FI+++L+ +  +  S+
Sbjct  254  DLRTNVETTAIADVMNGEIDLFIQAYLRQENQLVESN  290



>gb|AFZ60017.1| Peptide chain release factor 2 [Anabaena cylindrica PCC 7122]
Length=373

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  275  EERSQLQNKEKALARLKAKLLVIAKEQRAQEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  334

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  +M+GE+D FI+++L+
Sbjct  335  DLRTNTETTAIGDIMNGEIDAFIQAYLR  362



>gb|AFY37549.1| bacterial peptide chain release factor 2 (bRF-2) [Leptolyngbya 
sp. PCC 7376]
Length=373

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQR  EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  277  QERSQLQNKEKAMALLKAKLLVIAQEQRTQEIAEIRGDMVEAAWGNQIRNYVFHPYQMVK  336

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+D++ VMDG+LD FI ++L+ +  +  +S
Sbjct  337  DLRTNKETTDVSGVMDGDLDSFIEAYLRQETHVGEAS  373



>ref|WP_041763200.1| peptide chain release factor 2 [Leptolyngbya sp. PCC 7376]
Length=359

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQR  EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  263  QERSQLQNKEKAMALLKAKLLVIAQEQRTQEIAEIRGDMVEAAWGNQIRNYVFHPYQMVK  322

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+D++ VMDG+LD FI ++L+ +  +  +S
Sbjct  323  DLRTNKETTDVSGVMDGDLDSFIEAYLRQETHVGEAS  359



>ref|WP_019475510.1| peptide chain release factor 2 [Prochlorococcus sp. W3]
Length=343

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KA++ LKAKLLVIA+EQRA+EI +I+GD V+A WG QIRNYVFHPY++VK
Sbjct  250  EERSQLKNKEKAMNLLKAKLLVIAKEQRAAEISEIKGDIVEAAWGTQIRNYVFHPYQMVK  309

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYS  298
            D+RT  ET+D+ SV++G+LDPFI   L+   S
Sbjct  310  DLRTKQETNDLDSVLNGDLDPFINKLLRLNIS  341



>tpg|DAA51264.1| TPA: hypothetical protein ZEAMMB73_478053 [Zea mays]
Length=289

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 72/85 (85%), Gaps = 6/85 (7%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  164  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  223

Query  393  DVRTGYETSDITSVMDGELDPFIRS  319
            DVRTG      ++++  E D F R+
Sbjct  224  DVRTG------SNLLVAEDDAFNRN  242



>ref|WP_041226096.1| peptide chain release factor 2 [Crinalium epipsammum]
Length=286

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL  LKAKLL+IA+EQRA E+ +IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  193  QERSQLQNKEKALVILKAKLLIIAQEQRAQEVAEIRGDMVEAAWGNQIRNYVFHPYQLVK  252

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            D+RTG ET+ +T +++GELD FI ++L+ +  ++
Sbjct  253  DLRTGVETTAVTDILNGELDLFIEAYLRQENQLT  286



>ref|WP_041426759.1| peptide chain release factor 2 [Synechococcus sp. CC9311]
Length=356

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+  VMDG+L+PFI++ L+
Sbjct  317  DLRTQEETTDVQGVMDGDLNPFIQALLR  344



>ref|WP_006854038.1| peptide chain release factor 2 [Synechococcus sp. WH 8016]
 gb|EHA61831.1| Peptide chain release factor 2 [Synechococcus sp. WH 8016]
Length=356

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+  VMDG+L+PFI++ L+
Sbjct  317  DLRTQEETTDVQGVMDGDLNPFIQALLR  344



>ref|WP_041443307.1| peptide chain release factor 2 [Synechococcus sp. PCC 7002]
Length=338

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL+IA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  244  QERSQLQNKEKALAILKAKLLIIAQEQRAQEIAEIRGDMVEAAWGNQIRNYVFHPYQMVK  303

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT +ET+D+  VMDG+LD FI + L+
Sbjct  304  DLRTNHETTDVDGVMDGDLDAFIEASLR  331



>ref|WP_030007901.1| peptide chain release factor 2 [Synechococcus sp. NKBG042902]
Length=338

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL+IA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  244  QERSQLQNKEKALAILKAKLLIIAQEQRAQEIAEIRGDMVEAAWGNQIRNYVFHPYQMVK  303

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT +ET+D+  VMDG+LD FI + L+
Sbjct  304  DLRTNHETTDVDGVMDGDLDAFIEASLR  331



>ref|WP_012194754.1| peptide chain release factor 2 [Prochlorococcus marinus]
 gb|ABX08129.1| peptide chain release factor RF-2 [Prochlorococcus marinus str. 
MIT 9211]
Length=356

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKL++IA+EQRAS+I  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLMIIAQEQRASQIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFL  313
            D+RTG E++D+  VM+G+LDPFI++ L
Sbjct  317  DLRTGKESTDVEGVMNGDLDPFIQALL  343



>gb|ABI46074.1| peptide chain release factor 2, programmed frameshift [Synechococcus 
sp. CC9311]
Length=375

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  276  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  335

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+  VMDG+L+PFI++ L+
Sbjct  336  DLRTQEETTDVQGVMDGDLNPFIQALLR  363



>gb|ELS33558.1| bacterial peptide chain release factor 2 (bRF-2) [Pseudanabaena 
biceps PCC 7429]
Length=368

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK  A+  LKAKLL+IA+EQRA +I  IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  275  QERSQLQNKENAMRLLKAKLLIIAQEQRAQKIADIRGDMVEAAWGNQIRNYVFHPYQLVK  334

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RTG ET++I +VMDG+L+PFI+S+L+
Sbjct  335  DLRTGEETTNIQNVMDGDLEPFIQSYLR  362



>ref|WP_038552613.1| peptide chain release factor 2 [Synechococcus sp. KORDI-52]
 gb|AII48292.1| peptide chain release factor 2 [Synechococcus sp. KORDI-52]
Length=356

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+ +VMDG LDPFI + L+
Sbjct  317  DLRTNEETNDVQAVMDGALDPFIDASLR  344



>ref|WP_038547201.1| peptide chain release factor 2 [Synechococcus sp. KORDI-100]
 gb|AII44666.1| peptide chain release factor 2 [Synechococcus sp. KORDI-100]
Length=356

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+ +VMDG LDPFI + L+
Sbjct  317  DLRTSEETNDVQAVMDGALDPFIDASLR  344



>ref|WP_028953014.1| peptide chain release factor 2 [Synechococcus sp. CC9616]
Length=356

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+ +VMDG LDPFI + L+
Sbjct  317  DLRTSEETNDVQAVMDGALDPFIDASLR  344



>ref|WP_019476940.1| peptide chain release factor 2 [Prochlorococcus sp. W7]
Length=350

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KA++ LKAKLLVIA+EQRA+EI +I+GD V+A WG QIRNYVFHPY++VK
Sbjct  257  EERSQLKNKEKAMNLLKAKLLVIAKEQRAAEISEIKGDIVEAAWGSQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYS  298
            D+RT  ET+D+ SV++G+LDPFI   L+   S
Sbjct  317  DLRTKQETNDLDSVLNGDLDPFIDKLLRLNIS  348



>ref|WP_042503956.1| peptide chain release factor 2 [Synechococcus sp. WH 8102]
Length=356

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+ +VMDG LDPFI + L+
Sbjct  317  DLRTSEETNDVQAVMDGALDPFIDASLR  344



>ref|WP_006042963.1| peptide chain release factor 2 [Synechococcus sp. WH 7805]
 gb|EAR17410.1| peptide chain release factor 2 [Synechococcus sp. WH 7805]
Length=356

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+  VMDG+L+PFI++ L+
Sbjct  317  DLRTQEETNDVQGVMDGDLEPFIQALLR  344



>sp|Q7U3W6.1|RF2_SYNPX RecName: Full=Peptide chain release factor 2; Short=RF-2 [Synechococcus 
sp. WH 8102]
 emb|CAE08826.1| peptide chain release factor RF-2 [Synechococcus sp. WH 8102]
Length=374

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  275  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  334

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+ +VMDG LDPFI + L+
Sbjct  335  DLRTSEETNDVQAVMDGALDPFIDASLR  362



>ref|WP_033374401.1| peptide chain release factor 2 [Spirulina subsalsa]
Length=337

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA EI QIRGD V+A WG QIRNYVFHPY++VK
Sbjct  244  QERSQLQNKEKAMALLKAKLLVIAQEQRAQEIAQIRGDIVEAAWGNQIRNYVFHPYQMVK  303

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+G LDPFI ++L+
Sbjct  304  DLRTTEETTAIDDVMNGALDPFIEAYLR  331



>ref|WP_044076357.1| peptide chain release factor 2 [Prochlorothrix hollandica]
Length=287

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LK++LLVIA+EQRA E+ +IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  193  QERSQLQNKEKALALLKSRLLVIAKEQRAKEVSEIRGDIVEAAWGTQIRNYVFHPYQLVK  252

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  VM+GELDPFI+++L+
Sbjct  253  DLRTQVETTAIQDVMNGELDPFIQAYLR  280



>gb|ACA98201.1| peptide chain release factor 2 [Synechococcus sp. PCC 7002]
Length=359

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL+IA+EQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  265  QERSQLQNKEKALAILKAKLLIIAQEQRAQEIAEIRGDMVEAAWGNQIRNYVFHPYQMVK  324

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT +ET+D+  VMDG+LD FI + L+
Sbjct  325  DLRTNHETTDVDGVMDGDLDAFIEASLR  352



>ref|WP_043693362.1| peptide chain release factor 2 [Synechococcus sp. KORDI-49]
 gb|AII46350.1| peptide chain release factor 2 [Synechococcus sp. KORDI-49]
Length=356

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+  VMDG LDPFI + L+
Sbjct  317  DLRTSEETNDVQGVMDGALDPFIDASLR  344



>ref|WP_009788764.1| peptide chain release factor 2 [Synechococcus sp. BL107]
 gb|EAU71403.1| peptide chain release factor 2 [Synechococcus sp. BL107]
Length=356

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+ +VMDG LDPFI + L+
Sbjct  317  DLRTQEETNDVQAVMDGALDPFIDASLR  344



>ref|WP_011360865.1| peptide chain release factor 2 [Synechococcus sp. CC9902]
 gb|ABB27082.1| bacterial peptide chain release factor 2 (bRF-2) [Synechococcus 
sp. CC9902]
Length=356

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+ +VMDG LDPFI + L+
Sbjct  317  DLRTQEETNDVQAVMDGALDPFIDASLR  344



>ref|WP_025970098.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498G3]
Length=162

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA+  LK+KLLVIA+EQRA+E+  I+GD V+A WG QIRNYVFHPY++VK
Sbjct  65   QERSQLQNKEKAMLLLKSKLLVIAKEQRAAEVADIKGDIVEAAWGNQIRNYVFHPYQMVK  124

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            D+RT  ET+++ SV+DG+L+PFI   L+   S + S
Sbjct  125  DLRTMQETNELDSVLDGDLEPFIHELLRMNISSNES  160



>ref|WP_010474139.1| peptide chain release factor 2 [Acaryochloris sp. CCMEE 5410]
Length=304

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQ+A EI  IRGDAV+A WG QIRNYVFHPY++VK
Sbjct  210  QERSQLQNKEKAMALLKAKLLVIAQEQKAKEIADIRGDAVEAAWGNQIRNYVFHPYQMVK  269

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I SVMDG LD FI ++L+
Sbjct  270  DLRTNQETTAIESVMDGALDNFIEAYLR  297



>ref|WP_012164078.1| peptide chain release factor 2 [Acaryochloris marina]
 gb|ABW28698.1| peptide chain release factor 2 [Acaryochloris marina MBIC11017]
Length=304

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLLVIA+EQ+A EI  IRGDAV+A WG QIRNYVFHPY++VK
Sbjct  210  QERSQLQNKEKAMALLKAKLLVIAQEQKAKEIADIRGDAVEAAWGNQIRNYVFHPYQMVK  269

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I SVMDG LD FI ++L+
Sbjct  270  DLRTNQETTAIESVMDGALDNFIEAYLR  297



>ref|WP_017741315.1| peptide chain release factor 2 [Scytonema hofmanni]
Length=290

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL+RLKAKLLVIA+ Q A EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  EERSQLQNKEKALARLKAKLLVIAQAQHAKEIAEIRGDMVEASWGNQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ I  +M+GE+D FI+++L+
Sbjct  254  DLRTNEETTAIADIMNGEIDSFIQAYLR  281



>ref|WP_039755868.1| MULTISPECIES: peptide chain release factor 2 [Synechococcus]
Length=291

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL  LKAKLLV+ +EQ+A E+ +IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  193  EERSQLQNKEKALVILKAKLLVVLQEQKAKEVAEIRGDMVEAAWGNQIRNYVFHPYQLVK  252

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RTG ET  I  VM+G+L+PFI+++L+    M + +
Sbjct  253  DLRTGVETKAIADVMNGDLNPFIQAYLRQDNQMLIET  289



>gb|AFW81292.1| hypothetical protein ZEAMMB73_079544 [Zea mays]
Length=377

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 72/85 (85%), Gaps = 6/85 (7%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  252  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  311

Query  393  DVRTGYETSDITSVMDGELDPFIRS  319
            DVRTG      ++++  E D F R+
Sbjct  312  DVRTG------SNLLVAEDDAFNRN  330



>ref|WP_017293282.1| peptide chain release factor 2 [Geminocystis herdmanii]
Length=329

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+RLKAKLLV+AEEQRA EI +IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  238  QERSQLQNKEKALARLKAKLLVVAEEQRAKEIAEIRGDIVEAGWGTQIRNYVFHPYQLVK  297

Query  393  DVRTGYETSDITSVMDGELDPFIRSFL  313
            D+RT  ET+ +  V+DGEL+ F+ ++L
Sbjct  298  DLRTNVETTAVNDVLDGELNNFVEAYL  324



>ref|WP_009631870.1| peptide chain release factor 2 [Synechocystis sp. PCC 7509]
Length=361

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL+IAEEQRA EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  266  QERSQLQNKEKALAILKAKLLIIAEEQRAQEIAEIRGDIVEAAWGNQIRNYVFHPYQMVK  325

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ +T VM+GE+D FI+++L+
Sbjct  326  DLRTNVETTAVTDVMNGEIDLFIQAYLR  353



>gb|ABB56436.1| bacterial peptide chain release factor 2 (bRF-2) [Synechococcus 
elongatus PCC 7942]
 gb|AJD56518.1| peptide chain release factor 2 [Synechococcus sp. UTEX 2973]
Length=304

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL  LKAKLLV+ +EQ+A E+ +IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  206  EERSQLQNKEKALVILKAKLLVVLQEQKAKEVAEIRGDMVEAAWGNQIRNYVFHPYQLVK  265

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RTG ET  I  VM+G+L+PFI+++L+    M + +
Sbjct  266  DLRTGVETKAIADVMNGDLNPFIQAYLRQDNQMLIET  302



>ref|WP_041237479.1| peptide chain release factor 2 [Cyanothece sp. PCC 7425]
Length=305

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL+IA+EQ+A EI  IRGDAV+A WG QIRNYVF PYKLVK
Sbjct  210  QERSQLQNKEKALAILKAKLLIIAQEQKAQEIADIRGDAVEAAWGTQIRNYVFDPYKLVK  269

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            DVRTG ET  I  VM+GELD FI+++L+
Sbjct  270  DVRTGVETQAIEVVMNGELDEFIQAYLR  297



>gb|AIE74280.1| Peptide chain release factor 2; programmed frameshift-containing 
[Synechocystis sp. PCC 6714]
Length=312

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL++ EEQRA  I +IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  218  QERSQLQNKEKALAILKAKLLIVLEEQRAQAIAEIRGDMVEAAWGTQIRNYVFHPYQLVK  277

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKY  307
            D+RT  ET+D++ VMDGEL  FI ++L++
Sbjct  278  DLRTNLETTDVSGVMDGELSDFIEAYLRH  306



>ref|WP_038027728.1| peptide chain release factor 2 [Synechococcus sp. NKBG15041c]
Length=291

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL+IA+EQR  EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  195  QERSQLQNKEKALAILKAKLLIIAQEQRTKEIAEIRGDMVEAAWGNQIRNYVFHPYQMVK  254

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT +ET+DI  VMDG+L+ FI + L+
Sbjct  255  DLRTNHETTDIAGVMDGDLEAFIEASLR  282



>ref|WP_010873201.1| peptide chain release factor 2 [Synechocystis sp. PCC 6803]
 ref|NP_441899.1| peptide chain release factor 2 [Synechocystis sp. PCC 6803]
 dbj|BAA18577.1| peptide chain release factor [Synechocystis sp. PCC 6803]
 gb|AGF52265.1| peptide chain release factor [Synechocystis sp. PCC 6803]
Length=288

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL++ EEQRA  I +IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  194  QERSQLQNKEKALAILKAKLLIVLEEQRAQAIAEIRGDMVEAAWGTQIRNYVFHPYQLVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKY  307
            D+RT  ET+D+  VMDGEL  FI ++L++
Sbjct  254  DLRTNVETTDVGGVMDGELSDFIEAYLRH  282



>ref|WP_041677104.1| peptide chain release factor 2 [Synechococcus elongatus]
Length=291

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL  L+AKLLV+ +EQ+A E+ +IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  193  EERSQLQNKEKALVILRAKLLVVLQEQKAKEVAEIRGDMVEAAWGNQIRNYVFHPYQLVK  252

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RTG ET  I  VM+G+L+PFI+++L+    M + +
Sbjct  253  DLRTGVETKAIADVMNGDLNPFIQAYLRQDNQMLIET  289



>ref|WP_011124360.1| MULTISPECIES: peptide chain release factor 2 [Prochlorococcus]
 ref|NP_874599.1| Protein chain release factor B [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|AAP99251.1| Protein chain release factor B [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|KGG11480.1| Peptide chain release factor 2 [Prochlorococcus marinus str. 
LG]
 gb|KGG18566.1| Peptide chain release factor 2 [Prochlorococcus marinus str. 
SS2]
 gb|KGG22839.1| Peptide chain release factor 2 [Prochlorococcus marinus str. 
SS35]
 gb|KGG32715.1| Peptide chain release factor 2 [Prochlorococcus marinus str. 
SS51]
 gb|KGG37103.1| Peptide chain release factor 2 [Prochlorococcus sp. SS52]
Length=356

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKL++IA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLMIIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFL  313
            D+R+G E++D+ SVM+G+LD FI+S L
Sbjct  317  DLRSGTESNDVESVMNGDLDLFIQSLL  343



>ref|WP_041430218.1| peptide chain release factor 2 [Synechococcus sp. PCC 7502]
Length=303

 Score =   124 bits (312),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK   L  LKAKLL+IA+EQRA EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  210  QERSQLQNKTIGLQLLKAKLLIIAKEQRAKEISDIRGDIVEAAWGNQIRNYVFHPYQMVK  269

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            D+RTG ET++I  VM+GE+D FI+ +L+ +  +S
Sbjct  270  DLRTGLETTNIQDVMNGEIDFFIQGYLRQQNQLS  303



>ref|WP_038530504.1| peptide chain release factor 2 [Synechocystis sp. PCC 6714]
Length=348

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL++ EEQRA  I +IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  254  QERSQLQNKEKALAILKAKLLIVLEEQRAQAIAEIRGDMVEAAWGTQIRNYVFHPYQLVK  313

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKY  307
            D+RT  ET+D++ VMDGEL  FI ++L++
Sbjct  314  DLRTNLETTDVSGVMDGELSDFIEAYLRH  342



>dbj|BAD79302.1| peptide chain release factor RF-2 [Synechococcus elongatus PCC 
6301]
Length=304

 Score =   124 bits (312),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KAL  L+AKLLV+ +EQ+A E+ +IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  206  EERSQLQNKEKALVILRAKLLVVLQEQKAKEVAEIRGDMVEAAWGNQIRNYVFHPYQLVK  265

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RTG ET  I  VM+G+L+PFI+++L+    M + +
Sbjct  266  DLRTGVETKAIADVMNGDLNPFIQAYLRQDNQMLIET  302



>gb|ACL47458.1| peptide chain release factor 2 [Cyanothece sp. PCC 7425]
Length=361

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL+IA+EQ+A EI  IRGDAV+A WG QIRNYVF PYKLVK
Sbjct  266  QERSQLQNKEKALAILKAKLLIIAQEQKAQEIADIRGDAVEAAWGTQIRNYVFDPYKLVK  325

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            DVRTG ET  I  VM+GELD FI+++L+
Sbjct  326  DVRTGVETQAIEVVMNGELDEFIQAYLR  353



>ref|WP_041699372.1| peptide chain release factor 2 [Pseudanabaena sp. PCC 7367]
Length=303

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL N+ +A+  LKAKL+VIA+EQRA EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  210  QERSQLQNRDRAMQLLKAKLMVIAQEQRAQEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  269

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RTG ET++I  VMDG+LD FI+ +L+
Sbjct  270  DLRTGTETTNIQDVMDGDLDLFIQDYLR  297



>ref|WP_026032519.1| peptide chain release factor 2 [Prochlorococcus sp. W8]
Length=350

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QL NK KA++ LKAKLL+IA+EQRA++I  I+GD V+A WG QIRNYVFHPY++VK
Sbjct  257  EERSQLKNKEKAMNLLKAKLLIIAKEQRAAKIADIKGDIVEAAWGTQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYS  298
            D+RT  ET+D+ SV++G+LDPFI   L+   S
Sbjct  317  DLRTKQETNDLDSVLNGDLDPFINKLLRLNIS  348



>gb|KDR55030.1| peptide chain release factor 2 [Arthrospira platensis str. Paraca]
Length=309

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL N+ KA++ LKAKLLV+A+EQRA  I +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  211  QERSQLQNREKAMALLKAKLLVVAQEQRAQAIAEIRGDLVEAAWGNQIRNYVFHPYQMVK  270

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RTG ET+ I  VM+GELD FI+++L+
Sbjct  271  DLRTGEETTAINDVMNGELDGFIQAYLR  298



>ref|WP_014407126.1| peptide chain release factor 2 [Synechocystis sp. PCC 6803]
 dbj|BAK50754.1| peptide chain release factor [Synechocystis sp. PCC 6803]
 dbj|BAL29752.1| peptide chain release factor [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL32921.1| peptide chain release factor [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL36090.1| peptide chain release factor [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM54691.1| peptide chain release factor 2 [Synechocystis sp. PCC 6803]
Length=335

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL++ EEQRA  I +IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  241  QERSQLQNKEKALAILKAKLLIVLEEQRAQAIAEIRGDMVEAAWGTQIRNYVFHPYQLVK  300

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKY  307
            D+RT  ET+D+  VMDGEL  FI ++L++
Sbjct  301  DLRTNVETTDVGGVMDGELSDFIEAYLRH  329



>dbj|BAI91190.1| peptide chain release factor 2 [Arthrospira platensis NIES-39]
Length=316

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL N+ KA++ LKAKLLV+A+EQRA  I +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  218  QERSQLQNREKAMALLKAKLLVVAQEQRAQAIAEIRGDLVEAAWGNQIRNYVFHPYQMVK  277

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RTG ET+ I  VM+GELD FI+++L+
Sbjct  278  DLRTGEETTAINDVMNGELDGFIQAYLR  305



>ref|WP_036901568.1| peptide chain release factor 2 [Prochlorococcus sp. MIT 0601]
 gb|KGG13192.1| Peptide chain release factor 2 [Prochlorococcus sp. MIT 0601]
Length=356

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKL+V+A+EQRASEI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKDKALTLLKAKLMVVAQEQRASEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFL  313
            D+RT  E++DI  VM+G +D FI+S L
Sbjct  317  DLRTAKESTDIEGVMNGNIDSFIQSLL  343



>ref|WP_041235354.1| peptide chain release factor 2 [Dactylococcopsis salina]
Length=309

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL N+ KA++ LK+KL+VIA+EQRA +I +IRGDAV+A WG QIRNYVFHPY++VK
Sbjct  219  QERSQLQNREKAIALLKSKLIVIAQEQRAQKIAEIRGDAVEAAWGNQIRNYVFHPYQMVK  278

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYK  304
            D+RT  ETS +  V+DGE++PF+ ++L+ K
Sbjct  279  DLRTNVETSAVEDVLDGEINPFVEAYLRSK  308



>ref|WP_041430920.1| peptide chain release factor 2 [Synechococcus sp. PCC 6312]
Length=286

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKLL+IA+EQ+A EI  IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  193  QERSQLQNKEKAMAILKAKLLIIAQEQKAKEIADIRGDMVEAAWGNQIRNYVFHPYQLVK  252

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ IT VM+GEL+ FI+++L+
Sbjct  253  DLRTNLETTAITDVMNGELENFIQAYLR  280



>ref|WP_011823039.1| peptide chain release factor 2 [Prochlorococcus marinus]
 gb|ABM74820.1| peptide chain release factor RF-2 [Prochlorococcus marinus str. 
NATL1A]
Length=313

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LK+KL+VIA EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  220  QERSQLQNKDKAMALLKSKLMVIALEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  279

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+ SVM+GE+D FI+S L+
Sbjct  280  DLRTEQETTDVDSVMNGEIDIFIQSLLR  307



>ref|WP_006626197.1| MULTISPECIES: peptide chain release factor 2 [Arthrospira]
 gb|EDZ92490.1| peptide chain release factor 2 [Arthrospira maxima CS-328]
 emb|CCE19145.1| Peptide chain release factor 2 (RF-2) [Arthrospira sp. PCC 8005]
 gb|EKD05827.1| peptide chain release factor 2 [Arthrospira platensis C1]
Length=339

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL N+ KA++ LKAKLLV+A+EQRA  I +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  241  QERSQLQNREKAMALLKAKLLVVAQEQRAQAIAEIRGDLVEAAWGNQIRNYVFHPYQMVK  300

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RTG ET+ I  VM+GELD FI+++L+
Sbjct  301  DLRTGEETTAINDVMNGELDGFIQAYLR  328



>ref|WP_038650950.1| peptide chain release factor 2 [Prochlorococcus sp. MIT 0801]
 gb|AIQ96362.1| Peptide chain release factor 1 [Prochlorococcus sp. MIT 0801]
Length=313

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LK+KL+VIA EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  220  QERSQLQNKDKAMALLKSKLMVIALEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  279

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+ SVM+GE+D FI+S L+
Sbjct  280  DLRTEQETTDVDSVMNGEIDIFIQSLLR  307



>sp|P74476.2|RF2_SYNY3 RecName: Full=Peptide chain release factor 2; Short=RF-2 [Synechocystis 
sp. PCC 6803 substr. Kazusa]
Length=372

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLL++ EEQRA  I +IRGD V+A WG QIRNYVFHPY+LVK
Sbjct  278  QERSQLQNKEKALAILKAKLLIVLEEQRAQAIAEIRGDMVEAAWGTQIRNYVFHPYQLVK  337

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKY  307
            D+RT  ET+D+  VMDGEL  FI ++L++
Sbjct  338  DLRTNVETTDVGGVMDGELSDFIEAYLRH  366



>ref|WP_035737831.1| peptide chain release factor 2 [Arthrospira platensis]
Length=352

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL N+ KA++ LKAKLLV+A+EQRA  I +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  254  QERSQLQNREKAMALLKAKLLVVAQEQRAQAIAEIRGDLVEAAWGNQIRNYVFHPYQMVK  313

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RTG ET+ I  VM+GELD FI+++L+
Sbjct  314  DLRTGEETTAINDVMNGELDGFIQAYLR  341



>ref|WP_036904659.1| peptide chain release factor 2 [Prochlorococcus marinus]
 gb|KGG21666.1| Peptide chain release factor 1 [Prochlorococcus marinus str. 
PAC1]
Length=313

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LK+KL+VIA EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  220  QERSQLQNKDKAMALLKSKLMVIALEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  279

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+ SVM+GE+D FI+S L+
Sbjct  280  DLRTEQETTDVDSVMNGEIDIFIQSLLR  307



>ref|XP_003079791.1| putative translation releasing factor2 (ISS) [Ostreococcus tauri]
 emb|CAL53437.1| Peptide chain release factor [Ostreococcus tauri]
Length=419

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            E RTQ  N+  A+ R+KAKL  +AEE R ++I ++RGD VKAEWGQQIRNYV HPYK+VK
Sbjct  323  EHRTQALNRQAAMLRIKAKLTALAEEARVADIAELRGDIVKAEWGQQIRNYVLHPYKMVK  382

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            DVRTG ETSD+T V++G LD ++  +L++K S + S
Sbjct  383  DVRTGVETSDVTRVLNGGLDEYMNGYLRWKASKNES  418



>ref|WP_036946388.1| peptide chain release factor 2 [Pseudanabaena sp. PCC 6802]
Length=287

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA+  LKAKLL+IA+EQ A +I  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  194  QERSQLQNKEKAMQLLKAKLLIIAQEQHAQKIADIRGDIVEAAWGNQIRNYVFHPYQMVK  253

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET++I  VM+GEL+PFI+++L+
Sbjct  254  DLRTNIETANIQDVMNGELEPFIQAYLR  281



>ref|WP_025956439.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498L10]
Length=132

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA+  LK+KLLVIA+EQRA+E+  I+GD V+A WG QIRNYVFHPY++VK
Sbjct  35   QERSQLQNKEKAMLLLKSKLLVIAKEQRAAEVADIKGDIVEAAWGNQIRNYVFHPYQMVK  94

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            D+RT  ET+ + SV+DG+ +PFI   L+   S + S
Sbjct  95   DLRTMQETNALDSVLDGDPEPFIHELLRMNISSNES  130



>ref|YP_002048991.1| peptide chain release factor 2 [Paulinella chromatophora]
 gb|ACB42781.1| peptide chain release factor 2 [Paulinella chromatophora]
Length=354

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKL+VIA+EQRA+EI  IRG+ V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMALLKAKLMVIAQEQRAAEIADIRGEIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+  VMDG+LD FI++ L+
Sbjct  317  DLRTNKETTDVQGVMDGDLDLFIQALLR  344



>gb|ELR96896.1| peptide chain release factor 2 [Gloeocapsa sp. PCC 73106]
Length=302

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKL++IA+EQRA  I QIRGD V+A WG QIRNYVFHPY++VK
Sbjct  211  QERSQLQNKEKALTLLKAKLMIIAQEQRAQAIAQIRGDMVEAAWGNQIRNYVFHPYQMVK  270

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ +  V+DGE+D FI ++L+
Sbjct  271  DLRTNVETTAVEDVLDGEIDQFIEAYLQ  298



>gb|AFZ49839.1| peptide chain release factor 2 [Dactylococcopsis salina PCC 8305]
Length=367

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL N+ KA++ LK+KL+VIA+EQRA +I +IRGDAV+A WG QIRNYVFHPY++VK
Sbjct  277  QERSQLQNREKAIALLKSKLIVIAQEQRAQKIAEIRGDAVEAAWGNQIRNYVFHPYQMVK  336

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYK  304
            D+RT  ETS +  V+DGE++PF+ ++L+ K
Sbjct  337  DLRTNVETSAVEDVLDGEINPFVEAYLRSK  366



>ref|WP_029979375.1| peptide chain release factor 2, partial [Prochlorococcus sp. 
scB243_495N3]
Length=272

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA+  LK+KLLVIA+EQRA+E+  I+GD V+A WG QIRNYVFHPY++VK
Sbjct  175  QERSQLQNKEKAMLLLKSKLLVIAKEQRAAEVADIKGDIVEAAWGNQIRNYVFHPYQMVK  234

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            D+RT  ET+++ SV+DG LDPFI   L+   S + S
Sbjct  235  DLRTMQETNELDSVLDGGLDPFIHELLRLNISSNES  270



>ref|WP_029960129.1| peptide chain release factor 2 [Prochlorococcus sp. scB241_528J8]
Length=354

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA+  LK+KLLVIA+EQRA+E+  I+GD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMLLLKSKLLVIAKEQRAAEVADIKGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            D+RT +ET+D+ SV+DG L+PFI   L+   S + S
Sbjct  317  DLRTMHETNDLDSVLDGGLEPFIHELLRMNISSNES  352



>ref|WP_029979862.1| peptide chain release factor 2, partial [Prochlorococcus sp. 
scB245a_520D2]
Length=257

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA+  LK+KLLVIA+EQRA+E+  I+GD V+A WG QIRNYVFHPY++VK
Sbjct  162  QERSQLQNKEKAMLLLKSKLLVIAKEQRAAEVADIKGDIVEAAWGNQIRNYVFHPYQMVK  221

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            D+RT  ET+++ SV+DG+L+PFI   L+   S + S
Sbjct  222  DLRTMQETNELDSVLDGDLEPFIHELLRMNISSNES  257



>tpg|DAA36556.1| TPA: hypothetical protein ZEAMMB73_481691 [Zea mays]
Length=983

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 72/85 (85%), Gaps = 6/85 (7%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            EER+QLANKIKALSRLKAKLLVIA EQRASEIKQIRGD VKAEWGQQIRNYVFHPYKLVK
Sbjct  858  EERSQLANKIKALSRLKAKLLVIALEQRASEIKQIRGDIVKAEWGQQIRNYVFHPYKLVK  917

Query  393  DVRTGYETSDITSVMDGELDPFIRS  319
            DVRTG      ++++  E D F R+
Sbjct  918  DVRTG------SNLLVAEDDAFNRN  936



>ref|WP_025965215.1| peptide chain release factor 2, partial [Prochlorococcus sp. 
scB243_496M6]
Length=271

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA+  LK+KLLVIA+EQRA+E+  I+GD V+A WG QIRNYVFHPY++VK
Sbjct  174  QERSQLQNKEKAMLLLKSKLLVIAKEQRAAEVADIKGDIVEAAWGNQIRNYVFHPYQMVK  233

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            D+RT  ET+++ SV+DG LDPFI   L+   S + S
Sbjct  234  DLRTMKETNELDSVLDGGLDPFIHELLRMNISSNES  269



>gb|AFZ47489.1| bacterial peptide chain release factor 2 (bRF-2) [Cyanobacterium 
stanieri PCC 7202]
Length=368

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLLVIA+EQ+  EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  277  QERSQLQNKEKALAILKAKLLVIAQEQKIQEIAEIRGDIVEAAWGMQIRNYVFHPYQMVK  336

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYS  298
            D+RT  ET+ I +VMDG+LD FI ++LK   S
Sbjct  337  DLRTNVETNAIDNVMDGDLDAFIEAYLKIPES  368



>ref|WP_041234579.1| peptide chain release factor 2 [Cyanobacterium stanieri]
Length=346

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKLLVIA+EQ+  EI +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  255  QERSQLQNKEKALAILKAKLLVIAQEQKIQEIAEIRGDIVEAAWGMQIRNYVFHPYQMVK  314

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYS  298
            D+RT  ET+ I +VMDG+LD FI ++LK   S
Sbjct  315  DLRTNVETNAIDNVMDGDLDAFIEAYLKIPES  346



>ref|WP_041550043.1| peptide chain release factor 2 [Chamaesiphon minutus]
Length=286

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL  LKAKLL+IA+EQ+  EI +IRGD V+A WGQQIRNYVFHPY++VK
Sbjct  191  QERSQLQNKEKALVILKAKLLIIAQEQKTKEIAEIRGDMVEAAWGQQIRNYVFHPYQMVK  250

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSM  295
            D+RT  ET+ +  VM+GE+D FI ++L+ +  M
Sbjct  251  DLRTSVETTAVGDVMNGEIDEFIEAYLRQENMM  283



>ref|WP_034937480.1| peptide chain release factor 2 [Gloeocapsa sp. PCC 73106]
Length=335

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KAL+ LKAKL++IA+EQRA  I QIRGD V+A WG QIRNYVFHPY++VK
Sbjct  244  QERSQLQNKEKALTLLKAKLMIIAQEQRAQAIAQIRGDMVEAAWGNQIRNYVFHPYQMVK  303

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+ +  V+DGE+D FI ++L+
Sbjct  304  DLRTNVETTAVEDVLDGEIDQFIEAYLQ  331



>gb|AHF64859.1| peptide chain release factor 2 [Synechococcus sp. WH 8109]
Length=356

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ L AKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVF PY++VK
Sbjct  257  QERSQLQNKEKAMALLMAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFQPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+ +VMDG LDPFI + L+
Sbjct  317  DLRTNEETNDVQAVMDGALDPFIDACLR  344



>ref|WP_036031067.1| peptide chain release factor 2 [Leptolyngbya sp. PCC 6406]
Length=355

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL N+ KA++ L A+L+VIA+EQ+A  I +IRGD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNREKAMALLTARLMVIAQEQKAQAIAEIRGDMVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMS  292
            D+RT  ET+ I +VMDGEL+PFI+++L+    M+
Sbjct  317  DLRTNEETTAIDTVMDGELEPFIQAYLRQGTQMA  350



>ref|WP_011294181.1| peptide chain release factor 2 [Prochlorococcus marinus]
 gb|AAZ59036.1| bacterial peptide chain release factor 2 (bRF-2) [Prochlorococcus 
marinus str. NATL2A]
Length=313

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LK+KL+VIA EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  220  QERSQLQNKDKAMALLKSKLMVIAVEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVK  279

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+ SVM+G++D FI+S L+
Sbjct  280  DLRTEQETTDVDSVMNGKIDIFIQSLLR  307



>ref|WP_029976895.1| peptide chain release factor 2 [Prochlorococcus sp. scB245a_520K10]
Length=354

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA+  LK+KLLVIA+EQRA+E+  I+GD V+A WG QIRNYVFHPY++VK
Sbjct  257  QERSQLQNKEKAMLLLKSKLLVIAKEQRAAEVADIKGDIVEAAWGNQIRNYVFHPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMSS  283
            D+RT  ET+D+ SV+DG L+PFI   L+   S + S+
Sbjct  317  DLRTMKETNDLDSVLDGGLEPFIHELLRMNISSNESN  353



>ref|WP_025782220.1| peptide chain release factor 2 [Candidatus Synechococcus spongiarum]
Length=354

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL N+ +A++ LKAKLLVIA+EQRA+EI  IRGD V A WG QIRNYV HPY+LVK
Sbjct  257  QERSQLQNRERAMALLKAKLLVIAQEQRAAEIADIRGDMVAAAWGNQIRNYVLHPYQLVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFL  313
            D+RT  ET+D+ +VM+GELD FI++ L
Sbjct  317  DLRTNAETTDVQAVMNGELDAFIQASL  343



>ref|WP_011365370.1| peptide chain release factor 2 [Synechococcus sp. CC9605]
 gb|ABB36174.1| peptide chain release factor 2 [Synechococcus sp. CC9605]
Length=356

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ L AKLLVIA+EQRA+EI  IRGD V+A WG QIRNYVF PY++VK
Sbjct  257  QERSQLQNKEKAMALLMAKLLVIAQEQRAAEIADIRGDIVEAAWGNQIRNYVFQPYQMVK  316

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLK  310
            D+RT  ET+D+ +VMDG LDPFI + L+
Sbjct  317  DLRTNEETNDVQAVMDGALDPFIDASLR  344



>gb|KGG16757.1| Peptide chain release factor 2 [Prochlorococcus sp. MIT 0602]
Length=321

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKL++IA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  220  QERSQLQNKEKAMALLKAKLMIIAQEQRAAEIADIRGDMVEAAWGNQIRNYVFHPYQMVK  279

Query  393  DVRTGYETSDITSVMDGELDPFIRSFL  313
            D+RT  E++D+  VM+G+LD FI+S L
Sbjct  280  DLRTHKESTDVEGVMNGDLDFFIQSLL  306



>gb|KGG18269.1| Peptide chain release factor 2 [Prochlorococcus sp. MIT 0603]
Length=318

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA++ LKAKL++IA+EQRA+EI  IRGD V+A WG QIRNYVFHPY++VK
Sbjct  217  QERSQLQNKEKAMALLKAKLMIIAQEQRAAEIADIRGDMVEAAWGNQIRNYVFHPYQMVK  276

Query  393  DVRTGYETSDITSVMDGELDPFIRSFL  313
            D+RT  E++D+  VM+G+LD FI+S L
Sbjct  277  DLRTHKESTDVEGVMNGDLDFFIQSLL  303



>ref|WP_029948385.1| peptide chain release factor 2, partial [Prochlorococcus sp. 
scB241_527L15]
Length=303

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  573  EERTQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVK  394
            +ER+QL NK KA+  LK+KLLVIA+EQRA+E+  I+GD V+A WG QIRNYVFHPY++VK
Sbjct  206  QERSQLQNKEKAMLLLKSKLLVIAKEQRAAEVADIKGDIVEAAWGNQIRNYVFHPYQMVK  265

Query  393  DVRTGYETSDITSVMDGELDPFIRSFLKYKYSMSMS  286
            D+RT  ET+++ SV+DG+L+PFI   L+   S + S
Sbjct  266  DLRTMQETNELDSVLDGDLEPFIHELLRMNISSNES  301



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750