BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF048L23

Length=259
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57279.1|  alpha-expansin                                         166   1e-48   Ipomoea nil [qian niu]
ref|XP_004249634.1|  PREDICTED: expansin-A3                             138   7e-38   
gb|ADD14635.1|  expansin precursor                                      135   3e-37   Solanum tuberosum [potatoes]
ref|XP_006349505.1|  PREDICTED: expansin-A3-like                        136   4e-37   Solanum tuberosum [potatoes]
gb|ADC35365.1|  alpha-expansin 2                                        135   5e-37   Coffea arabica [arabica coffee]
emb|CDP00110.1|  unnamed protein product                                135   6e-37   Coffea canephora [robusta coffee]
ref|XP_009761115.1|  PREDICTED: expansin-A6-like                        135   6e-37   Nicotiana sylvestris
ref|XP_006366490.1|  PREDICTED: expansin-A6                             135   7e-37   Solanum tuberosum [potatoes]
ref|NP_001234881.1|  expansin9 precursor                                135   1e-36   Solanum lycopersicum
gb|AAC96082.1|  alpha-expansin precursor                                132   1e-36   Nicotiana tabacum [American tobacco]
ref|XP_009613959.1|  PREDICTED: expansin-A6-like                        134   2e-36   Nicotiana tomentosiformis
gb|AAR82849.1|  expansin-1                                              134   3e-36   Petunia x hybrida [garden petunia]
gb|AEQ55290.1|  expansin                                                133   6e-36   Breonia chinensis
gb|AEQ55275.1|  expansin                                                133   6e-36   Breonia chinensis
ref|XP_008343537.1|  PREDICTED: expansin-A4-like                        132   8e-36   Malus domestica [apple tree]
ref|XP_009343581.1|  PREDICTED: expansin-A4-like                        132   9e-36   Pyrus x bretschneideri [bai li]
ref|XP_009597793.1|  PREDICTED: expansin-A6-like                        132   1e-35   Nicotiana tomentosiformis
gb|ABK92484.1|  unknown                                                 128   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006488339.1|  PREDICTED: expansin-A4-like                        132   1e-35   Citrus sinensis [apfelsine]
ref|XP_009788740.1|  PREDICTED: expansin-A3-like                        132   1e-35   Nicotiana sylvestris
ref|XP_002298353.1|  alpha-expansin 1 family protein                    132   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006424843.1|  hypothetical protein CICLE_v10029094mg             132   2e-35   Citrus clementina [clementine]
gb|AEQ55274.1|  expansin                                                131   2e-35   Breonia chinensis
dbj|BAD00017.1|  expansin                                               130   2e-35   Malus domestica [apple tree]
gb|AAF35900.1|AF230331_1  expansin 1                                    129   3e-35   Zinnia elegans [garden zinnia]
ref|XP_008784594.1|  PREDICTED: expansin-A4-like                        131   3e-35   Phoenix dactylifera
ref|XP_007205740.1|  hypothetical protein PRUPE_ppa010180mg             131   3e-35   Prunus persica
ref|XP_010111457.1|  hypothetical protein L484_021280                   131   3e-35   Morus notabilis
ref|XP_008777004.1|  PREDICTED: expansin-A4-like                        131   4e-35   Phoenix dactylifera
ref|XP_008223717.1|  PREDICTED: expansin-A4                             130   4e-35   Prunus mume [ume]
gb|AEU08407.1|  expansin 2                                              130   5e-35   Prunus salicina [Japanese plum]
gb|ACN94264.1|  expansin                                                130   5e-35   Rehmannia glutinosa [Chinese foxglove]
gb|ACJ48968.2|  expansin                                                130   5e-35   Breonia chinensis
gb|AAM22624.1|AF428177_1  expansin 10 precursor                         130   5e-35   Rumex palustris
gb|AAM22625.1|AF428178_1  expansin 11 precursor                         130   6e-35   Rumex palustris
ref|XP_002313434.1|  alpha-expansin 1 family protein                    130   6e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011042710.1|  PREDICTED: expansin-A4-like                        130   6e-35   Populus euphratica
gb|AAM22626.1|AF428179_1  expansin 12 precursor                         130   7e-35   Rumex palustris
gb|KHN41101.1|  Expansin-A4                                             126   7e-35   Glycine soja [wild soybean]
gb|AAK48848.1|AF350939_1  expansin                                      130   7e-35   Prunus cerasus [pie cherry]
dbj|BAN09210.1|  alpha expansin                                         130   7e-35   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_011035307.1|  PREDICTED: expansin-A6                             130   7e-35   Populus euphratica
ref|XP_002533097.1|  Alpha-expansin 4 precursor, putative               130   8e-35   Ricinus communis
ref|XP_002266625.1|  PREDICTED: expansin-A6                             130   8e-35   Vitis vinifera
gb|KDP44940.1|  hypothetical protein JCGZ_01440                         130   1e-34   Jatropha curcas
gb|KCW88943.1|  hypothetical protein EUGRSUZ_A012692                    125   1e-34   Eucalyptus grandis [rose gum]
ref|XP_007218834.1|  hypothetical protein PRUPE_ppa010198mg             129   1e-34   Prunus persica
emb|CDP09064.1|  unnamed protein product                                129   1e-34   Coffea canephora [robusta coffee]
ref|XP_008802710.1|  PREDICTED: expansin-A4                             129   1e-34   Phoenix dactylifera
ref|XP_011089478.1|  PREDICTED: expansin-A6                             129   1e-34   Sesamum indicum [beniseed]
ref|XP_004171474.1|  PREDICTED: expansin-A4-like                        125   1e-34   
ref|XP_008233635.1|  PREDICTED: expansin-A4-like                        129   1e-34   Prunus mume [ume]
gb|ACK36943.1|  expansin                                                129   1e-34   Annona cherimola [cherimoya]
gb|ABB90846.1|  expansin 5                                              125   1e-34   Cucumis sativus [cucumbers]
gb|ADD14631.1|  expansin precursor                                      128   1e-34   Solanum tuberosum [potatoes]
gb|AAX38235.1|  expansin 10                                             125   1e-34   Cucumis sativus [cucumbers]
ref|XP_010264435.1|  PREDICTED: expansin-A4                             129   2e-34   Nelumbo nucifera [Indian lotus]
gb|KDP35637.1|  hypothetical protein JCGZ_09075                         129   2e-34   Jatropha curcas
ref|XP_011031225.1|  PREDICTED: expansin-A4-like                        129   2e-34   Populus euphratica
gb|AAR10411.2|  EXP1                                                    128   2e-34   Actinidia deliciosa [Chinese gooseberry]
gb|AAR09168.1|  alpha-expansin 1                                        129   2e-34   Populus tremula x Populus tremuloides
gb|AAY59532.1|  expansin                                                129   2e-34   Gossypium hirsutum [American cotton]
gb|KHF98169.1|  Expansin-A4 -like protein                               127   2e-34   Gossypium arboreum [tree cotton]
ref|NP_181300.1|  expansin-A3                                           129   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002312101.1|  alpha-expansin 9 precursor family protein          129   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_004300427.1|  PREDICTED: expansin-A6                             129   2e-34   Fragaria vesca subsp. vesca
ref|XP_006341021.1|  PREDICTED: expansin-A3                             129   2e-34   Solanum tuberosum [potatoes]
gb|AFZ78606.1|  expansin protein                                        129   2e-34   Populus tomentosa [Chinese white poplar]
ref|XP_011077214.1|  PREDICTED: expansin-A6-like                        129   2e-34   Sesamum indicum [beniseed]
ref|NP_001234081.1|  expansin A4 precursor                              129   2e-34   Solanum lycopersicum
gb|ADD14630.1|  expansin precursor                                      127   2e-34   Solanum tuberosum [potatoes]
ref|XP_006435550.1|  hypothetical protein CICLE_v10032484mg             129   2e-34   Citrus clementina [clementine]
gb|ACB72461.1|  expansin 2                                              127   2e-34   Ipomoea batatas [batate]
dbj|BAH36867.1|  alpha expansin                                         125   3e-34   Torenia fournieri [bluewings]
ref|XP_002283530.1|  PREDICTED: expansin-A4                             128   3e-34   Vitis vinifera
ref|XP_003519349.1|  PREDICTED: expansin-A4-like                        128   3e-34   Glycine max [soybeans]
gb|ADY68814.1|  expansin                                                128   3e-34   Gossypium barbadense [Egyptian cotton]
ref|XP_009419260.1|  PREDICTED: expansin-A7-like                        128   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEN70900.1|  expansin                                                128   3e-34   Gossypium tomentosum
gb|ADY68817.1|  expansin                                                128   3e-34   Gossypium raimondii
ref|XP_006339024.1|  PREDICTED: expansin-A3-like                        128   3e-34   Solanum tuberosum [potatoes]
gb|ADY68815.1|  expansin                                                128   3e-34   Gossypium barbadense [Egyptian cotton]
gb|ADY68818.1|  expansin                                                128   3e-34   Gossypium hirsutum [American cotton]
ref|XP_009587747.1|  PREDICTED: expansin-A3-like                        128   3e-34   Nicotiana tomentosiformis
gb|AEN70893.1|  expansin                                                128   3e-34   Gossypium schwendimanii
ref|XP_010920576.1|  PREDICTED: expansin-A4-like                        128   4e-34   Elaeis guineensis
gb|AEN70895.1|  expansin                                                128   4e-34   Gossypium mustelinum
ref|XP_007016396.1|  Expansin A4, ALPHA 1.6,EXPA4                       128   4e-34   Theobroma cacao [chocolate]
gb|KDP20458.1|  hypothetical protein JCGZ_05303                         128   4e-34   Jatropha curcas
ref|XP_006410954.1|  hypothetical protein EUTSA_v10017095mg             128   4e-34   Eutrema salsugineum [saltwater cress]
ref|XP_010937609.1|  PREDICTED: expansin-A4                             128   4e-34   Elaeis guineensis
ref|XP_007009225.1|  Expansin A4, ALPHA 1.6,EXPA4                       128   4e-34   
ref|XP_006846223.1|  hypothetical protein AMTR_s00012p00230920          128   4e-34   Amborella trichopoda
ref|XP_006350774.1|  PREDICTED: expansin-A6                             128   4e-34   Solanum tuberosum [potatoes]
gb|AGR44459.1|  expansin 7                                              127   4e-34   Pyrus x bretschneideri [bai li]
ref|XP_007140533.1|  hypothetical protein PHAVU_008G120700g             128   5e-34   Phaseolus vulgaris [French bean]
ref|XP_010922313.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A4-...    128   5e-34   
gb|KJB78839.1|  hypothetical protein B456_013G022200                    128   5e-34   Gossypium raimondii
ref|XP_010931278.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A7        128   5e-34   Elaeis guineensis
ref|XP_010256907.1|  PREDICTED: expansin-A4                             128   5e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006294816.1|  hypothetical protein CARUB_v10023867mg             128   5e-34   Capsella rubella
ref|XP_008461679.1|  PREDICTED: expansin-A4                             128   5e-34   Cucumis melo [Oriental melon]
ref|XP_004147685.1|  PREDICTED: expansin-A4-like                        128   5e-34   Cucumis sativus [cucumbers]
ref|XP_002881524.1|  ATEXPA3                                            128   6e-34   Arabidopsis lyrata subsp. lyrata
dbj|BAC67194.1|  expansin                                               128   6e-34   Pyrus communis
gb|AAV85475.1|  expansin                                                127   6e-34   Populus tomentosa [Chinese white poplar]
ref|XP_002533155.1|  Alpha-expansin 4 precursor, putative               126   6e-34   
ref|XP_008371813.1|  PREDICTED: expansin-A4-like                        128   6e-34   Malus domestica [apple tree]
gb|ABK93541.1|  unknown                                                 127   6e-34   Populus trichocarpa [western balsam poplar]
gb|EYU18981.1|  hypothetical protein MIMGU_mgv1a012125mg                127   6e-34   Erythranthe guttata [common monkey flower]
ref|XP_010517036.1|  PREDICTED: expansin-A3                             128   6e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004143121.1|  PREDICTED: expansin-A4-like                        127   6e-34   Cucumis sativus [cucumbers]
gb|KCW85559.1|  hypothetical protein EUGRSUZ_B02358                     123   6e-34   Eucalyptus grandis [rose gum]
ref|XP_009357738.1|  PREDICTED: expansin-A4-like                        127   7e-34   Pyrus x bretschneideri [bai li]
gb|AIE54285.1|  expansin                                                127   7e-34   Nicotiana tabacum [American tobacco]
gb|KJB76740.1|  hypothetical protein B456_012G104400                    127   7e-34   Gossypium raimondii
ref|XP_008799850.1|  PREDICTED: expansin-A6-like                        127   7e-34   Phoenix dactylifera
ref|NP_001288899.1|  expansin-A6 precursor                              127   8e-34   Brassica rapa
gb|KJB55836.1|  hypothetical protein B456_009G098800                    127   8e-34   Gossypium raimondii
ref|NP_191109.1|  expansin A16                                          127   8e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAP48989.1|  expansin                                                127   8e-34   Sambucus nigra
emb|CDY20467.1|  BnaC04g05770D                                          127   8e-34   Brassica napus [oilseed rape]
ref|XP_009772489.1|  PREDICTED: expansin-A3-like                        127   8e-34   Nicotiana sylvestris
ref|XP_004490888.1|  PREDICTED: expansin-A4-like                        127   8e-34   Cicer arietinum [garbanzo]
ref|XP_009610453.1|  PREDICTED: expansin-A3-like                        127   8e-34   Nicotiana tomentosiformis
ref|XP_007141864.1|  hypothetical protein PHAVU_008G232200g             127   9e-34   Phaseolus vulgaris [French bean]
gb|KHG20113.1|  Expansin-A4 -like protein                               127   9e-34   Gossypium arboreum [tree cotton]
ref|XP_010685747.1|  PREDICTED: expansin-A4                             127   9e-34   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY07024.1|  BnaA04g22910D                                          127   9e-34   
emb|CDY24952.1|  BnaC03g22200D                                          127   9e-34   Brassica napus [oilseed rape]
gb|ACO07292.1|  expansin 10                                             127   1e-33   Cucumis sativus [cucumbers]
gb|AEN70907.1|  expansin                                                127   1e-33   Gossypium armourianum
gb|AEN70891.1|  expansin                                                127   1e-33   Gossypium thurberi
ref|XP_004142066.1|  PREDICTED: expansin-A4-like                        127   1e-33   
ref|XP_006411198.1|  hypothetical protein EUTSA_v10017119mg             127   1e-33   Eutrema salsugineum [saltwater cress]
gb|ABO32367.1|  expansin                                                127   1e-33   Litchi
gb|AHL25255.1|  expansin                                                127   1e-33   Boehmeria nivea [Chinese silk-plant]
gb|AEN70914.1|  expansin                                                127   1e-33   Gossypium trilobum
ref|XP_010521846.1|  PREDICTED: expansin-A6                             127   1e-33   Tarenaya hassleriana [spider flower]
ref|NP_001284471.1|  expansin-A4 precursor                              127   1e-33   Cucumis melo [Oriental melon]
gb|AEN70901.1|  expansin                                                127   1e-33   Gossypium barbadense var. brasiliense
ref|XP_009381075.1|  PREDICTED: expansin-A7-like                        127   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX74845.1|  BnaA05g05910D                                          125   1e-33   
emb|CAN73252.1|  hypothetical protein VITISV_027049                     126   1e-33   Vitis vinifera
ref|XP_002283358.1|  PREDICTED: expansin-A4                             127   1e-33   Vitis vinifera
gb|KHG12963.1|  Expansin-A4 -like protein                               125   1e-33   Gossypium arboreum [tree cotton]
ref|XP_010505357.1|  PREDICTED: expansin-A3-like                        127   1e-33   Camelina sativa [gold-of-pleasure]
gb|AAZ08313.1|  putative alpha-expansin                                 125   2e-33   Eucalyptus globulus [blue gum]
gb|KHG30766.1|  Expansin-A4 -like protein                               127   2e-33   Gossypium arboreum [tree cotton]
gb|AAT11859.2|  expansin 1                                              127   2e-33   Mangifera indica
ref|XP_003544219.1|  PREDICTED: expansin-A6-like                        127   2e-33   Glycine max [soybeans]
ref|XP_006480833.1|  PREDICTED: expansin-A4-like                        127   2e-33   Citrus sinensis [apfelsine]
emb|CDY31742.1|  BnaA04g16780D                                          127   2e-33   Brassica napus [oilseed rape]
gb|KHN07565.1|  Expansin-A4                                             125   2e-33   Glycine soja [wild soybean]
gb|KHN13987.1|  Expansin-A4                                             123   2e-33   Glycine soja [wild soybean]
ref|XP_006429095.1|  hypothetical protein CICLE_v10012518mg             126   2e-33   Citrus clementina [clementine]
ref|XP_009409019.1|  PREDICTED: expansin-A4-like                        126   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002878036.1|  ATEXPA16                                           126   2e-33   Arabidopsis lyrata subsp. lyrata
ref|NP_001288852.1|  expansin-A3 precursor                              127   2e-33   Brassica rapa
ref|XP_002881669.1|  ATEXPA4                                            126   2e-33   
ref|XP_009757427.1|  PREDICTED: expansin-A4-like                        126   2e-33   Nicotiana sylvestris
gb|AAR82850.1|  expansin-2                                              126   2e-33   Petunia x hybrida [garden petunia]
ref|XP_010043541.1|  PREDICTED: expansin-A4-like                        122   2e-33   Eucalyptus grandis [rose gum]
ref|XP_003552923.2|  PREDICTED: expansin-A3-like                        126   2e-33   Glycine max [soybeans]
gb|ACT67493.1|  expansin A1                                             126   2e-33   Raphanus sativus
ref|XP_009768238.1|  PREDICTED: expansin-A6-like                        126   2e-33   Nicotiana sylvestris
ref|XP_009143296.1|  PREDICTED: expansin-A4-like                        126   2e-33   Brassica rapa
ref|XP_003543517.1|  PREDICTED: expansin-A4                             126   2e-33   Glycine max [soybeans]
ref|NP_001234761.1|  expansin18 precursor                               126   2e-33   
dbj|BAH36869.1|  alpha expansin                                         122   2e-33   Torenia fournieri [bluewings]
gb|KHG29956.1|  Expansin-A4 -like protein                               126   2e-33   Gossypium arboreum [tree cotton]
emb|CDX74942.1|  BnaA05g06880D                                          126   2e-33   
gb|KJB73995.1|  hypothetical protein B456_011G266000                    126   2e-33   Gossypium raimondii
ref|XP_009380637.1|  PREDICTED: expansin-A4                             126   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010528418.1|  PREDICTED: expansin-A3                             126   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_009364387.1|  PREDICTED: expansin-A4                             126   3e-33   Pyrus x bretschneideri [bai li]
gb|KJB36710.1|  hypothetical protein B456_006G172400                    126   3e-33   Gossypium raimondii
ref|XP_004486999.1|  PREDICTED: expansin-A6-like                        126   3e-33   Cicer arietinum [garbanzo]
ref|XP_009353647.1|  PREDICTED: expansin-A6-like                        126   3e-33   Pyrus x bretschneideri [bai li]
emb|CAA04385.1|  Expansin                                               126   3e-33   Brassica napus [oilseed rape]
ref|XP_008464122.1|  PREDICTED: expansin-A4                             126   3e-33   Cucumis melo [Oriental melon]
emb|CDX77222.1|  BnaC04g40170D                                          126   3e-33   
ref|XP_007027012.1|  Expansin A4, ALPHA 1.6,EXPA4                       126   3e-33   
gb|KHN32128.1|  Expansin-A4                                             124   3e-33   Glycine soja [wild soybean]
ref|XP_006409928.1|  hypothetical protein EUTSA_v10017116mg             126   3e-33   Eutrema salsugineum [saltwater cress]
gb|KHG15821.1|  Expansin-A4 -like protein                               126   3e-33   Gossypium arboreum [tree cotton]
ref|XP_009398502.1|  PREDICTED: expansin-A7-like                        126   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEV43315.1|  expansin A5                                             124   3e-33   Glycine max [soybeans]
gb|KFK32246.1|  hypothetical protein AALP_AA6G217100                    125   3e-33   Arabis alpina [alpine rockcress]
ref|XP_008384848.1|  PREDICTED: expansin-A4                             126   3e-33   Malus domestica [apple tree]
ref|XP_010505648.1|  PREDICTED: expansin-A4                             125   3e-33   Camelina sativa [gold-of-pleasure]
gb|AEV43317.1|  expansin A5b                                            124   3e-33   Glycine max [soybeans]
gb|AFB77223.1|  expansin 1                                              125   4e-33   Betula platyphylla [Asian white birch]
ref|XP_004249536.1|  PREDICTED: expansin-A6-like                        125   4e-33   Solanum lycopersicum
gb|AEE69071.1|  expansin-4                                              125   4e-33   Petunia hybrid cultivar [hybrid petunia]
ref|NP_001276255.1|  expansin-A4-like precursor                         124   4e-33   
ref|XP_009141827.1|  PREDICTED: expansin-A4-like                        125   4e-33   Brassica rapa
gb|KJB46592.1|  hypothetical protein B456_007G376300                    125   4e-33   Gossypium raimondii
ref|XP_003552173.1|  PREDICTED: expansin-A4                             125   4e-33   Glycine max [soybeans]
gb|ABN09940.1|  expansin A5                                             125   4e-33   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010517323.1|  PREDICTED: expansin-A4-like                        125   4e-33   Camelina sativa [gold-of-pleasure]
ref|NP_181500.1|  expansin A4                                           125   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504408.1|  PREDICTED: expansin-A16-like                       125   4e-33   Camelina sativa [gold-of-pleasure]
gb|ADD14636.1|  expansin precursor                                      124   4e-33   Solanum tuberosum [potatoes]
ref|XP_010516124.1|  PREDICTED: expansin-A16                            125   5e-33   Camelina sativa [gold-of-pleasure]
gb|ABN09939.1|  expansin A4                                             125   5e-33   Musa acuminata AAA Group [Cavendish banana]
ref|XP_003537990.1|  PREDICTED: expansin-A4-like                        125   5e-33   
ref|XP_003616412.1|  Expansin                                           125   5e-33   Medicago truncatula
gb|KJB46593.1|  hypothetical protein B456_007G376300                    126   6e-33   Gossypium raimondii
ref|NP_001242978.1|  expansin-A4-like precursor                         125   6e-33   Glycine max [soybeans]
emb|CDY39521.1|  BnaC04g15200D                                          124   6e-33   Brassica napus [oilseed rape]
gb|KCW65541.1|  hypothetical protein EUGRSUZ_G02938                     125   6e-33   Eucalyptus grandis [rose gum]
ref|XP_003547326.1|  PREDICTED: expansin-A4-like                        125   6e-33   Glycine max [soybeans]
ref|XP_004302749.1|  PREDICTED: expansin-A6                             125   6e-33   Fragaria vesca subsp. vesca
gb|AAM47000.1|AF512542_1  alpha-expansin precursor                      125   6e-33   Gossypium hirsutum [American cotton]
ref|XP_011027216.1|  PREDICTED: expansin-A4                             125   6e-33   Populus euphratica
ref|XP_010033123.1|  PREDICTED: expansin-A4                             125   6e-33   Eucalyptus grandis [rose gum]
ref|XP_002315218.1|  alpha-expansin 9 precursor family protein          125   7e-33   
ref|XP_009409516.1|  PREDICTED: expansin-A6-like                        125   7e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004154408.1|  PREDICTED: expansin-A4-like                        125   7e-33   
ref|XP_010106493.1|  hypothetical protein L484_025251                   125   7e-33   Morus notabilis
ref|XP_009349313.1|  PREDICTED: expansin-A6-like                        125   7e-33   Pyrus x bretschneideri [bai li]
ref|XP_010534508.1|  PREDICTED: expansin-A4                             125   7e-33   Tarenaya hassleriana [spider flower]
ref|XP_004492358.1|  PREDICTED: expansin-A6-like                        125   8e-33   Cicer arietinum [garbanzo]
ref|XP_004145295.1|  PREDICTED: expansin-A4-like                        125   8e-33   
ref|XP_003538409.1|  PREDICTED: expansin-A6                             125   8e-33   Glycine max [soybeans]
gb|ACA05164.1|  expansin 1                                              124   9e-33   Dimocarpus longan [longan]
ref|XP_006294843.1|  hypothetical protein CARUB_v10023894mg             124   9e-33   Capsella rubella
gb|KJB16930.1|  hypothetical protein B456_002G257400                    125   9e-33   Gossypium raimondii
emb|CDY47883.1|  BnaA07g14280D                                          124   9e-33   Brassica napus [oilseed rape]
emb|CAA59470.1|  orf                                                    124   9e-33   Pisum sativum [garden pea]
ref|XP_010508990.1|  PREDICTED: expansin-A4-like                        124   9e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009124371.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A6        124   1e-32   Brassica rapa
gb|ABO30976.2|  alpha expansin protein 1                                124   1e-32   Calotropis procera
ref|XP_009589397.1|  PREDICTED: expansin-A4-like                        124   1e-32   Nicotiana tomentosiformis
ref|XP_010690765.1|  PREDICTED: expansin-A4                             124   1e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG12430.1|  Expansin-A4 -like protein                               124   1e-32   Gossypium arboreum [tree cotton]
ref|XP_010554612.1|  PREDICTED: expansin-A4                             124   1e-32   Tarenaya hassleriana [spider flower]
ref|NP_001288961.1|  expansin-A4 precursor                              124   1e-32   Brassica rapa
ref|XP_010067412.1|  PREDICTED: expansin-A4                             125   1e-32   Eucalyptus grandis [rose gum]
emb|CDY07642.1|  BnaA03g18690D                                          124   1e-32   Brassica napus [oilseed rape]
emb|CDY69611.1|  BnaCnng64440D                                          124   1e-32   Brassica napus [oilseed rape]
ref|XP_010557251.1|  PREDICTED: expansin-A6-like                        124   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_007205748.1|  hypothetical protein PRUPE_ppa010226mg             124   2e-32   Prunus persica
gb|ABM66430.1|  expansin 3                                              124   2e-32   Musa acuminata AAA Group [Cavendish banana]
ref|XP_002881024.1|  ATEXPA6                                            124   2e-32   Arabidopsis lyrata subsp. lyrata
dbj|BAH36862.1|  alpha expansin                                         124   2e-32   Rosa hybrid cultivar
ref|XP_008240857.1|  PREDICTED: expansin-A6-like                        124   2e-32   Prunus mume [ume]
gb|ABN09942.1|  expansin A5                                             123   2e-32   Musa acuminata AAA Group [Cavendish banana]
emb|CDY10456.1|  BnaCnng03570D                                          124   2e-32   Brassica napus [oilseed rape]
ref|XP_009388613.1|  PREDICTED: expansin-A7                             124   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009787901.1|  PREDICTED: expansin-A3-like                        124   2e-32   Nicotiana sylvestris
gb|KFK36856.1|  hypothetical protein AALP_AA4G180600                    123   3e-32   Arabis alpina [alpine rockcress]
ref|XP_008457477.1|  PREDICTED: expansin-A4-like                        123   3e-32   Cucumis melo [Oriental melon]
ref|XP_010043542.1|  PREDICTED: expansin-A4-like                        123   3e-32   Eucalyptus grandis [rose gum]
ref|NP_001233958.1|  expansin precursor                                 123   3e-32   Solanum lycopersicum
ref|NP_195846.1|  expansin A9                                           123   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008357089.1|  PREDICTED: expansin-A6                             123   3e-32   
gb|KFK36651.1|  alpha-expansin 4                                        123   3e-32   Arabis alpina [alpine rockcress]
ref|XP_002463623.1|  hypothetical protein SORBIDRAFT_01g003120          123   3e-32   Sorghum bicolor [broomcorn]
ref|XP_007150329.1|  hypothetical protein PHAVU_005G144500g             123   3e-32   Phaseolus vulgaris [French bean]
gb|EMT32065.1|  hypothetical protein F775_28771                         122   3e-32   
gb|KHN07218.1|  Expansin-A4                                             123   3e-32   Glycine soja [wild soybean]
ref|XP_003552064.1|  PREDICTED: expansin-A4                             123   4e-32   Glycine max [soybeans]
ref|XP_010490643.1|  PREDICTED: expansin-A9                             123   4e-32   Camelina sativa [gold-of-pleasure]
gb|EPS64820.1|  hypothetical protein M569_09956                         123   4e-32   Genlisea aurea
gb|AAM62937.1|  Alpha-expansin 4 precursor (At-EXP4) (AtEx4) (Ath...    123   4e-32   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA52221.1|  TPA: hypothetical protein ZEAMMB73_487280              119   5e-32   
ref|XP_010452058.1|  PREDICTED: expansin-A9-like                        122   5e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006288496.1|  hypothetical protein CARUB_v10001761mg             122   5e-32   Capsella rubella
ref|XP_010423881.1|  PREDICTED: expansin-A9-like                        122   6e-32   Camelina sativa [gold-of-pleasure]
emb|CDY02943.1|  BnaC04g25430D                                          122   6e-32   
gb|AAW32214.1|  alpha-expansin EXPA3                                    119   6e-32   Triticum aestivum [Canadian hard winter wheat]
gb|AAQ08016.1|  expansin                                                122   7e-32   Melilotus albus
ref|XP_009607348.1|  PREDICTED: expansin-A3-like                        123   7e-32   Nicotiana tomentosiformis
dbj|BAE06067.1|  expansin                                               122   7e-32   Sagittaria pygmaea
ref|XP_011077647.1|  PREDICTED: expansin-A6-like                        122   7e-32   
ref|XP_006291698.1|  hypothetical protein CARUB_v10017862mg             122   8e-32   Capsella rubella
gb|AAL31477.1|AF319472_1  alpha-expansin 6 precursor                    122   8e-32   Cucumis sativus [cucumbers]
emb|CDY40233.1|  BnaA09g35150D                                          122   8e-32   
gb|ABK24904.1|  unknown                                                 122   8e-32   
gb|EPS67093.1|  hypothetical protein M569_07682                         122   8e-32   
ref|XP_002870966.1|  ATEXPA9                                            122   8e-32   
gb|AGR44458.1|  expansin 6                                              119   8e-32   
ref|XP_010111142.1|  hypothetical protein L484_010756                   122   9e-32   
ref|XP_010532011.1|  PREDICTED: expansin-A4-like                        122   9e-32   
ref|NP_001288942.1|  expansin-A16 precursor                             122   9e-32   
gb|KFK34799.1|  hypothetical protein AALP_AA5G194700                    122   1e-31   
gb|KEH39447.1|  expansin A10                                            122   1e-31   
emb|CBI16120.3|  unnamed protein product                                122   1e-31   
gb|KHG24991.1|  Expansin-A4 -like protein                               121   1e-31   
gb|AAZ38818.1|  alpha-expansin 4                                        118   1e-31   
ref|XP_010042831.1|  PREDICTED: expansin-A4-like                        119   1e-31   
gb|EYU19913.1|  hypothetical protein MIMGU_mgv1a012177mg                121   1e-31   
ref|XP_009130690.1|  PREDICTED: expansin-A9-like                        121   2e-31   
ref|XP_004981242.1|  PREDICTED: expansin-A7-like                        121   2e-31   
ref|XP_009122794.1|  PREDICTED: expansin-A9                             121   2e-31   
emb|CDP06606.1|  unnamed protein product                                121   2e-31   
ref|XP_009341751.1|  PREDICTED: expansin-A4-like                        121   2e-31   
emb|CAH18933.1|  expansin                                               121   2e-31   
ref|XP_008387765.1|  PREDICTED: expansin-A4-like                        121   2e-31   
emb|CDX80810.1|  BnaC03g00640D                                          121   2e-31   
gb|EMS68657.1|  Expansin-A7                                             120   2e-31   
ref|XP_007163413.1|  hypothetical protein PHAVU_001G232600g             121   2e-31   
ref|XP_010037129.1|  PREDICTED: expansin-A4-like                        122   3e-31   
emb|CDX76090.1|  BnaA04g03540D                                          120   3e-31   
ref|XP_010427324.1|  PREDICTED: expansin-A16-like                       120   3e-31   
gb|AAK56122.1|AF332172_1  alpha-expansin 4                              119   3e-31   
gb|ABM54492.1|  expansin 2                                              120   3e-31   
dbj|BAC67193.1|  expansin                                               120   3e-31   
ref|XP_009139160.1|  PREDICTED: expansin-A16-like                       120   3e-31   
emb|CDY48101.1|  BnaC02g03580D                                          120   3e-31   
emb|CDY04847.1|  BnaAnng00290D                                          120   4e-31   
ref|NP_001288956.1|  expansin-A9-like precursor                         120   4e-31   
ref|XP_003563572.1|  PREDICTED: expansin-A7                             120   4e-31   
gb|AEQ55269.1|  expansin                                                120   4e-31   
ref|XP_006398690.1|  hypothetical protein EUTSA_v10014430mg             120   4e-31   
ref|NP_001051731.1|  Os03g0822000                                       120   5e-31   
gb|AEQ55284.1|  expansin                                                120   5e-31   
emb|CDY41218.1|  BnaC08g26400D                                          120   5e-31   
gb|KJB08889.1|  hypothetical protein B456_001G111100                    120   5e-31   
gb|KFK24708.1|  hypothetical protein AALP_AA8G014300                    120   5e-31   
gb|AEQ55271.1|  expansin                                                120   5e-31   
gb|ACF84785.1|  unknown                                                 120   6e-31   
gb|KJB08890.1|  hypothetical protein B456_001G111100                    120   7e-31   
gb|ACG46282.1|  alpha-expansin 6 precursor                              120   7e-31   
ref|XP_007133996.1|  hypothetical protein PHAVU_010G010200g             119   7e-31   
ref|XP_011019858.1|  PREDICTED: expansin-A6                             119   1e-30   
gb|KEH22886.1|  expansin-A1-like protein                                119   1e-30   
gb|AAF32410.1|AF230277_1  alpha-expansin 2                              119   1e-30   
gb|EYU41729.1|  hypothetical protein MIMGU_mgv1a012073mg                119   1e-30   
ref|XP_010558331.1|  PREDICTED: expansin-A9                             119   1e-30   
gb|EYU26594.1|  hypothetical protein MIMGU_mgv1a012061mg                119   1e-30   
ref|XP_006403453.1|  hypothetical protein EUTSA_v10010989mg             119   1e-30   
gb|AAS48878.1|  expansin EXPA9                                          119   2e-30   
gb|AEQ55268.1|  expansin                                                119   2e-30   
ref|XP_011094866.1|  PREDICTED: expansin-A6                             119   2e-30   
ref|XP_002309061.1|  expansin family protein                            118   2e-30   
ref|XP_010026825.1|  PREDICTED: expansin-A4-like                        116   2e-30   
gb|KHN40987.1|  Expansin-A8                                             118   2e-30   
ref|XP_003519289.1|  PREDICTED: expansin-A8-like                        118   3e-30   
gb|ABR57377.1|  alpha-expansin 1                                        114   4e-30   
gb|KHN17924.1|  Expansin-A3                                             119   4e-30   
ref|XP_002520863.1|  Alpha-expansin 8 precursor, putative               117   4e-30   
gb|ABR57380.1|  alpha-expansin 1                                        114   4e-30   
gb|KHG27586.1|  Expansin-A8 -like protein                               117   7e-30   
ref|XP_002532867.1|  Alpha-expansin 8 precursor, putative               117   7e-30   
ref|XP_011019014.1|  PREDICTED: expansin-A8-like                        117   7e-30   
gb|ABM66452.1|  expansin                                                117   7e-30   
gb|ABR57382.1|  alpha-expansin 1                                        113   9e-30   
emb|CDP04049.1|  unnamed protein product                                117   1e-29   
emb|CDP13911.1|  unnamed protein product                                116   1e-29   
gb|KJB74926.1|  hypothetical protein B456_012G014400                    116   1e-29   
ref|XP_010042199.1|  PREDICTED: expansin-A4-like                        114   1e-29   
ref|XP_003544930.1|  PREDICTED: expansin-A8                             116   1e-29   
gb|ADC35364.1|  alpha-expansin 1                                        116   1e-29   
dbj|BAA21109.1|  expansin                                               114   1e-29   
ref|XP_002309181.2|  hypothetical protein POPTR_0006s10850g             116   1e-29   
ref|NP_001236550.1|  expansin precursor                                 116   1e-29   
ref|XP_011084824.1|  PREDICTED: expansin-A2-like                        117   1e-29   
gb|ABR57379.1|  alpha-expansin 1                                        113   1e-29   
ref|XP_006346675.1|  PREDICTED: expansin-A10-like                       116   1e-29   
gb|AEQ55270.1|  expansin                                                116   2e-29   
gb|ACX69842.1|  expansin                                                116   2e-29   
gb|AAZ08312.1|  putative alpha-expansin                                 112   2e-29   
ref|XP_004490713.1|  PREDICTED: expansin-A8-like                        115   2e-29   
gb|AEN70881.1|  alpha-expansin 1                                        116   2e-29   
gb|EPS68567.1|  hypothetical protein M569_06200                         116   2e-29   
gb|ADY68810.1|  alpha-expansin 1                                        115   2e-29   
gb|AEN70871.1|  alpha-expansin 1                                        115   2e-29   
gb|ABD48785.1|  alpha-expansin 1                                        115   2e-29   
gb|AIZ46895.1|  expansin                                                113   3e-29   
gb|AFG52975.1|  hypothetical protein 0_1610_01                          111   3e-29   
gb|ABI94216.1|  EXP2                                                    114   3e-29   
ref|NP_001242219.1|  uncharacterized protein LOC100777044 precursor     115   3e-29   
gb|AEW07441.1|  hypothetical protein 0_1610_01                          111   3e-29   
gb|AEX12538.1|  hypothetical protein 2_4686_01                          110   3e-29   
gb|KHN48407.1|  Expansin-A8                                             115   3e-29   
gb|AFK39658.1|  unknown                                                 115   3e-29   
ref|XP_004294733.1|  PREDICTED: expansin-A4-like                        115   3e-29   
gb|ABR57386.1|  alpha-expansin 1                                        112   4e-29   
ref|XP_010253098.1|  PREDICTED: expansin-A8-like                        115   4e-29   
gb|KEH34458.1|  expansin A10                                            115   4e-29   
gb|ACD37706.1|  alpha expansin                                          115   4e-29   
gb|ACJ84647.1|  unknown                                                 115   4e-29   
gb|AEW07864.1|  hypothetical protein 0_13323_01                         110   4e-29   
gb|AFG52979.1|  hypothetical protein 0_1610_01                          110   5e-29   
ref|XP_009410516.1|  PREDICTED: expansin-A4-like                        115   5e-29   
ref|XP_011098644.1|  PREDICTED: expansin-A10                            114   5e-29   
dbj|BAH20215.1|  AT2G28950                                              110   5e-29   
gb|AEN70885.1|  alpha-expansin 1                                        114   6e-29   
gb|AHL25254.1|  expansin                                                114   6e-29   
gb|KCW63104.1|  hypothetical protein EUGRSUZ_G00712                     112   6e-29   
gb|AEN70883.1|  alpha-expansin 1                                        114   6e-29   
gb|AEN70870.1|  alpha-expansin 1                                        114   6e-29   
ref|XP_009762738.1|  PREDICTED: expansin-A10-like                       115   6e-29   
ref|XP_010031088.1|  PREDICTED: expansin-A8-like                        114   6e-29   
ref|XP_008812336.1|  PREDICTED: expansin-A16-like                       115   6e-29   
ref|XP_010677870.1|  PREDICTED: expansin-A4-like                        114   7e-29   
gb|AAF35901.1|AF230332_1  expansin 2                                    114   7e-29   
dbj|BAN09211.1|  alpha expansin                                         114   7e-29   
gb|AEN70869.1|  alpha-expansin 1                                        114   7e-29   
gb|ACF87150.1|  unknown                                                 114   7e-29   
gb|ABR57381.1|  alpha-expansin 1                                        111   7e-29   
gb|KHG02505.1|  Expansin-A2                                             114   8e-29   
gb|ABB59694.1|  alpha-expansin 2                                        114   8e-29   
gb|AEN70868.1|  alpha-expansin 1                                        114   8e-29   
gb|AEQ55272.1|  expansin                                                114   8e-29   
gb|AEN70867.1|  alpha-expansin 1                                        114   8e-29   
ref|XP_004246275.1|  PREDICTED: expansin-A10-like                       114   8e-29   
gb|AEN70887.1|  alpha-expansin 1                                        114   8e-29   
ref|XP_004307494.1|  PREDICTED: expansin-A4-like                        114   9e-29   
ref|XP_003616026.1|  Expansin                                           114   9e-29   
ref|NP_001265970.1|  expansin-A8-like precursor                         114   1e-28   
gb|KJB60202.1|  hypothetical protein B456_009G293500                    114   1e-28   
ref|XP_007142047.1|  hypothetical protein PHAVU_008G248000g             114   1e-28   
gb|KJB73009.1|  hypothetical protein B456_011G209100                    114   1e-28   
ref|XP_010918818.1|  PREDICTED: expansin-A10-like                       116   1e-28   
gb|KHN04238.1|  Expansin-A8                                             114   1e-28   
gb|KHG29916.1|  Expansin-A8 -like protein                               114   1e-28   
ref|XP_009607404.1|  PREDICTED: expansin-A10-like                       114   1e-28   
ref|XP_009374380.1|  PREDICTED: expansin-A4-like                        114   1e-28   
ref|XP_010252076.1|  PREDICTED: expansin-A8-like                        114   1e-28   
ref|NP_001281040.1|  expansin-A4-like precursor                         114   1e-28   
emb|CAN73461.1|  hypothetical protein VITISV_033906                     114   1e-28   
ref|XP_002266243.1|  PREDICTED: expansin-A4                             114   1e-28   
gb|ACK36942.1|  expansin                                                113   1e-28   
gb|ADC35366.1|  alpha-expansin 3                                        113   1e-28   
ref|XP_008354429.1|  PREDICTED: expansin-A4-like                        113   1e-28   
gb|AFB77225.1|  expansin 3                                              113   1e-28   
ref|XP_010938009.1|  PREDICTED: expansin-A2-like                        113   2e-28   
gb|AEN70875.1|  alpha-expansin 1                                        113   2e-28   
ref|NP_001289251.1|  expansin-A4-like precursor                         113   2e-28   
gb|ABR57384.1|  alpha-expansin 1                                        110   2e-28   
gb|ACJ85313.1|  unknown                                                 113   2e-28   
gb|ACJ70084.1|  expansin                                                113   2e-28   
gb|AAM46998.1|AF512540_1  alpha-expansin precursor                      113   2e-28   
gb|AAY43797.1|  expansin                                                113   2e-28   
ref|XP_008458865.1|  PREDICTED: expansin-A4                             113   2e-28   
gb|ACM90160.1|  expansin 2                                              113   2e-28   
gb|ABK25460.1|  unknown                                                 113   2e-28   
gb|AAM46997.1|AF512539_1  alpha-expansin precursor                      113   2e-28   
dbj|BAD94932.2|  Expansin                                               109   2e-28   
gb|KJB71465.1|  hypothetical protein B456_011G128500                    112   2e-28   
gb|KHG13406.1|  Expansin-A8 -like protein                               113   2e-28   
gb|AAR82851.1|  expansin-3                                              113   2e-28   
emb|CBI30173.3|  unnamed protein product                                114   2e-28   
ref|XP_006650810.1|  PREDICTED: expansin-A7-like                        113   2e-28   
ref|XP_003538280.1|  PREDICTED: expansin-A8                             113   2e-28   
dbj|BAG16265.1|  alpha expansin like protein                            111   2e-28   
gb|ABL86681.1|  EX4                                                     113   2e-28   
ref|NP_001150534.1|  alpha-expansin 6 precursor                         113   2e-28   
ref|XP_007132063.1|  hypothetical protein PHAVU_011G063800g             113   3e-28   
gb|KJB60772.1|  hypothetical protein B456_009G324900                    112   3e-28   
dbj|BAG16264.1|  alpha-expansin like protein                            111   3e-28   
ref|XP_010044491.1|  PREDICTED: expansin-A1-like                        112   3e-28   
gb|KJB71463.1|  hypothetical protein B456_011G128500                    112   3e-28   
gb|ACK43222.1|  expansin 2                                              112   3e-28   
ref|XP_009631918.1|  PREDICTED: expansin-A4-like                        113   3e-28   
dbj|BAG16266.1|  alpha expansin like protein                            110   3e-28   
gb|KJB60771.1|  hypothetical protein B456_009G324900                    112   3e-28   
ref|NP_001267685.1|  expansin-A16-like                                  112   3e-28   
gb|EPS70210.1|  hypothetical protein M569_04549                         112   3e-28   
ref|XP_007205762.1|  hypothetical protein PRUPE_ppa010314mg             112   3e-28   
gb|KJB71462.1|  hypothetical protein B456_011G128500                    112   3e-28   
gb|KJB71461.1|  hypothetical protein B456_011G128500                    112   3e-28   
gb|ADY68811.1|  alpha-expansin 1                                        112   3e-28   
ref|XP_010931357.1|  PREDICTED: expansin-A4-like                        112   4e-28   
gb|EMT21884.1|  hypothetical protein F775_32026                         111   4e-28   
gb|ABC55453.1|  expansin protein                                        112   4e-28   
ref|XP_006435913.1|  hypothetical protein CICLE_v10032524mg             112   4e-28   
gb|ACA05166.1|  expansin 3                                              112   4e-28   
gb|AAL87023.1|  cell wall protein Exp4 precursor                        112   4e-28   
gb|AFK24458.1|  expansin 5                                              112   4e-28   
ref|XP_010043148.1|  PREDICTED: expansin-A4-like                        112   4e-28   
gb|KJB71466.1|  hypothetical protein B456_011G128500                    112   4e-28   
ref|XP_004171211.1|  PREDICTED: expansin-A16-like                       112   5e-28   
gb|AAC39512.1|  expansin                                                112   5e-28   
dbj|BAH36861.1|  alpha expansin                                         112   5e-28   
gb|ABR57485.1|  alpha-expansin 6                                        107   5e-28   
gb|ABL86682.1|  EX5                                                     110   5e-28   
ref|NP_001240113.1|  expansin precursor                                 112   5e-28   
dbj|BAJ10397.1|  alpha-expansin                                         112   5e-28   
ref|XP_010678491.1|  PREDICTED: expansin-A10-like                       112   5e-28   
gb|AAZ08310.1|  putative alpha-expansin                                 111   5e-28   
gb|AAM62987.1|  expansin AtEx6                                          112   5e-28   
ref|XP_011080662.1|  PREDICTED: expansin-A4-like                        112   5e-28   
ref|XP_011070988.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A10...    112   6e-28   
ref|XP_003523276.1|  PREDICTED: expansin-A8-like                        112   6e-28   
ref|NP_180461.1|  expansin A6                                           112   6e-28   
gb|AAC33529.1|  expansin                                                112   6e-28   
ref|XP_010414459.1|  PREDICTED: expansin-A6-like                        112   6e-28   
gb|ACK43884.1|  expansin                                                112   6e-28   
ref|XP_010510558.1|  PREDICTED: expansin-A6                             112   6e-28   
gb|ABR57484.1|  alpha-expansin 6                                        107   6e-28   
ref|XP_009804397.1|  PREDICTED: expansin-A10                            112   6e-28   
ref|XP_010243262.1|  PREDICTED: expansin-A16-like                       112   7e-28   
gb|ABL86680.1|  EXA1                                                    112   7e-28   
ref|XP_006294844.1|  hypothetical protein CARUB_v10023895mg             112   7e-28   
ref|XP_010670610.1|  PREDICTED: expansin-A2-like                        112   7e-28   



>dbj|BAO57279.1| alpha-expansin [Ipomoea nil]
Length=257

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/81 (100%), Positives = 81/81 (100%), Gaps = 0/81 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS
Sbjct  177  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  236

Query  79   WNVAPANWQFGQTFQGKNFRA  17
            WNVAPANWQFGQTFQGKNFRA
Sbjct  237  WNVAPANWQFGQTFQGKNFRA  257



>ref|XP_004249634.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
Length=259

 Score =   138 bits (347),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDIQKV VKG+ TPWI+++RNWGQNW+T+A LVGQ+LSFRV ASDRR   S
Sbjct  179  VLVTNVAGAGDIQKVYVKGTNTPWISMTRNWGQNWQTNAKLVGQALSFRVTASDRRSSAS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            +N+APANWQFGQTFQGKNFR
Sbjct  239  YNIAPANWQFGQTFQGKNFR  258



>gb|ADD14635.1| expansin precursor, partial [Solanum tuberosum]
Length=210

 Score =   135 bits (339),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI KV+VKG+RT WITLSRNWGQNW+T++ LVGQSLSFRV ASD+R+ TS
Sbjct  130  VLVTNVAGAGDITKVMVKGTRTNWITLSRNWGQNWQTNSVLVGQSLSFRVTASDKRKSTS  189

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP++WQFGQTF GKNFR
Sbjct  190  WNIAPSHWQFGQTFVGKNFR  209



>ref|XP_006349505.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=259

 Score =   136 bits (342),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDIQKV VKG+ TPWI+++RNWGQNW+T+A L+GQ+LSFRV  SDRR   S
Sbjct  179  VLVTNVAGAGDIQKVYVKGTNTPWISMTRNWGQNWQTNAKLIGQALSFRVTGSDRRSSAS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            +N+APANWQFGQTFQGKNFR
Sbjct  239  YNIAPANWQFGQTFQGKNFR  258



>gb|ADC35365.1| alpha-expansin 2 [Coffea arabica]
Length=258

 Score =   135 bits (341),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGS+T WITLSRNWGQNW+T+A L GQSLSFRVRASDRR  TS
Sbjct  178  VLITNVAGAGDIVQASVKGSKTGWITLSRNWGQNWQTNAVLAGQSLSFRVRASDRRSSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APANWQFGQTF GKNFR
Sbjct  238  WNIAPANWQFGQTFTGKNFR  257



>emb|CDP00110.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   135 bits (341),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGS+T WITLSRNWGQNW+T+A L GQSLSFRVRASDRR  TS
Sbjct  175  VLITNVAGAGDIVQASVKGSKTGWITLSRNWGQNWQTNAVLAGQSLSFRVRASDRRSSTS  234

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APANWQFGQTF GKNFR
Sbjct  235  WNIAPANWQFGQTFTGKNFR  254



>ref|XP_009761115.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=260

 Score =   135 bits (341),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI K++VKGSRT WIT+SRNWGQNW+T++ LVGQ+LSFRV ASDRR+ TS
Sbjct  180  VLVTNVAGAGDIVKLMVKGSRTGWITMSRNWGQNWQTNSVLVGQALSFRVTASDRRKSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  240  WNIAPAHWQFGQTFVGKNFR  259



>ref|XP_006366490.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=257

 Score =   135 bits (340),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI KV+VKG+RT WITLSRNWGQNW+T++ LVGQSLSFRV ASD+R+ TS
Sbjct  177  VLVTNVAGAGDITKVMVKGTRTNWITLSRNWGQNWQTNSVLVGQSLSFRVTASDKRKSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP++WQFGQTF GKNFR
Sbjct  237  WNIAPSHWQFGQTFVGKNFR  256



>ref|NP_001234881.1| expansin9 precursor [Solanum lycopersicum]
 emb|CAB46492.1| expansin9 [Solanum lycopersicum]
Length=257

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +LVTNVAGAGDI KV+VKG+RT WITLSRNWGQNW+T++ LVGQSLSFRV ASD+R+ TS
Sbjct  177  ILVTNVAGAGDITKVMVKGTRTNWITLSRNWGQNWQTNSVLVGQSLSFRVTASDKRKSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP++WQFGQTF GKNFR
Sbjct  237  WNIAPSHWQFGQTFVGKNFR  256



>gb|AAC96082.1| alpha-expansin precursor [Nicotiana tabacum]
Length=169

 Score =   132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI K++VKGSR+ WIT+SRNWGQNW+T++ LVGQ+LSFRV ASDRR+ TS
Sbjct  89   VLVTNVAGAGDIVKLMVKGSRSGWITMSRNWGQNWQTNSVLVGQALSFRVTASDRRKSTS  148

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  149  WNIAPAHWQFGQTFVGKNFR  168



>ref|XP_009613959.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI K++VKGSR+ WIT+SRNWGQNW+T++ LVGQ+LSFRV ASDRR+ TS
Sbjct  180  VLVTNVAGAGDILKLMVKGSRSGWITMSRNWGQNWQTNSVLVGQALSFRVTASDRRKSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  240  WNIAPAHWQFGQTFVGKNFR  259



>gb|AAR82849.1| expansin-1 [Petunia x hybrida]
Length=260

 Score =   134 bits (336),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI +V VKGS+T WITLSRNWGQNW+T+A L GQSLSFRV ASDRR  TS
Sbjct  180  VLVTNVAGAGDIVRVRVKGSKTNWITLSRNWGQNWQTNAVLTGQSLSFRVTASDRRSSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  240  WNIAPAHWQFGQTFMGKNFR  259



>gb|AEQ55290.1| expansin [Breonia chinensis]
Length=259

 Score =   133 bits (334),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI +V VKGSRT WI+LSRNWGQNW+T++ LVGQSLSFRV ASDRR  TS
Sbjct  179  VLVTNVAGAGDIVRVFVKGSRTGWISLSRNWGQNWQTNSVLVGQSLSFRVTASDRRSSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  239  WNIVPAHWQFGQTFVGKNFR  258



>gb|AEQ55275.1| expansin [Breonia chinensis]
Length=259

 Score =   133 bits (334),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI +V VKGSRT WI+LSRNWGQNW+T++ LVGQSLSFRV ASDRR  TS
Sbjct  179  VLVTNVAGAGDIVRVFVKGSRTGWISLSRNWGQNWQTNSVLVGQSLSFRVTASDRRSSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  239  WNIVPAHWQFGQTFVGKNFR  258



>ref|XP_008343537.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   132 bits (333),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+ NVAGAGDI KV VKG+ TPW++LSRNWGQNW+++A LVGQSLSFRV ASDRR  TS
Sbjct  181  VLIHNVAGAGDIVKVYVKGTNTPWMSLSRNWGQNWQSNAILVGQSLSFRVTASDRRTSTS  240

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  241  WNIVPSNWQFGQTFTGKNFR  260



>ref|XP_009343581.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   132 bits (333),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+ NVAGAGDI KV VKG+ TPW++LSRNWGQNW+++A LVGQSLSFRV ASDRR  TS
Sbjct  181  VLIHNVAGAGDIVKVYVKGTNTPWMSLSRNWGQNWQSNAILVGQSLSFRVTASDRRTSTS  240

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  241  WNIVPSNWQFGQTFTGKNFR  260



>ref|XP_009597793.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI +V VKGS+T WIT+SRNWGQN++T++ L+GQSLSFRV ASDRR  TS
Sbjct  180  VLVTNVAGAGDIVRVYVKGSKTNWITMSRNWGQNYQTNSVLIGQSLSFRVTASDRRSSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  240  WNIAPAHWQFGQTFSGKNFR  259



>gb|ABK92484.1| unknown [Populus trichocarpa]
Length=123

 Score =   128 bits (322),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVRASDRR  TS
Sbjct  43   VLISNVAGAGDIVQVSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTS  102

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  103  WNIVPAHWQFGQTFTGKNFR  122



>ref|XP_006488339.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO72838.1| hypothetical protein CISIN_1g046524mg [Citrus sinensis]
Length=259

 Score =   132 bits (332),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI +V VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV+ASDRR  TS
Sbjct  179  VLVTNVAGAGDILRVNVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  239  WNIVPANWQFGQTFVGKNFR  258



>ref|XP_009788740.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=259

 Score =   132 bits (332),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +LVTNVAGAGDIQKVL+KG+ T WI +SRNWGQNW+T+A LVGQ+LS RV+ASD R VTS
Sbjct  179  LLVTNVAGAGDIQKVLIKGTNTQWIAMSRNWGQNWQTNAVLVGQALSIRVKASDHRSVTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
             NVAP NWQFGQTF+GKNFR
Sbjct  239  TNVAPPNWQFGQTFEGKNFR  258



>ref|XP_002298353.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|ABK92494.1| unknown [Populus trichocarpa]
 gb|EEE83158.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   132 bits (331),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVRASDRR  TS
Sbjct  182  VLISNVAGAGDIVQVSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  242  WNIAPAHWQFGQTFTGKNFR  261



>ref|XP_006424843.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
 gb|ESR38083.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
Length=259

 Score =   132 bits (331),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI +V VKGSRT W+++SRNWGQNW+++A L+GQSLSFRV+ASDRR  TS
Sbjct  179  VLVTNVAGAGDILRVNVKGSRTGWMSMSRNWGQNWQSNAVLIGQSLSFRVKASDRRSSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  239  WNIVPANWQFGQTFVGKNFR  258



>gb|AEQ55274.1| expansin [Breonia chinensis]
 gb|AEQ55289.1| expansin [Breonia chinensis]
Length=256

 Score =   131 bits (330),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI +V VKGSRT WI++SRNWGQNW+T++ LVGQSLSFRV ASDRR  TS
Sbjct  176  VLVTNVAGAGDIVRVFVKGSRTGWISMSRNWGQNWQTNSVLVGQSLSFRVTASDRRSSTS  235

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  236  WNMVPAHWQFGQTFVGKNFR  255



>dbj|BAD00017.1| expansin [Malus domestica]
Length=224

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+ NVAGAGDI K  VKG+ TPW++LSRNWGQNW+++A LVGQSLSFRV ASDRR  TS
Sbjct  144  VLIHNVAGAGDIVKAYVKGTNTPWMSLSRNWGQNWQSNAILVGQSLSFRVTASDRRTSTS  203

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  204  WNIVPSNWQFGQTFTGKNFR  223



>gb|AAF35900.1|AF230331_1 expansin 1 [Zinnia violacea]
Length=203

 Score =   129 bits (325),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDIQKV VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV ASDRR  TS
Sbjct  123  VLISNVAGAGDIQKVWVKGSKTNWMSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTS  182

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  183  WNIVPAHWQFGQTFTGKNFR  202



>ref|XP_008784594.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=260

 Score =   131 bits (329),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKGSRT W+ +SRNWGQNW+++A LVGQSLSFRV ASDRR  TS
Sbjct  180  VLITNVAGAGDIVRVSVKGSRTGWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  240  WNIVPANWQFGQTFAGKNFR  259



>ref|XP_007205740.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
 dbj|BAC66787.1| expansin [Prunus persica]
 gb|EMJ06939.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
Length=260

 Score =   131 bits (329),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLV+NVAGAGDI +V VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVR SDRR  TS
Sbjct  180  VLVSNVAGAGDIVRVSVKGSKTSWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNV PANWQFGQTF GKNFR
Sbjct  240  WNVVPANWQFGQTFTGKNFR  259



>ref|XP_010111457.1| hypothetical protein L484_021280 [Morus notabilis]
 gb|EXC30980.1| hypothetical protein L484_021280 [Morus notabilis]
Length=263

 Score =   131 bits (329),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAG+I +V VKGS+T W+++SRNWGQNW+++A LVGQ+LSFRVRASDRR  TS
Sbjct  183  VLVTNVAGAGNIVQVGVKGSKTGWLSMSRNWGQNWQSNAVLVGQALSFRVRASDRRSSTS  242

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APANWQFGQTF GKNFR
Sbjct  243  WNIAPANWQFGQTFTGKNFR  262



>ref|XP_008777004.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=258

 Score =   131 bits (329),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKGSRT W+ LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRVSVKGSRTGWMPLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTATS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNV PANWQFGQTF GKNFR
Sbjct  238  WNVVPANWQFGQTFAGKNFR  257



>ref|XP_008223717.1| PREDICTED: expansin-A4 [Prunus mume]
Length=260

 Score =   130 bits (328),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLV+NVAGAGDI +V VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVR SDRR  TS
Sbjct  180  VLVSNVAGAGDIVRVSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNV PANWQFGQTF GKNFR
Sbjct  240  WNVVPANWQFGQTFTGKNFR  259



>gb|AEU08407.1| expansin 2 [Prunus salicina]
Length=260

 Score =   130 bits (328),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLV+NVAGAGDI +V VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVR SDRR  TS
Sbjct  180  VLVSNVAGAGDIVRVSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNV PANWQFGQTF GKNFR
Sbjct  240  WNVVPANWQFGQTFTGKNFR  259



>gb|ACN94264.1| expansin [Rehmannia glutinosa]
 gb|ACN94265.1| expansin [Rehmannia glutinosa]
Length=260

 Score =   130 bits (328),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI KV +KGSRT W+T+SRNWGQNW++++ L+GQSLSFRV  SDRR  TS
Sbjct  180  VLVTNVAGAGDIVKVSIKGSRTGWMTMSRNWGQNWQSNSVLIGQSLSFRVTGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP+NWQFGQTF GKNFR
Sbjct  240  WNIAPSNWQFGQTFVGKNFR  259



>gb|ACJ48968.2| expansin [Breonia chinensis]
 gb|ACT10284.2| expansin [Breonia chinensis]
Length=258

 Score =   130 bits (328),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT WI+LSRNWGQNW+T++ L GQSLSFRVRASDRR  TS
Sbjct  178  VLITNVAGAGDIVQAWVKGSRTGWISLSRNWGQNWQTNSVLAGQSLSFRVRASDRRSSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  238  WNIVPSNWQFGQTFTGKNFR  257



>gb|AAM22624.1|AF428177_1 expansin 10 precursor [Rumex palustris]
Length=258

 Score =   130 bits (327),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V +KGSR+ W+ +SRNWGQNW+++A LVGQSLSFRV ASDRR+ TS
Sbjct  178  VLITNVAGAGDIVRVSIKGSRSDWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAPA+WQFGQTF GKNFR
Sbjct  238  WNVAPASWQFGQTFTGKNFR  257



>gb|AAM22625.1|AF428178_1 expansin 11 precursor [Rumex palustris]
Length=258

 Score =   130 bits (327),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V +KGSR+ W+ +SRNWGQNW+++A LVGQSLSFRV ASDRR+ TS
Sbjct  178  VLITNVAGAGDIVRVSIKGSRSDWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAPA+WQFGQTF GKNFR
Sbjct  238  WNVAPASWQFGQTFTGKNFR  257



>ref|XP_002313434.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|EEE87389.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   130 bits (327),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVRASDRR  TS
Sbjct  182  VLISNVAGAGDIVQVSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  242  WNIVPAHWQFGQTFTGKNFR  261



>ref|XP_011042710.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=262

 Score =   130 bits (327),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVRASDRR  TS
Sbjct  182  VLISNVAGAGDIVQVSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  242  WNIVPAHWQFGQTFTGKNFR  261



>gb|AAM22626.1|AF428179_1 expansin 12 precursor [Rumex palustris]
Length=258

 Score =   130 bits (327),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V +KGSR+ W+ +SRNWGQNW+++A LVGQSLSFRV ASDRR+ TS
Sbjct  178  VLITNVAGAGDIVRVSIKGSRSDWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRKSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAPA+WQFGQTF GKNFR
Sbjct  238  WNVAPASWQFGQTFTGKNFR  257



>gb|KHN41101.1| Expansin-A4 [Glycine soja]
Length=123

 Score =   126 bits (317),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI K  VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV ASDRR  TS
Sbjct  43   VLITNVAGAGDIVKTSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTS  102

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNF+
Sbjct  103  WNLVPANWQFGQTFTGKNFK  122



>gb|AAK48848.1|AF350939_1 expansin [Prunus cerasus]
Length=260

 Score =   130 bits (327),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLV+NVAGAGDI +V VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVR SDRR  TS
Sbjct  180  VLVSNVAGAGDIVRVSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  240  WNIVPANWQFGQTFTGKNFR  259



>dbj|BAN09210.1| alpha expansin [Eustoma exaltatum subsp. russellianum]
Length=262

 Score =   130 bits (327),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT WI+LSRNWGQNW+T+  L+GQSLSFRV ASDRR  TS
Sbjct  182  VLITNVAGAGDIVRASVKGSRTNWISLSRNWGQNWQTNGVLIGQSLSFRVTASDRRTSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP+NWQFGQTF GKNFR
Sbjct  242  WNIAPSNWQFGQTFVGKNFR  261



>ref|XP_011035307.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=262

 Score =   130 bits (327),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKGS+T W+++SRNWGQNW+++A LVGQSLSFRVRASDRR  TS
Sbjct  182  VLISNVAGAGDIVQVSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  242  WNIVPAHWQFGQTFTGKNFR  261



>ref|XP_002533097.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
 gb|EEF29289.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
Length=259

 Score =   130 bits (326),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  239  WNIVPANWQFGQTFTGKNFR  258



>ref|XP_002266625.1| PREDICTED: expansin-A6 [Vitis vinifera]
 emb|CAN65872.1| hypothetical protein VITISV_000251 [Vitis vinifera]
 emb|CBI30547.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   130 bits (326),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI +V +KGS+T W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLVTNVAGAGDIVRVSIKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAPANWQFGQTF G+NFR
Sbjct  238  WNVAPANWQFGQTFSGRNFR  257



>gb|KDP44940.1| hypothetical protein JCGZ_01440 [Jatropha curcas]
Length=258

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI K  VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVKASVKGSKTGWMSLSRNWGQNWQSNAILVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  238  WNIVPANWQFGQTFTGKNFR  257



>gb|KCW88943.1| hypothetical protein EUGRSUZ_A012692, partial [Eucalyptus grandis]
Length=102

 Score =   125 bits (314),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI +V VKGSRT W+ +SRNWGQNW+++A LVGQ+LSFRV  SD+R  TS
Sbjct  22   VLVTNVAGAGDIVRVNVKGSRTGWMGMSRNWGQNWQSNAVLVGQALSFRVTGSDKRTSTS  81

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAPA WQFGQTF+GKNFR
Sbjct  82   WNVAPAGWQFGQTFEGKNFR  101



>ref|XP_007218834.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
 gb|EMJ20033.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
Length=259

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGS+T W++LSRNWGQNW+++A L GQSLSFRV  SDRR  TS
Sbjct  179  VLITNVAGAGDIVKVSVKGSKTGWMSLSRNWGQNWQSNAVLAGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  239  WNIVPANWQFGQTFTGKNFR  258



>emb|CDP09064.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAG+I +V VKGSRT WI++SRNWGQNW+T+  LVGQSLSFRV ASDRR  TS
Sbjct  180  VLVTNVAGAGNIVRVSVKGSRTGWISMSRNWGQNWQTNGNLVGQSLSFRVAASDRRSSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  240  WNIAPAHWQFGQTFVGKNFR  259



>ref|XP_008802710.1| PREDICTED: expansin-A4 [Phoenix dactylifera]
Length=258

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W+ LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIMRASVKGSRTGWMPLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  238  WNIVPANWQFGQTFAGKNFR  257



>ref|XP_011089478.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=260

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V +KGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  180  VLITNVAGAGDIVRVSIKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP+NWQFGQTF GKNFR
Sbjct  240  WNIAPSNWQFGQTFVGKNFR  259



>ref|XP_004171474.1| PREDICTED: expansin-A4-like, partial [Cucumis sativus]
Length=119

 Score =   125 bits (315),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGS T W+++SRNWGQNW+++A LVGQ+LSFR+  SDRR  TS
Sbjct  39   VLITNVAGAGDIVKVSVKGSNTGWMSMSRNWGQNWQSNAVLVGQTLSFRLTGSDRRTSTS  98

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP+NWQFGQTF GKNFR
Sbjct  99   WNVAPSNWQFGQTFTGKNFR  118



>ref|XP_008233635.1| PREDICTED: expansin-A4-like [Prunus mume]
Length=259

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGS+T W++LSRNWGQNW+++A L GQSLSFRV  SDRR  TS
Sbjct  179  VLITNVAGAGDIVKVSVKGSKTGWMSLSRNWGQNWQSNAVLAGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  239  WNIVPANWQFGQTFTGKNFR  258



>gb|ACK36943.1| expansin [Annona cherimola]
Length=259

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKGSRT W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLITNVAGAGDIVRVSVKGSRTGWMAMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  239  WNIVPANWQFGQTFSGKNFR  258



>gb|ABB90846.1| expansin 5 [Cucumis sativus]
Length=109

 Score =   125 bits (314),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKG+RT W++L+RNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  29   VLITNVAGAGDIVRVSVKGTRTGWMSLTRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  88

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  89   WNIAPAHWQFGQTFTGKNFR  108



>gb|ADD14631.1| expansin precursor, partial [Solanum tuberosum]
Length=210

 Score =   128 bits (321),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +LVTNVAGAGDIQKVL+KG+ T WI +SRNWGQNW+T++ LVGQ+LS RV+ASD R VT+
Sbjct  130  LLVTNVAGAGDIQKVLIKGTNTQWIAMSRNWGQNWQTNSPLVGQALSIRVKASDHRSVTN  189

Query  79   WNVAPANWQFGQTFQGKNFR  20
             NVAP+NWQFGQTF+GKNFR
Sbjct  190  VNVAPSNWQFGQTFEGKNFR  209



>gb|AAX38235.1| expansin 10 [Cucumis sativus]
Length=126

 Score =   125 bits (315),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGS T W+++SRNWGQNW+++A LVGQ+LSFR+  SDRR  TS
Sbjct  46   VLITNVAGAGDIVKVSVKGSNTGWMSMSRNWGQNWQSNAVLVGQTLSFRLTGSDRRTSTS  105

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP+NWQFGQTF GKNFR
Sbjct  106  WNVAPSNWQFGQTFTGKNFR  125



>ref|XP_010264435.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI KV VKGS T W+T+SRNWGQNW+++A LVGQ+LSFR+  SD R  TS
Sbjct  180  VLVTNVAGAGDIVKVSVKGSNTGWLTMSRNWGQNWQSNAVLVGQALSFRITGSDHRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAPANWQFGQTF GKNFR
Sbjct  240  WNVAPANWQFGQTFTGKNFR  259



>gb|KDP35637.1| hypothetical protein JCGZ_09075 [Jatropha curcas]
Length=258

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLV+NVAGAGDI KV +KGS+T W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  178  VLVSNVAGAGDIVKVSIKGSKTDWLSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APANWQFGQTF GKNFR
Sbjct  238  WNIAPANWQFGQTFTGKNFR  257



>ref|XP_011031225.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=258

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGSRT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNV P+NWQFGQTF GKNFR
Sbjct  238  WNVVPSNWQFGQTFAGKNFR  257



>gb|AAR10411.2| EXP1 [Actinidia deliciosa]
Length=211

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAG+I +V VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV ASDRR  TS
Sbjct  131  VLISNVAGAGNIVRVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVAASDRRSSTS  190

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  191  WNIVPANWQFGQTFAGKNFR  210



>gb|AAR09168.1| alpha-expansin 1 [Populus tremula x Populus tremuloides]
Length=262

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKGS+T W+++SRNWGQNW+++A LVGQ+LSFRVRASDRR  TS
Sbjct  182  VLISNVAGAGDIVQVSVKGSKTGWMSMSRNWGQNWQSNAVLVGQTLSFRVRASDRRSSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  242  WNIVPAHWQFGQTFTGKNFR  261



>gb|AAY59532.1| expansin [Gossypium hirsutum]
Length=254

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  174  VLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  233

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  234  WNIVPAHWQFGQTFTGKNFR  253



>gb|KHF98169.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=210

 Score =   127 bits (320),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAG+GDI K  VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  130  VLITNVAGSGDIVKASVKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  189

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP+NWQFGQTF GKNFR
Sbjct  190  WNIAPSNWQFGQTFTGKNFR  209



>ref|NP_181300.1| expansin-A3 [Arabidopsis thaliana]
 ref|XP_004253297.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
 sp|O80932.1|EXPA3_ARATH RecName: Full=Expansin-A3; Short=AtEXPA3; AltName: Full=Alpha-expansin-3; 
Short=At-EXP3; Short=AtEx3; AltName: Full=Ath-ExpAlpha-1.9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC23634.1| putative expansin [Arabidopsis thaliana]
 gb|AAL91271.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AAM67431.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AEC09429.1| expansin-A3 [Arabidopsis thaliana]
Length=262

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI  V VKGS+T W+ +SRNWGQNW+++A L+GQSLSFRV ASDRR  TS
Sbjct  182  VLVTNVAGAGDINGVSVKGSKTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAPA WQFGQTF GKNFR
Sbjct  242  WNVAPATWQFGQTFSGKNFR  261



>ref|XP_002312101.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEE89468.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGSRT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNV P+NWQFGQTF GKNFR
Sbjct  238  WNVVPSNWQFGQTFAGKNFR  257



>ref|XP_004300427.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=259

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLV+NVAGAGDI +V VKGSRT W++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  179  VLVSNVAGAGDIVRVSVKGSRTGWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  239  WNIVPANWQFGQTFTGKNFR  258



>ref|XP_006341021.1| PREDICTED: expansin-A3 [Solanum tuberosum]
Length=263

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +LVTNVAGAGDIQKVL+KG+ T WI +SRNWGQNW+T++ LVGQ+LS RV+ASD R VT+
Sbjct  183  LLVTNVAGAGDIQKVLIKGTNTQWIAMSRNWGQNWQTNSPLVGQALSIRVKASDHRSVTN  242

Query  79   WNVAPANWQFGQTFQGKNFR  20
             NVAP+NWQFGQTF+GKNFR
Sbjct  243  VNVAPSNWQFGQTFEGKNFR  262



>gb|AFZ78606.1| expansin protein [Populus tomentosa]
Length=262

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKGS+T W+++SRNWGQNW+++A LVGQ+LSFRVRASDRR  TS
Sbjct  182  VLISNVAGAGDIVQVSVKGSKTGWMSMSRNWGQNWQSNAVLVGQTLSFRVRASDRRSSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  242  WNIVPAHWQFGQTFTGKNFR  261



>ref|XP_011077214.1| PREDICTED: expansin-A6-like [Sesamum indicum]
Length=259

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+ +SRNWGQNW+++A LVGQSLSFRV+ASD R  T+
Sbjct  179  VLISNVAGAGDIMKVWVKGSRTGWMAMSRNWGQNWQSNAVLVGQSLSFRVKASDHRSSTA  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  239  WNIVPSNWQFGQTFTGKNFR  258



>ref|NP_001234081.1| expansin A4 precursor [Solanum lycopersicum]
 gb|AAD13632.1| expansin precursor [Solanum lycopersicum]
Length=263

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +LVTNVAGAGDIQKVL+KG+ T WI +SRNWGQNW+T++ LVGQ+LS RV+ASD R VT+
Sbjct  183  LLVTNVAGAGDIQKVLIKGTNTQWIAMSRNWGQNWQTNSPLVGQALSIRVKASDHRSVTN  242

Query  79   WNVAPANWQFGQTFQGKNFR  20
             NVAP+NWQFGQTF+GKNFR
Sbjct  243  VNVAPSNWQFGQTFEGKNFR  262



>gb|ADD14630.1| expansin precursor, partial [Solanum tuberosum]
Length=210

 Score =   127 bits (320),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI  + +KGS+T WI++SRNWGQNW+T++ L GQSLSFRVRA DRR  TS
Sbjct  130  VLVTNVAGAGDIVSLSIKGSKTNWISMSRNWGQNWQTNSVLFGQSLSFRVRAGDRRSSTS  189

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  190  WNIAPAHWQFGQTFVGKNFR  209



>ref|XP_006435550.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 ref|XP_006486470.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|ESR48790.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 gb|KDO69285.1| hypothetical protein CISIN_1g024916mg [Citrus sinensis]
Length=260

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI K  VKGSRT W++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  180  VLITNVAGAGDIVKASVKGSRTGWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  240  WNIVPANWQFGQTFTGKNFR  259



>gb|ACB72461.1| expansin 2 [Ipomoea batatas]
Length=192

 Score =   127 bits (318),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +L+TNV GAGDI +  VKGS+T W+ LSRNWGQNW+T+A L+GQSLSFRVR SDRR  TS
Sbjct  112  ILITNVGGAGDIVRASVKGSKTGWMDLSRNWGQNWQTNAELMGQSLSFRVRGSDRRSSTS  171

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP+NWQFGQTF GKNFR
Sbjct  172  WNIAPSNWQFGQTFVGKNFR  191



>dbj|BAH36867.1| alpha expansin [Torenia fournieri]
Length=130

 Score =   125 bits (314),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI +V +KG+ T WI +SRNWGQNW++SA LVGQ+LSFRV ASDRR  TS
Sbjct  50   VLVTNVAGAGDIVRVSIKGTHTQWIPMSRNWGQNWQSSATLVGQALSFRVTASDRRSSTS  109

Query  79   WNVAPANWQFGQTFQGKNFR  20
             NVAP NWQFGQTF GKNFR
Sbjct  110  MNVAPPNWQFGQTFMGKNFR  129



>ref|XP_002283530.1| PREDICTED: expansin-A4 [Vitis vinifera]
Length=258

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRASVKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  238  WNIAPAHWQFGQTFSGKNFR  257



>ref|XP_003519349.1| PREDICTED: expansin-A4-like [Glycine max]
Length=257

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI K  VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV ASDRR  TS
Sbjct  177  VLITNVAGAGDIVKTSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNF+
Sbjct  237  WNLVPANWQFGQTFTGKNFK  256



>gb|ADY68814.1| expansin [Gossypium barbadense]
 gb|ADY68816.1| expansin [Gossypium herbaceum subsp. africanum]
 gb|AEN70897.1| expansin [Gossypium darwinii]
 gb|AEN70899.1| expansin [Gossypium tomentosum]
 gb|AEN70903.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70905.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70909.1| expansin [Gossypium davidsonii]
 gb|AEN70910.1| expansin [Gossypium klotzschianum]
 gb|KJB20062.1| hypothetical protein B456_003G131000 [Gossypium raimondii]
Length=259

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  239  WNIVPAHWQFGQTFTGKNFR  258



>ref|XP_009419260.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIIRASVKGSRTGWMPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTFQGKNFR
Sbjct  238  WNIVPSNWQFGQTFQGKNFR  257



>gb|AEN70900.1| expansin [Gossypium tomentosum]
Length=259

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  239  WNIVPAHWQFGQTFTGKNFR  258



>gb|ADY68817.1| expansin [Gossypium raimondii]
Length=259

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  239  WNIVPAHWQFGQTFTGKNFR  258



>ref|XP_006339024.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=257

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            ++VTNVAGAGDIQ+V VKG+ T WI +SRNWGQNW+++A L GQ+LSF+V+ SDRR VTS
Sbjct  177  IIVTNVAGAGDIQQVQVKGTNTKWIIMSRNWGQNWQSNALLTGQALSFKVKTSDRRYVTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            +NVAP+NWQFGQT+QGKN+R
Sbjct  237  YNVAPSNWQFGQTYQGKNYR  256



>gb|ADY68815.1| expansin [Gossypium barbadense]
 gb|ADY68819.1| expansin [Gossypium hirsutum]
 gb|AEN70892.1| expansin [Gossypium laxum]
 gb|AEN70894.1| expansin [Gossypium turneri]
 gb|AEN70896.1| expansin [Gossypium mustelinum]
 gb|AEN70898.1| expansin [Gossypium darwinii]
 gb|AEN70902.1| expansin [Gossypium barbadense var. brasiliense]
 gb|AEN70904.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70906.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70908.1| expansin [Gossypium harknessii]
 gb|AEN70911.1| expansin [Gossypium aridum]
 gb|AEN70912.1| expansin [Gossypium gossypioides]
 gb|AEN70913.1| expansin [Gossypium lobatum]
Length=259

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  239  WNIVPAHWQFGQTFTGKNFR  258



>gb|ADY68818.1| expansin [Gossypium hirsutum]
Length=259

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  239  WNIVPAHWQFGQTFTGKNFR  258



>ref|XP_009587747.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=259

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +LVTNVAGAGDIQKVL+KG+ T WI +SRNWGQNW+T+A LVG++LS RV+ASD R VTS
Sbjct  179  LLVTNVAGAGDIQKVLIKGTNTQWIAMSRNWGQNWQTNAVLVGKALSIRVKASDHRSVTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
             NVAP NWQFGQTF GKNFR
Sbjct  239  NNVAPPNWQFGQTFVGKNFR  258



>gb|AEN70893.1| expansin [Gossypium schwendimanii]
Length=259

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  239  WNIVPAHWQFGQTFTGKNFR  258



>ref|XP_010920576.1| PREDICTED: expansin-A4-like [Elaeis guineensis]
Length=260

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVA AGDI +V VKGSRT W+ +SRNWGQNW+++A LVGQSLSFRV ASDRR  TS
Sbjct  180  VLITNVASAGDIVRVSVKGSRTGWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  240  WNIVPANWQFGQTFAGKNFR  259



>gb|AEN70895.1| expansin [Gossypium mustelinum]
Length=259

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  239  WNIVPAHWQFGQTFTGKNFR  258



>ref|XP_007016396.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY34015.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=258

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV   DRR  TS
Sbjct  178  VLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGGDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  238  WNIVPANWQFGQTFAGKNFR  257



>gb|KDP20458.1| hypothetical protein JCGZ_05303 [Jatropha curcas]
Length=260

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKG+RT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  180  VLISNVAGAGDIVKVSVKGTRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRSSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  240  WNIVPSNWQFGQTFSGKNFR  259



>ref|XP_006410954.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
 dbj|BAJ34443.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52407.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
Length=263

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI  V VKGS+T W+ +SRNWGQNW+++A L+GQSLSFRV ASDRR  TS
Sbjct  183  VLITNVAGAGDITGVSVKGSKTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTS  242

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAPA WQFGQTF GKNFR
Sbjct  243  WNVAPATWQFGQTFSGKNFR  262



>ref|XP_010937609.1| PREDICTED: expansin-A4 [Elaeis guineensis]
Length=260

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKGS T W+ +SRNWGQNW+++A LVGQSLSFRV ASD R+ TS
Sbjct  180  VLITNVAGAGDIVRVSVKGSHTGWMPMSRNWGQNWQSNAVLVGQSLSFRVTASDHRRSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  240  WNIVPANWQFGQTFAGKNFR  259



>ref|XP_007009225.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY18035.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=259

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI K  VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLITNVAGAGDIVKASVKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  239  WNIVPSNWQFGQTFTGKNFR  258



>ref|XP_006846223.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
 gb|ERN07898.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
Length=258

 Score =   128 bits (321),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW++++ LVGQ+LSFRV +SDRR  TS
Sbjct  178  VLISNVAGAGDIVKVWVKGSRTGWMSMSRNWGQNWQSNSILVGQALSFRVTSSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNV PANWQFGQTF GKNFR
Sbjct  238  WNVVPANWQFGQTFTGKNFR  257



>ref|XP_006350774.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=260

 Score =   128 bits (321),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI  + +KGS+T WI++SRNWGQNW+T++ L GQSLSFRVRA DRR  TS
Sbjct  180  VLVTNVAGAGDIVSLSIKGSKTNWISMSRNWGQNWQTNSVLFGQSLSFRVRAGDRRSSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  240  WNIAPAHWQFGQTFIGKNFR  259



>gb|AGR44459.1| expansin 7, partial [Pyrus x bretschneideri]
Length=205

 Score =   127 bits (318),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+ NVAGAGDI K  VKG+ TPW++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  125  VLIHNVAGAGDIVKAYVKGTNTPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  184

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  185  WNIVPSNWQFGQTFTGKNFR  204



>ref|XP_007140533.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
 gb|ESW12527.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
Length=258

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKGS+T W+++SRNWGQNW+++A LVGQ+LSFR+  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRVSVKGSKTAWLSMSRNWGQNWQSNAVLVGQTLSFRITGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP NWQFGQTF GKNFR
Sbjct  238  WNVAPPNWQFGQTFTGKNFR  257



>ref|XP_010922313.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A4-like [Elaeis guineensis]
Length=258

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRASVKGSRTGWMPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  238  WNIVPANWQFGQTFAGKNFR  257



>gb|KJB78839.1| hypothetical protein B456_013G022200 [Gossypium raimondii]
Length=258

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAG+GDI K  VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGSGDIVKASVKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP+NWQFGQTF GKNFR
Sbjct  238  WNIAPSNWQFGQTFTGKNFR  257



>ref|XP_010931278.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A7 [Elaeis guineensis]
Length=258

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKGSRT W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRVSVKGSRTGWMPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTTTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNF+
Sbjct  238  WNIVPANWQFGQTFAGKNFQ  257



>ref|XP_010256907.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGS+T W+++SRNWGQNW+++A LVGQSLSFR+  SDRR  TS
Sbjct  180  VLITNVAGAGDIVKVSVKGSQTGWMSMSRNWGQNWQSNAVLVGQSLSFRITGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNV P+NWQFGQTF GKNFR
Sbjct  240  WNVVPSNWQFGQTFTGKNFR  259



>ref|XP_006294816.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
 gb|EOA27714.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
Length=262

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI  V VKGS+T W+ +SRNWGQNW+++A L+GQSLSFRV ASDRR  TS
Sbjct  182  VLVTNVAGAGDINGVSVKGSKTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP +WQFGQTF GKNFR
Sbjct  242  WNVAPPSWQFGQTFSGKNFR  261



>ref|XP_008461679.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=260

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +L+TNVAGAGDI K  VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV +SDRR  TS
Sbjct  180  ILITNVAGAGDIVKASVKGSKTEWMSMSRNWGQNWQSNAILVGQSLSFRVTSSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  240  WNIVPSNWQFGQTFTGKNFR  259



>ref|XP_004147685.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004161909.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN50556.1| hypothetical protein Csa_5G182120 [Cucumis sativus]
Length=259

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +L+TNVAGAGDI K  VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV +SDRR  TS
Sbjct  179  ILITNVAGAGDIVKASVKGSKTEWMSMSRNWGQNWQSNAILVGQSLSFRVTSSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  239  WNIVPSNWQFGQTFTGKNFR  258



>ref|XP_002881524.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002881525.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57783.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57784.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI  V VKGS+T W+ +SRNWGQNW+++A L+GQSLSFRV ASDRR  TS
Sbjct  182  VLVTNVAGAGDINGVSVKGSKTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP+ WQFGQTF GKNFR
Sbjct  242  WNVAPSTWQFGQTFSGKNFR  261



>dbj|BAC67194.1| expansin [Pyrus communis]
Length=261

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+ NVAGAGDI K  VKG+ TPW++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  181  VLIHNVAGAGDIVKAYVKGTNTPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  240

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  241  WNIVPSNWQFGQTFTGKNFR  260



>gb|AAV85475.1| expansin [Populus tomentosa]
Length=258

 Score =   127 bits (320),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGD+ KV VKGSRT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDLVKVSVKGSRTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNV P NWQFGQTF GKNFR
Sbjct  238  WNVVPPNWQFGQTFAGKNFR  257



>ref|XP_002533155.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
 gb|EEF29236.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
Length=201

 Score =   126 bits (317),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGD+ K  VKGS+T W+T+SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  121  VLITNVAGAGDVVKASVKGSKTGWMTMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  180

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  181  WNIVPSNWQFGQTFTGKNFR  200



>ref|XP_008371813.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+ NVAGAGDI K  VKG+ TPW++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  181  VLIHNVAGAGDIVKAYVKGTNTPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  240

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  241  WNIVPSNWQFGQTFTGKNFR  260



>gb|ABK93541.1| unknown [Populus trichocarpa]
Length=258

 Score =   127 bits (320),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKG RT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVKVSVKGCRTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNV P+NWQFGQTF GKNFR
Sbjct  238  WNVVPSNWQFGQTFAGKNFR  257



>gb|EYU18981.1| hypothetical protein MIMGU_mgv1a012125mg [Erythranthe guttata]
Length=260

 Score =   127 bits (320),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI ++ +KG+RT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  180  VLVTNVAGAGDIVRLSIKGTRTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APANWQFGQTF GKNFR
Sbjct  240  WNIAPANWQFGQTFVGKNFR  259



>ref|XP_010517036.1| PREDICTED: expansin-A3 [Camelina sativa]
Length=262

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI  V VKGS+T W+ +SRNWGQNW+++A L+GQSLSFRV ASDRR  TS
Sbjct  182  VLVTNVAGAGDINGVSVKGSKTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP +WQFGQTF GKNFR
Sbjct  242  WNVAPPSWQFGQTFSGKNFR  261



>ref|XP_004143121.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004166197.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN47143.1| hypothetical protein Csa_6G190340 [Cucumis sativus]
Length=258

 Score =   127 bits (320),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKG+RT W++L+RNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRVSVKGTRTGWMSLTRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  238  WNIAPAHWQFGQTFTGKNFR  257



>gb|KCW85559.1| hypothetical protein EUGRSUZ_B02358, partial [Eucalyptus grandis]
Length=97

 Score =   123 bits (308),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKG+RT W+++SRNWGQNW+++A LVGQ+LSFRV ASDRR  TS
Sbjct  17   VLISNVAGAGDIVRVSVKGARTGWMSMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSTS  76

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA WQFGQTF GKNFR
Sbjct  77   WNMVPAGWQFGQTFTGKNFR  96



>ref|XP_009357738.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
 ref|XP_009357739.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   127 bits (320),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+ NVAGAGDI K  VKG+ TPW++LSRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  181  VLIHNVAGAGDIVKAYVKGTNTPWMSLSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  240

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  241  WNIVPSNWQFGQTFTGKNFR  260



>gb|AIE54285.1| expansin [Nicotiana tabacum]
Length=257

 Score =   127 bits (320),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            V+VTNVAGAGDIQKV VKG+ T W+ +SRNWGQNW+++A LVGQ+LSF+V+ASD R VT+
Sbjct  177  VIVTNVAGAGDIQKVFVKGTNTKWMAMSRNWGQNWQSNAQLVGQALSFKVKASDHRYVTT  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            +NVAP+NWQFGQT++ KNFR
Sbjct  237  YNVAPSNWQFGQTYEAKNFR  256



>gb|KJB76740.1| hypothetical protein B456_012G104400 [Gossypium raimondii]
Length=264

 Score =   127 bits (320),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI KV VKG+ T W+++SRNWGQNW+++A LVGQ LSFRV  SDRR  TS
Sbjct  184  VLVTNVAGAGDIVKVSVKGTNTGWLSMSRNWGQNWQSNAVLVGQQLSFRVTGSDRRTSTS  243

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APANWQFGQTF GKNFR
Sbjct  244  WNMAPANWQFGQTFTGKNFR  263



>ref|XP_008799850.1| PREDICTED: expansin-A6-like [Phoenix dactylifera]
Length=260

 Score =   127 bits (320),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI ++ VKGSRT W+ +SRNWGQNW+++A LVGQSLSFR+ ASDRR  TS
Sbjct  180  VLVTNVAGAGDIVRLSVKGSRTGWMPMSRNWGQNWQSNAVLVGQSLSFRLTASDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  240  WNIVPAHWQFGQTFAGKNFR  259



>ref|NP_001288899.1| expansin-A6 precursor [Brassica rapa]
 gb|AGM16348.1| alpha-expansin protein 6 [Brassica rapa]
Length=260

 Score =   127 bits (320),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAG+I ++ VKG+RT W+++SRNWGQNW++++ LVGQSLSFRV ASDRR  TS
Sbjct  180  VLVTNVAGAGNIVRLSVKGTRTSWMSMSRNWGQNWQSNSVLVGQSLSFRVTASDRRSSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  240  WNIAPAHWQFGQTFTGKNFR  259



>gb|KJB55836.1| hypothetical protein B456_009G098800 [Gossypium raimondii]
Length=259

 Score =   127 bits (320),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGD+ KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDLVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  239  WNIVPAHWQFGQTFTGKNFR  258



>ref|NP_191109.1| expansin A16 [Arabidopsis thaliana]
 sp|Q9M2S9.1|EXP16_ARATH RecName: Full=Expansin-A16; Short=AtEXPA16; AltName: Full=Alpha-expansin-16; 
Short=At-EXP16; Short=AtEx16; AltName: Full=Ath-ExpAlpha-1.7; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB75908.1| expansin-like protein [Arabidopsis thaliana]
 dbj|BAD43638.1| expansin-like protein [Arabidopsis thaliana]
 gb|AEE79393.1| expansin A16 [Arabidopsis thaliana]
Length=260

 Score =   127 bits (320),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGS+T W++L+RNWGQNW+++A LVGQSLSFRV +SDRR  TS
Sbjct  180  VLITNVAGAGDIARTSVKGSKTGWMSLTRNWGQNWQSNAVLVGQSLSFRVTSSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP+NWQFGQTF GKNFR
Sbjct  240  WNIAPSNWQFGQTFVGKNFR  259



>gb|AAP48989.1| expansin [Sambucus nigra]
Length=256

 Score =   127 bits (319),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKGSRT W+++SRNWGQNW+++  LVGQSLSFRV  SDRR  TS
Sbjct  176  VLISNVAGAGDIVRVSVKGSRTGWMSMSRNWGQNWQSNTVLVGQSLSFRVTGSDRRTSTS  235

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  236  WNIVPANWQFGQTFTGKNFR  255



>emb|CDY20467.1| BnaC04g05770D [Brassica napus]
Length=256

 Score =   127 bits (319),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  176  VLITNVAGAGDIVRTSVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  235

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  236  WNIVPSNWQFGQTFVGKNFR  255



>ref|XP_009772489.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=257

 Score =   127 bits (319),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            V+VTNVAGAGDIQKV VKG+ T W+ +SRNWGQNW+++A LVGQ+LSF+V+ASD R VT+
Sbjct  177  VIVTNVAGAGDIQKVFVKGTNTKWMAMSRNWGQNWQSNAQLVGQALSFKVKASDHRYVTT  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            +NVAP+NWQFGQT++ KNFR
Sbjct  237  YNVAPSNWQFGQTYEAKNFR  256



>ref|XP_004490888.1| PREDICTED: expansin-A4-like [Cicer arietinum]
Length=260

 Score =   127 bits (319),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI K  VKGS++ W+++SRNWGQNW+++A L+GQSLSFRV ASDRR  TS
Sbjct  180  VLITNVAGAGDIVKTSVKGSKSGWMSMSRNWGQNWQSNAILIGQSLSFRVTASDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  240  WNIVPSNWQFGQTFTGKNFR  259



>ref|XP_009610453.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=257

 Score =   127 bits (319),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            V+VTNVAGAGDIQKV VKG+ T W+ +SRNWGQNW+++A LVGQ+LSF+V+ASD R VT+
Sbjct  177  VIVTNVAGAGDIQKVFVKGTNTKWMAMSRNWGQNWQSNAQLVGQALSFKVKASDHRYVTT  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            +NVAP+NWQFGQT++ KNFR
Sbjct  237  YNVAPSNWQFGQTYEAKNFR  256



>ref|XP_007141864.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
 gb|ESW13858.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
Length=260

 Score =   127 bits (319),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGD+ +  VKG++T W+++SRNWGQNW+++A LVGQSLSFRV ASDRR  TS
Sbjct  180  VLITNVAGAGDVVRTSVKGAKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  240  WNIVPANWQFGQTFTGKNFR  259



>gb|KHG20113.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=259

 Score =   127 bits (319),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGD+ KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDLVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  239  WNIVPAHWQFGQTFTGKNFR  258



>ref|XP_010685747.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   127 bits (319),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLV+NVAGAGDI  V +KGS+T W+ +SRNWGQNW++++ LVGQSLSFRVR SD+R  TS
Sbjct  181  VLVSNVAGAGDIVNVYIKGSKTNWMAMSRNWGQNWQSNSVLVGQSLSFRVRGSDKRSSTS  240

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP+NWQFGQTF GKNFR
Sbjct  241  WNIAPSNWQFGQTFTGKNFR  260



>emb|CDY07024.1| BnaA04g22910D [Brassica napus]
Length=258

 Score =   127 bits (319),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRTSVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  238  WNIVPSNWQFGQTFVGKNFR  257



>emb|CDY24952.1| BnaC03g22200D [Brassica napus]
Length=258

 Score =   127 bits (319),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRTSVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  238  WNIVPSNWQFGQTFVGKNFR  257



>gb|ACO07292.1| expansin 10 [Cucumis sativus]
Length=259

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGS T W+++SRNWGQNW+++A LVGQ+LSFR+  SDRR  TS
Sbjct  179  VLITNVAGAGDIVKVSVKGSNTGWMSMSRNWGQNWQSNAVLVGQTLSFRLTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP+NWQFGQTF GKNFR
Sbjct  239  WNVAPSNWQFGQTFTGKNFR  258



>gb|AEN70907.1| expansin [Gossypium armourianum]
Length=259

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P++WQFGQTF GKNFR
Sbjct  239  WNIVPSHWQFGQTFTGKNFR  258



>gb|AEN70891.1| expansin [Gossypium thurberi]
Length=259

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P++WQFGQTF GKNFR
Sbjct  239  WNIVPSHWQFGQTFTGKNFR  258



>ref|XP_004142066.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN54256.1| hypothetical protein Csa_4G296100 [Cucumis sativus]
Length=259

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGS T W+++SRNWGQNW+++A LVGQ+LSFR+  SDRR  TS
Sbjct  179  VLITNVAGAGDIVKVSVKGSNTGWMSMSRNWGQNWQSNAVLVGQTLSFRLTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP+NWQFGQTF GKNFR
Sbjct  239  WNVAPSNWQFGQTFTGKNFR  258



>ref|XP_006411198.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
 gb|ESQ52651.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
Length=258

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRTSVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  238  WNIVPSNWQFGQTFVGKNFR  257



>gb|ABO32367.1| expansin [Litchi chinensis]
Length=256

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI KV VKGS+T W+T+SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  176  VLVTNVAGAGDIVKVSVKGSKTGWLTMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  235

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVA +NWQFGQTF GKNFR
Sbjct  236  WNVAKSNWQFGQTFVGKNFR  255



>gb|AHL25255.1| expansin [Boehmeria nivea]
Length=260

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +L++NVAG+GDI +  VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  180  ILISNVAGSGDIVRASVKGSKTGWMSLSRNWGQNWQSNAALVGQSLSFRVTGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APANWQFGQTF GKNFR
Sbjct  240  WNIAPANWQFGQTFTGKNFR  259



>gb|AEN70914.1| expansin [Gossypium trilobum]
Length=259

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDIVKVSVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P++WQFGQTF GKNFR
Sbjct  239  WNIVPSHWQFGQTFTGKNFR  258



>ref|XP_010521846.1| PREDICTED: expansin-A6 [Tarenaya hassleriana]
Length=259

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGD+ +V VKGSRT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  179  VLVTNVAGAGDVVRVSVKGSRTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP++WQFGQTF GKNFR
Sbjct  239  WNIAPSHWQFGQTFVGKNFR  258



>ref|NP_001284471.1| expansin-A4 precursor [Cucumis melo]
 gb|ABI94060.1| ripening-related expansin [Cucumis melo]
Length=259

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKGS T W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  179  VLITNVAGAGDIVRVSVKGSNTGWMSMSRNWGQNWQSNAVLVGQTLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP+NWQFGQTF GKNFR
Sbjct  239  WNVAPSNWQFGQTFTGKNFR  258



>gb|AEN70901.1| expansin [Gossypium barbadense var. brasiliense]
Length=259

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI K  VKGSRT W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDIVKASVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  239  WNIVPAHWQFGQTFTGKNFR  258



>ref|XP_009381075.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W+ +SRNWGQNW+++A LVGQ LSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRASVKGSRTGWMPMSRNWGQNWQSNAVLVGQPLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFRA  17
            WN+ P+NWQFGQTF+GKN+RA
Sbjct  238  WNIVPSNWQFGQTFEGKNYRA  258



>emb|CDX74845.1| BnaA05g05910D [Brassica napus]
Length=180

 Score =   125 bits (313),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKG+RT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  100  VLITNVAGAGDIVRTSVKGTRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  159

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  160  WNIVPSNWQFGQTFVGKNFR  179



>emb|CAN73252.1| hypothetical protein VITISV_027049 [Vitis vinifera]
Length=247

 Score =   126 bits (317),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI K  VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SD R  TS
Sbjct  167  VLITNVAGAGDIVKASVKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTSTS  226

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  227  WNIVPSNWQFGQTFSGKNFR  246



>ref|XP_002283358.1| PREDICTED: expansin-A4 [Vitis vinifera]
 emb|CBI31662.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI K  VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SD R  TS
Sbjct  178  VLITNVAGAGDIVKASVKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  238  WNIVPSNWQFGQTFSGKNFR  257



>gb|KHG12963.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=190

 Score =   125 bits (313),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV +KG+ T W ++SRNWGQNW+++  LVGQ+LSFRV+ SD+R  TS
Sbjct  110  VLITNVAGAGDIVKVSIKGTNTGWTSMSRNWGQNWQSNVVLVGQALSFRVKGSDKRTSTS  169

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP NWQFGQTF GKNFR
Sbjct  170  WNVAPTNWQFGQTFTGKNFR  189



>ref|XP_010505357.1| PREDICTED: expansin-A3-like [Camelina sativa]
Length=262

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI  V VKG++T W+ +SRNWGQNW+++A L+GQSLSFRV ASDRR  TS
Sbjct  182  VLVTNVAGAGDINGVSVKGTKTEWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP +WQFGQTF GKNFR
Sbjct  242  WNVAPPSWQFGQTFSGKNFR  261



>gb|AAZ08313.1| putative alpha-expansin [Eucalyptus globulus]
Length=206

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI K+ VKGS+T WI++SRNWGQNW++++ L GQSLSFRV A DRR  TS
Sbjct  126  VLVTNVAGAGDINKLWVKGSKTGWISMSRNWGQNWQSNSVLAGQSLSFRVTAGDRRTSTS  185

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  186  WNIVPSNWQFGQTFTGKNFR  205



>gb|KHG30766.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=262

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV +KG++T W+++SRNWGQNW+++A L+GQ+LSFRV  SD+R  TS
Sbjct  182  VLITNVAGAGDIVKVSIKGTKTGWMSMSRNWGQNWQSNAVLIGQALSFRVTGSDKRTSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP+NWQFGQTF GKNFR
Sbjct  242  WNVAPSNWQFGQTFTGKNFR  261



>gb|AAT11859.2| expansin 1 [Mangifera indica]
Length=260

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+ +VAG+GDI KV VKG+RT W+++SRNWGQNW+++  LVGQ+LSFRVRASDRR  TS
Sbjct  180  VLIADVAGSGDIVKVSVKGTRTGWMSMSRNWGQNWQSNTVLVGQALSFRVRASDRRSSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  240  WNIVPANWQFGQTFVGKNFR  259



>ref|XP_003544219.1| PREDICTED: expansin-A6-like [Glycine max]
Length=260

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV ASDRR  TS
Sbjct  180  VLITNVAGAGDIVRTSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF  KNFR
Sbjct  240  WNIVPANWQFGQTFTAKNFR  259



>ref|XP_006480833.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO51152.1| hypothetical protein CISIN_1g025025mg [Citrus sinensis]
Length=259

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI +V VKG+ T W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  179  VLVTNVAGAGDIVRVSVKGANTQWLSMSRNWGQNWQSNAQLVGQALSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAPANWQFGQTF GKNFR
Sbjct  239  WNVAPANWQFGQTFSGKNFR  258



>emb|CDY31742.1| BnaA04g16780D [Brassica napus]
Length=260

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAG+I ++ VKG+RT W+++SRNWGQNW++++ LVGQ+LSFRV ASDRR  TS
Sbjct  180  VLVTNVAGAGNIVRLSVKGTRTSWMSMSRNWGQNWQSNSVLVGQALSFRVTASDRRSSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  240  WNIAPAHWQFGQTFMGKNFR  259



>gb|KHN07565.1| Expansin-A4 [Glycine soja]
Length=208

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  128  VLITNVAGAGDIMRASVKGSKTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  187

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P NWQFGQTF GKNFR
Sbjct  188  WNIVPRNWQFGQTFAGKNFR  207



>gb|KHN13987.1| Expansin-A4 [Glycine soja]
Length=123

 Score =   123 bits (308),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V +KGS+T W+++SRNWGQNW+++A LVGQ+LSFRV  SD+R  TS
Sbjct  43   VLITNVAGAGDIVRVSMKGSKTAWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDQRTSTS  102

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP NWQFGQTF GKNFR
Sbjct  103  WNLAPPNWQFGQTFTGKNFR  122



>ref|XP_006429095.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
 gb|ESR42335.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
Length=259

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI +V VKG+ T W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  179  VLVTNVAGAGDIVRVSVKGANTQWLSMSRNWGQNWQSNAQLVGQALSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAPANWQFGQTF GKNFR
Sbjct  239  WNVAPANWQFGQTFSGKNFR  258



>ref|XP_009409019.1| PREDICTED: expansin-A4-like [Musa acuminata subsp. malaccensis]
Length=257

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W+ +SRNWGQNW+++A LVGQSLSFR+  SDRR  TS
Sbjct  177  VLITNVAGAGDIVRASVKGSRTGWMPMSRNWGQNWQSNAVLVGQSLSFRLTGSDRRTSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF+GKNFR
Sbjct  237  WNIVPSNWQFGQTFEGKNFR  256



>ref|XP_002878036.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54295.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
Length=260

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGS+T W++L+RNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  180  VLITNVAGAGDILRTSVKGSKTGWMSLTRNWGQNWQSNAVLVGQSLSFRVTTSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP+NWQFGQTF GKNFR
Sbjct  240  WNIAPSNWQFGQTFVGKNFR  259



>ref|NP_001288852.1| expansin-A3 precursor [Brassica rapa]
 gb|AGM16345.1| alpha-expansin protein 3 [Brassica rapa]
 emb|CDX91376.1| BnaC04g07740D [Brassica napus]
Length=263

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI  V VKGS+T W+ +SRNWGQNW+++A L+GQ+LSFRV ASDRR  TS
Sbjct  183  VLVTNVAGAGDINGVSVKGSKTDWVRMSRNWGQNWQSNAVLIGQALSFRVTASDRRSSTS  242

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP +WQFGQTF GKNFR
Sbjct  243  WNVAPPSWQFGQTFSGKNFR  262



>ref|XP_002881669.1| ATEXPA4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57928.1| ATEXPA4 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  177  VLITNVAGAGDIVRASVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  237  WNMVPSNWQFGQTFVGKNFR  256



>ref|XP_009757427.1| PREDICTED: expansin-A4-like [Nicotiana sylvestris]
Length=261

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGS+T WI+LSRNWGQNW+++A L GQSLSFRV+ASD R  TS
Sbjct  181  VLITNVAGAGDIIKVWVKGSKTNWISLSRNWGQNWQSNAVLTGQSLSFRVKASDHRSSTS  240

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P++WQFGQTF GKNF+
Sbjct  241  WNIVPSHWQFGQTFTGKNFK  260



>gb|AAR82850.1| expansin-2 [Petunia x hybrida]
Length=262

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+ NVAGAGDI KV VKG++T WI LSRNWGQNW+T++ L GQSLSFRV+ASD R  TS
Sbjct  182  VLIPNVAGAGDIIKVWVKGTKTNWIPLSRNWGQNWQTNSILTGQSLSFRVKASDHRTSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP++WQFGQTF GKNFR
Sbjct  242  WNIAPSHWQFGQTFNGKNFR  261



>ref|XP_010043541.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
Length=114

 Score =   122 bits (307),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKG+RT W+++SRNWGQNW+++A LVGQ+LSFRV ASDRR  TS
Sbjct  34   VLISNVAGAGDIVRVSVKGARTGWMSMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSTS  93

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA WQFGQTF GKNFR
Sbjct  94   WNMVPAGWQFGQTFTGKNFR  113



>ref|XP_003552923.2| PREDICTED: expansin-A3-like [Glycine max]
Length=262

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  182  VLITNVAGAGDIMRASVKGSKTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P NWQFGQTF GKNFR
Sbjct  242  WNIVPRNWQFGQTFAGKNFR  261



>gb|ACT67493.1| expansin A1 [Raphanus sativus]
Length=258

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRTSVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQT+ GKNFR
Sbjct  238  WNIVPSNWQFGQTYVGKNFR  257



>ref|XP_009768238.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=257

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLV NVAGAGDI +V VKGS+T WIT+SRNWGQN++T++ L+GQSLSFRV ASDRR   S
Sbjct  177  VLVANVAGAGDIVRVYVKGSKTNWITMSRNWGQNYQTNSVLIGQSLSFRVTASDRRSSAS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP +WQFGQTF GKNFR
Sbjct  237  WNIAPPHWQFGQTFIGKNFR  256



>ref|XP_009143296.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=256

 Score =   126 bits (316),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKG+RT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  176  VLITNVAGAGDIVRTSVKGTRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  235

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  236  WNIVPSNWQFGQTFVGKNFR  255



>ref|XP_003543517.1| PREDICTED: expansin-A4 [Glycine max]
Length=257

 Score =   126 bits (316),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI    VKGSRT W+ +SRNWGQNW+++A LVGQ+LSFRV ASDRR  TS
Sbjct  177  VLISNVAGAGDIVHAYVKGSRTGWMPMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  237  WNIVPSNWQFGQTFTGKNFR  256



>ref|NP_001234761.1| expansin18 precursor [Solanum lycopersicum]
 emb|CAA06271.2| expansin18 [Solanum lycopersicum]
Length=260

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI  + +KGS+T WI++SRNWGQNW+T++ L GQSLSFRVRA DRR  TS
Sbjct  180  VLVTNVAGAGDIVSLSIKGSKTNWISMSRNWGQNWQTNSVLFGQSLSFRVRAGDRRSSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  240  WNITPAHWQFGQTFVGKNFR  259



>dbj|BAH36869.1| alpha expansin [Torenia fournieri]
Length=132

 Score =   122 bits (307),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 2/82 (2%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGS--RTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQV  86
            VLVTNVAGAGDI +V VKGS  ++ WI +SRNWGQNWE++A LVGQ+LSFRV ASDRR  
Sbjct  50   VLVTNVAGAGDIVRVSVKGSNKKSEWIAMSRNWGQNWESNALLVGQALSFRVTASDRRSS  109

Query  85   TSWNVAPANWQFGQTFQGKNFR  20
            TS NVAP NWQFGQTF GKNFR
Sbjct  110  TSMNVAPPNWQFGQTFTGKNFR  131



>gb|KHG29956.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=258

 Score =   126 bits (316),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI K  VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVKASVKGSKTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P++WQFGQTF GKNFR
Sbjct  238  WNIVPSHWQFGQTFTGKNFR  257



>emb|CDX74942.1| BnaA05g06880D [Brassica napus]
Length=263

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +LVTNVAGAGDI  V VKGS+T W+ +SRNWGQNW+++A L+GQ+LSFRV ASDRR  TS
Sbjct  183  ILVTNVAGAGDINGVSVKGSKTDWVRMSRNWGQNWQSNAVLIGQALSFRVTASDRRSSTS  242

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP +WQFGQTF GKNFR
Sbjct  243  WNVAPPSWQFGQTFSGKNFR  262



>gb|KJB73995.1| hypothetical protein B456_011G266000 [Gossypium raimondii]
Length=258

 Score =   126 bits (316),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI K  VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVKASVKGSKTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P++WQFGQTF GKNFR
Sbjct  238  WNIVPSHWQFGQTFTGKNFR  257



>ref|XP_009380637.1| PREDICTED: expansin-A4 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W+ +SRNWGQNW+++A LVGQSLSFRV  SD R  TS
Sbjct  182  VLITNVAGAGDIIRATVKGSRTGWMPMSRNWGQNWQSNAALVGQSLSFRVTGSDHRTSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA WQFGQTF GKNFR
Sbjct  242  WNIAPATWQFGQTFSGKNFR  261



>ref|XP_010528418.1| PREDICTED: expansin-A3 [Tarenaya hassleriana]
Length=264

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGD+ +  +KGS+T W+++SRNWGQNW+++A  VGQSLSFRV ASDRR  TS
Sbjct  184  VLITNVAGAGDVVRASIKGSKTAWMSMSRNWGQNWQSNAVFVGQSLSFRVTASDRRTSTS  243

Query  79   WNVAPANWQFGQTFQGKNFR  20
            +NVAPANWQFGQTF GKNFR
Sbjct  244  FNVAPANWQFGQTFSGKNFR  263



>ref|XP_009364387.1| PREDICTED: expansin-A4 [Pyrus x bretschneideri]
Length=260

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKG+RT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  180  VLISNVAGAGDIVRVSVKGARTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  240  WNIVPANWQFGQTFTGKNFR  259



>gb|KJB36710.1| hypothetical protein B456_006G172400 [Gossypium raimondii]
Length=264

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI KV VKG+ T W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  184  VLVTNVAGAGDIVKVKVKGTNTNWLSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  243

Query  79   WNVAPANWQFGQTFQGKNFR  20
             NVAPANWQFGQTF GKNFR
Sbjct  244  LNVAPANWQFGQTFTGKNFR  263



>ref|XP_004486999.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +  VKG+RT W+ +SRNWGQNW+++A LVGQSLSFRV +SDRR  TS
Sbjct  177  VLISNVAGAGDIVRTYVKGTRTRWMPMSRNWGQNWQSNAVLVGQSLSFRVTSSDRRTSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP NWQFGQTF GKNFR
Sbjct  237  WNIAPHNWQFGQTFTGKNFR  256



>ref|XP_009353647.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
 ref|XP_009349875.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKGSRT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  180  VLISNVAGAGDIVRVSVKGSRTDWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  240  WNIVPAHWQFGQTFTGKNFR  259



>emb|CAA04385.1| Expansin [Brassica napus]
Length=260

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAG+I ++ VKG+RT WI++SRNWGQNW++++ LVGQ+LSFRV ASDRR  TS
Sbjct  180  VLVTNVAGAGNIVRLSVKGTRTSWISMSRNWGQNWQSNSVLVGQALSFRVTASDRRSSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP +WQFGQTF GKNFR
Sbjct  240  WNIAPTHWQFGQTFMGKNFR  259



>ref|XP_008464122.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=258

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKG+RT W++L+RNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRVSVKGTRTGWMSLTRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  238  WNIVPAHWQFGQTFTGKNFR  257



>emb|CDX77222.1| BnaC04g40170D [Brassica napus]
Length=260

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAG+I ++ VKG+RT WI++SRNWGQNW++++ LVGQ+LSFRV ASDRR  TS
Sbjct  180  VLVTNVAGAGNIVRLSVKGTRTSWISMSRNWGQNWQSNSVLVGQALSFRVTASDRRSSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP +WQFGQTF GKNFR
Sbjct  240  WNIAPTHWQFGQTFMGKNFR  259



>ref|XP_007027012.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY07514.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=263

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI KV VKG++T W+++SRNWGQNW+++A LVGQ+LSFRV  SD+R  TS
Sbjct  183  VLVTNVAGAGDIVKVSVKGTKTGWLSMSRNWGQNWQSNAVLVGQALSFRVTGSDKRTSTS  242

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVA ANWQFGQTF GKNFR
Sbjct  243  WNVASANWQFGQTFTGKNFR  262



>gb|KHN32128.1| Expansin-A4 [Glycine soja]
Length=210

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +  VKG+RT W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  130  VLISNVAGAGDIVRTYVKGTRTGWMPMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  189

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP NWQFGQTF GKNFR
Sbjct  190  WNIAPPNWQFGQTFTGKNFR  209



>ref|XP_006409928.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
 gb|ESQ51381.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
Length=260

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAG+I ++ VKG+RT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  180  VLVTNVAGAGNIVRLSVKGTRTSWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  240  WNIAPAHWQFGQTFMGKNFR  259



>gb|KHG15821.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI KV VKG+ T W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  184  VLVTNVAGAGDIVKVKVKGTNTNWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  243

Query  79   WNVAPANWQFGQTFQGKNFR  20
             NVAPANWQFGQTF GKNFR
Sbjct  244  LNVAPANWQFGQTFTGKNFR  263



>ref|XP_009398502.1| PREDICTED: expansin-A7-like [Musa acuminata subsp. malaccensis]
Length=258

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKGSRT W+ +SRNWGQNW+++A LVG+SLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRVSVKGSRTGWMPMSRNWGQNWQSNAVLVGESLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+ WQFGQTF+GKNFR
Sbjct  238  WNIVPSTWQFGQTFEGKNFR  257



>gb|AEV43315.1| expansin A5 [Glycine max]
Length=211

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +  VKG+RT W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  131  VLISNVAGAGDIVRTYVKGTRTGWMPMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  190

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP NWQFGQTF GKNFR
Sbjct  191  WNIAPPNWQFGQTFTGKNFR  210



>gb|KFK32246.1| hypothetical protein AALP_AA6G217100 [Arabis alpina]
Length=257

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAG+I ++ VKG+RT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  177  VLVTNVAGAGNIVRLSVKGTRTSWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  237  WNIAPAHWQFGQTFMGKNFR  256



>ref|XP_008384848.1| PREDICTED: expansin-A4 [Malus domestica]
Length=260

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI KV VKG+RT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  180  VLISNVAGAGDIVKVSVKGARTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  240  WNIVPAHWQFGQTFTGKNFR  259



>ref|XP_010505648.1| PREDICTED: expansin-A4 [Camelina sativa]
Length=257

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +L+TNVAGAGDI +  VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  177  ILITNVAGAGDIVRANVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  237  WNMVPSNWQFGQTFVGKNFR  256



>gb|AEV43317.1| expansin A5b [Glycine max]
Length=200

 Score =   124 bits (311),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +  VKG+RT W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  120  VLISNVAGAGDIVRTYVKGTRTGWMPMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  179

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP NWQFGQTF GKNFR
Sbjct  180  WNIAPPNWQFGQTFTGKNFR  199



>gb|AFB77223.1| expansin 1 [Betula platyphylla]
Length=258

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGS+T W++LSRNWGQNW+++  L GQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVKVSVKGSKTEWMSLSRNWGQNWQSNVVLAGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P++WQFGQTF GKNFR
Sbjct  238  WNIVPSDWQFGQTFTGKNFR  257



>ref|XP_004249536.1| PREDICTED: expansin-A6-like [Solanum lycopersicum]
Length=257

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            ++VTNVAGAGDIQ+V VKG+ T WI +SRNWGQNW+++A L GQ+LSF+V+ SD R VTS
Sbjct  177  IIVTNVAGAGDIQQVQVKGTNTKWIIMSRNWGQNWQSNAMLTGQALSFKVKTSDHRYVTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            +NVAP+NWQFGQT++GKN+R
Sbjct  237  YNVAPSNWQFGQTYEGKNYR  256



>gb|AEE69071.1| expansin-4 [Petunia hybrid cultivar]
Length=248

 Score =   125 bits (314),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDIQ+V VKG+ T WI +SRNWGQNW+++A + GQ+LSFRVR SD+R   S
Sbjct  168  VLVTNVAGAGDIQQVYVKGTNTEWIAMSRNWGQNWQSNALIAGQALSFRVRGSDQRSSAS  227

Query  79   WNVAPANWQFGQTFQGKNFR  20
             N+APANWQFGQTF+G+NFR
Sbjct  228  LNIAPANWQFGQTFEGENFR  247



>ref|NP_001276255.1| expansin-A4-like precursor [Glycine max]
 gb|AEV43318.1| expansin A5c [Glycine max]
Length=220

 Score =   124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLV+NVAGAGDI +  VKG+RT W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  140  VLVSNVAGAGDIVRTYVKGTRTGWMPMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  199

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP NWQFGQTF GKNFR
Sbjct  200  WNIAPPNWQFGQTFTGKNFR  219



>ref|XP_009141827.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=258

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -1

Query  256  LVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTSW  77
            L+TNVAGAGDI +  VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TSW
Sbjct  179  LITNVAGAGDIVRTSVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTSW  238

Query  76   NVAPANWQFGQTFQGKNFR  20
            N+ P+NWQFGQTF GKNFR
Sbjct  239  NIVPSNWQFGQTFVGKNFR  257



>gb|KJB46592.1| hypothetical protein B456_007G376300 [Gossypium raimondii]
Length=262

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGD+ KV +KG++T W+++SRNWGQNW+++A L+GQ+LSFRV  SD+R  TS
Sbjct  182  VLITNVAGAGDLVKVSIKGTKTGWMSMSRNWGQNWQSNAVLIGQALSFRVTGSDKRTSTS  241

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP NWQFGQTF GKNFR
Sbjct  242  WNVAPPNWQFGQTFTGKNFR  261



>ref|XP_003552173.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V +KGS+T W+++SRNWGQNW+++A LVGQ+LSFRV  SD+R  TS
Sbjct  178  VLITNVAGAGDIVRVSMKGSKTAWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDQRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP NWQFGQTF GKNFR
Sbjct  238  WNVAPPNWQFGQTFTGKNFR  257



>gb|ABN09940.1| expansin A5 [Musa acuminata AAA Group]
Length=257

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W+ +SRNWGQNW+++A LVGQSLSFR+  SDRR  TS
Sbjct  177  VLITNVAGAGDIVRASVKGSRTGWMPMSRNWGQNWQSNADLVGQSLSFRLTGSDRRTSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF+GKNFR
Sbjct  237  WNIVPSNWQFGQTFEGKNFR  256



>ref|XP_010517323.1| PREDICTED: expansin-A4-like [Camelina sativa]
Length=257

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +L+TNVAGAGDI +  VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  177  ILITNVAGAGDIVRANVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  237  WNMVPSNWQFGQTFVGKNFR  256



>ref|NP_181500.1| expansin A4 [Arabidopsis thaliana]
 sp|O48818.1|EXPA4_ARATH RecName: Full=Expansin-A4; Short=AtEXPA4; AltName: Full=Alpha-expansin-4; 
Short=At-EXP4; Short=AtEx4; AltName: Full=Ath-ExpAlpha-1.6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK95263.1|AF410277_1 At2g39700/F17A14.7 [Arabidopsis thaliana]
 gb|AAB97125.1| putative expansin [Arabidopsis thaliana]
 gb|AAL32761.1| putative expansin [Arabidopsis thaliana]
 gb|AAM13337.1| putative expansin [Arabidopsis thaliana]
 gb|AEC09708.1| expansin A4 [Arabidopsis thaliana]
Length=257

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W++LSRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  177  VLITNVAGAGDIVRASVKGSRTGWMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  237  WNMVPSNWQFGQTFVGKNFR  256



>ref|XP_010504408.1| PREDICTED: expansin-A16-like [Camelina sativa]
Length=260

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI K  VKGS+T W++L+RNWGQNW+++  LVGQ+LSFRV +SDRR  TS
Sbjct  180  VLITNVAGAGDIVKASVKGSKTGWMSLTRNWGQNWQSNDVLVGQTLSFRVTSSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP+NWQFGQTF GKNFR
Sbjct  240  WNIAPSNWQFGQTFVGKNFR  259



>gb|ADD14636.1| expansin precursor, partial [Solanum tuberosum]
Length=212

 Score =   124 bits (311),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKG++T WI LSRNWGQNW+++A L GQSLSFRV+ASD R  TS
Sbjct  132  VLITNVAGAGDIIKVWVKGTKTNWIPLSRNWGQNWQSNAVLTGQSLSFRVKASDHRSSTS  191

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P++WQFGQTF GKNF+
Sbjct  192  WNIVPSHWQFGQTFTGKNFK  211



>ref|XP_010516124.1| PREDICTED: expansin-A16 [Camelina sativa]
Length=260

 Score =   125 bits (314),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI K  VKGS+T W++L+RNWGQNW+++  LVGQ+LSFRV +SDRR  TS
Sbjct  180  VLITNVAGAGDIVKASVKGSKTGWMSLTRNWGQNWQSNDVLVGQTLSFRVTSSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP+NWQFGQTF GKNFR
Sbjct  240  WNIAPSNWQFGQTFVGKNFR  259



>gb|ABN09939.1| expansin A4 [Musa acuminata AAA Group]
Length=258

 Score =   125 bits (314),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRASVKGSRTGWMPMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+ WQFGQTF+GKNFR
Sbjct  238  WNIVPSTWQFGQTFEGKNFR  257



>ref|XP_003537990.1| PREDICTED: expansin-A4-like [Glycine max]
Length=259

 Score =   125 bits (314),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLV+NVAGAGDI +  VKG+RT W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  179  VLVSNVAGAGDIVRTYVKGTRTGWMPMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP NWQFGQTF GKNFR
Sbjct  239  WNIAPPNWQFGQTFTGKNFR  258



>ref|XP_003616412.1| Expansin [Medicago truncatula]
 gb|AES99370.1| expansin A10 [Medicago truncatula]
Length=259

 Score =   125 bits (314),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI K  VKGS+T W+++SRNWGQNW++++ LVGQSLSFRV +SD+R  TS
Sbjct  179  VLITNVAGAGDIVKTSVKGSKTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTSSDKRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  239  WNIVPSNWQFGQTFTGKNFR  258



>gb|KJB46593.1| hypothetical protein B456_007G376300 [Gossypium raimondii]
Length=293

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGD+ KV +KG++T W+++SRNWGQNW+++A L+GQ+LSFRV  SD+R  TS
Sbjct  213  VLITNVAGAGDLVKVSIKGTKTGWMSMSRNWGQNWQSNAVLIGQALSFRVTGSDKRTSTS  272

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP NWQFGQTF GKNFR
Sbjct  273  WNVAPPNWQFGQTFTGKNFR  292



>ref|NP_001242978.1| expansin-A4-like precursor [Glycine max]
 gb|AEV43316.1| expansin A5a [Glycine max]
Length=259

 Score =   125 bits (314),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +  VKG+RT W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  179  VLISNVAGAGDIVRTYVKGTRTGWMPMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+AP NWQFGQTF GKNFR
Sbjct  239  WNIAPPNWQFGQTFTGKNFR  258



>emb|CDY39521.1| BnaC04g15200D [Brassica napus]
Length=213

 Score =   124 bits (311),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAG+I ++ VKG+RT W+T+SRNWGQNW++++ LVGQ+LSFRV  SDRR  TS
Sbjct  133  VLVTNVAGAGNIVRLSVKGTRTSWMTMSRNWGQNWQSNSVLVGQALSFRVTGSDRRSSTS  192

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  193  WNITPAHWQFGQTFMGKNFR  212



>gb|KCW65541.1| hypothetical protein EUGRSUZ_G02938 [Eucalyptus grandis]
Length=259

 Score =   125 bits (314),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI K+ VKGS+T W+++SRNWGQNW++++ L GQSLSFRV A DRR  TS
Sbjct  179  VLVTNVAGAGDINKLWVKGSKTGWMSMSRNWGQNWQSNSVLAGQSLSFRVTAGDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  239  WNIVPSNWQFGQTFTGKNFR  258



>ref|XP_003547326.1| PREDICTED: expansin-A4-like [Glycine max]
Length=256

 Score =   125 bits (313),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI    VKGSRT WI +SRNWGQNW+++A LVGQ+LSFRV ASDRR  TS
Sbjct  176  VLISNVAGAGDIVHAYVKGSRTGWIAMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSTS  235

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P NWQF QTF GKNFR
Sbjct  236  WNIVPPNWQFAQTFTGKNFR  255



>ref|XP_004302749.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=260

 Score =   125 bits (314),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI  V VKG+ T W+ +SRNWGQNW++++ LVGQ+LSFRVR SDRR  T+
Sbjct  180  VLVTNVAGAGDIVSVSVKGTNTGWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTT  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            +NVAPANWQFGQT+ GKNFR
Sbjct  240  YNVAPANWQFGQTYSGKNFR  259



>gb|AAM47000.1|AF512542_1 alpha-expansin precursor [Gossypium hirsutum]
Length=264

 Score =   125 bits (314),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI KV VKG+ T W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  184  VLVTNVAGAGDIVKVKVKGTNTNWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  243

Query  79   WNVAPANWQFGQTFQGKNFR  20
             NVAPANWQFGQTF GKNFR
Sbjct  244  LNVAPANWQFGQTFTGKNFR  263



>ref|XP_011027216.1| PREDICTED: expansin-A4 [Populus euphratica]
Length=258

 Score =   125 bits (313),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGS+T W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVKVSVKGSKTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNV P+NWQF QTF GKNFR
Sbjct  238  WNVVPSNWQFSQTFVGKNFR  257



>ref|XP_010033123.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
 gb|KCW52678.1| hypothetical protein EUGRSUZ_J02048 [Eucalyptus grandis]
Length=263

 Score =   125 bits (314),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKGSRT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  183  VLISNVAGAGDIVRVSVKGSRTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  242

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA WQFGQTF GKNFR
Sbjct  243  WNIVPAGWQFGQTFTGKNFR  262



>ref|XP_002315218.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEF01389.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   125 bits (313),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGS+T W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVKVSVKGSKTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNV P+NWQF QTF GKNFR
Sbjct  238  WNVVPSNWQFSQTFVGKNFR  257



>ref|XP_009409516.1| PREDICTED: expansin-A6-like [Musa acuminata subsp. malaccensis]
Length=261

 Score =   125 bits (313),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKG+R+ WI +SRNWGQNW+++A LVGQSLSFRV  SD R  TS
Sbjct  181  VLITNVAGAGDIVRASVKGTRSGWIAMSRNWGQNWQSNAVLVGQSLSFRVTGSDHRTSTS  240

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  241  WNIAPASWQFGQTFSGKNFR  260



>ref|XP_004154408.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004173564.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN65728.1| hypothetical protein Csa_1G522540 [Cucumis sativus]
Length=259

 Score =   125 bits (313),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI KV VKG+RT W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  179  VLVTNVAGAGDIVKVSVKGTRTGWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
             NVAP++WQFGQTF GKNFR
Sbjct  239  INVAPSDWQFGQTFTGKNFR  258



>ref|XP_010106493.1| hypothetical protein L484_025251 [Morus notabilis]
 gb|EXC10669.1| hypothetical protein L484_025251 [Morus notabilis]
Length=258

 Score =   125 bits (313),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +  VKGS+T W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLISNVAGAGDIVRTSVKGSKTGWMLMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  238  WNIVPANWQFGQTFTGKNFR  257



>ref|XP_009349313.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   125 bits (313),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKG+RT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  180  VLISNVAGAGDIVRVSVKGARTDWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PA+WQFGQTF GKNFR
Sbjct  240  WNIVPAHWQFGQTFTGKNFR  259



>ref|XP_010534508.1| PREDICTED: expansin-A4 [Tarenaya hassleriana]
Length=261

 Score =   125 bits (313),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  181  VLITNVAGAGDIVRASVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  240

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P++WQFGQTF GKNFR
Sbjct  241  WNIVPSSWQFGQTFVGKNFR  260



>ref|XP_004492358.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=258

 Score =   125 bits (313),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKG+ T W+++SRNWGQNW+++A  VGQ+LSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIIRVSVKGTNTAWMSMSRNWGQNWQSNAVFVGQALSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP NWQFGQTF GKNFR
Sbjct  238  WNVAPPNWQFGQTFSGKNFR  257



>ref|XP_004145295.1| PREDICTED: expansin-A4-like [Cucumis sativus]
Length=258

 Score =   125 bits (313),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI KV VKG+RT W+++SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  178  VLVTNVAGAGDIVKVSVKGTRTGWMSMSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
             NVAP++WQFGQTF GKNFR
Sbjct  238  INVAPSDWQFGQTFTGKNFR  257



>ref|XP_003538409.1| PREDICTED: expansin-A6 [Glycine max]
Length=258

 Score =   125 bits (313),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGS+T W+++SRNWGQNW+++A LVGQSLSFRV   DRR  TS
Sbjct  178  VLITNVAGAGDIMRASVKGSKTEWMSMSRNWGQNWQSNAVLVGQSLSFRVTGGDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P NWQFGQTF GKNFR
Sbjct  238  WNIVPRNWQFGQTFAGKNFR  257



>gb|ACA05164.1| expansin 1 [Dimocarpus longan]
Length=256

 Score =   124 bits (312),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI KV VKGS T W+T+SRNWGQNW+++A L+GQ+LSFRV  SDRR  TS
Sbjct  176  VLVTNVAGAGDIVKVSVKGSNTGWLTMSRNWGQNWQSNAVLLGQALSFRVTGSDRRTSTS  235

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVA +NWQFGQTF GKNFR
Sbjct  236  WNVAKSNWQFGQTFIGKNFR  255



>ref|XP_006294843.1| hypothetical protein CARUB_v10023894mg [Capsella rubella]
 gb|EOA27741.1| hypothetical protein CARUB_v10023894mg [Capsella rubella]
Length=257

 Score =   124 bits (312),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +L+TNVAGAGDI +  VKGSRT W++LSRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  177  ILITNVAGAGDIVRANVKGSRTGWMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  237  WNMVPSNWQFGQTFVGKNFR  256



>gb|KJB16930.1| hypothetical protein B456_002G257400 [Gossypium raimondii]
Length=264

 Score =   125 bits (313),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV +KG+ T W ++SRNWGQNW+++  LVGQ+LSFRV+ SD+R  TS
Sbjct  184  VLITNVAGAGDIVKVSIKGTNTGWTSMSRNWGQNWQSNVILVGQALSFRVKGSDKRTSTS  243

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP NWQFGQTF GKNFR
Sbjct  244  WNVAPTNWQFGQTFTGKNFR  263



>emb|CDY47883.1| BnaA07g14280D [Brassica napus]
Length=260

 Score =   124 bits (312),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAG G+I ++ VKG+RT W+T+SRNWGQNW++++ LVGQ+LSFRV  SDRR  TS
Sbjct  180  VLVTNVAGVGNIVRLSVKGTRTSWMTMSRNWGQNWQSNSVLVGQALSFRVTGSDRRSSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  240  WNIAPAHWQFGQTFMGKNFR  259



>emb|CAA59470.1| orf [Pisum sativum]
Length=258

 Score =   124 bits (312),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKG+ T W+T+SRNWGQNW+++A  VGQ+LSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRVSVKGTNTAWMTMSRNWGQNWQSNAVFVGQALSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP +WQFGQTF GKNFR
Sbjct  238  WNVAPPHWQFGQTFTGKNFR  257



>ref|XP_010508990.1| PREDICTED: expansin-A4-like [Camelina sativa]
Length=257

 Score =   124 bits (312),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            +L+TNVAGAGDI +  VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  T+
Sbjct  177  ILITNVAGAGDIVRANVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTT  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  237  WNMVPSNWQFGQTFVGKNFR  256



>ref|XP_009124371.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A6 [Brassica rapa]
Length=260

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAG G+I ++ VKG+RT W+T+SRNWGQNW++++ LVGQ+LSFRV  SDRR  TS
Sbjct  180  VLVTNVAGVGNIVRLSVKGTRTSWMTMSRNWGQNWQSNSVLVGQALSFRVTGSDRRSSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APA+WQFGQTF GKNFR
Sbjct  240  WNIAPAHWQFGQTFMGKNFR  259



>gb|ABO30976.2| alpha expansin protein 1 [Calotropis procera]
Length=260

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGDI +V VKG+RT W+++SRNWGQNW+++A LVGQSLSFRV  SDR   TS
Sbjct  180  VLISNVAGAGDIVRVSVKGTRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVPGSDRPPSTS  239

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ PANWQFGQTF GKNFR
Sbjct  240  WNIVPANWQFGQTFVGKNFR  259



>ref|XP_009589397.1| PREDICTED: expansin-A4-like [Nicotiana tomentosiformis]
Length=261

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI KV VKGS+T WI+LSRNWGQNW+++A L  QSLSFRV+ASD R  TS
Sbjct  181  VLITNVAGAGDIIKVWVKGSKTNWISLSRNWGQNWQSNAVLTAQSLSFRVKASDHRSSTS  240

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P++WQFGQTF GKNF+
Sbjct  241  WNIVPSHWQFGQTFTGKNFK  260



>ref|XP_010690765.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=258

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL++NVAGAGD+  V VKGSRT W++LSRNWGQNW+++A LVGQSLSFRV ASDRR  TS
Sbjct  178  VLISNVAGAGDLVSVSVKGSRTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTASDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
             N+AP+NWQFGQTF G+NFR
Sbjct  238  LNIAPSNWQFGQTFIGRNFR  257



>gb|KHG12430.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAG+I KV VKG+ T W+++SRNWGQNW+++A LVGQ LSFRV  SDRR  TS
Sbjct  184  VLVTNVAGAGNIVKVSVKGTNTGWLSMSRNWGQNWQSNAVLVGQQLSFRVTGSDRRTSTS  243

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAPANWQFGQTF  KNFR
Sbjct  244  WNVAPANWQFGQTFTAKNFR  263



>ref|XP_010554612.1| PREDICTED: expansin-A4 [Tarenaya hassleriana]
Length=261

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKG++T W+ +SRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  181  VLITNVAGAGDIARASVKGTKTGWMGMSRNWGQNWQSNAVLVGQSLSFRVTGSDRRSSTS  240

Query  79   WNVAPANWQFGQTFQGKNFRA  17
            WN+ P++WQFGQTF GKNFRA
Sbjct  241  WNIVPSHWQFGQTFVGKNFRA  261



>ref|NP_001288961.1| expansin-A4 precursor [Brassica rapa]
 gb|AGM16346.1| alpha-expansin protein 4 [Brassica rapa]
Length=258

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRTSVKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            W++ P+NWQFGQTF GKNFR
Sbjct  238  WSIVPSNWQFGQTFVGKNFR  257



>ref|XP_010067412.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
Length=307

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAGDI K+ VKGS+T W+++SRNWGQNW++++ L GQSLSFRV A DRR  TS
Sbjct  227  VLVTNVAGAGDINKLWVKGSKTGWMSMSRNWGQNWQSNSVLAGQSLSFRVTAGDRRTSTS  286

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF GKNFR
Sbjct  287  WNIVPSNWQFGQTFTGKNFR  306



>emb|CDY07642.1| BnaA03g18690D [Brassica napus]
Length=258

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRTSVKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            W++ P+NWQFGQTF GKNFR
Sbjct  238  WSIVPSNWQFGQTFVGKNFR  257



>emb|CDY69611.1| BnaCnng64440D [Brassica napus]
Length=258

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGS+T W++LSRNWGQNW+++A LVGQSLSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRTSVKGSKTGWMSLSRNWGQNWQSNAVLVGQSLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            W++ P+NWQFGQTF GKNFR
Sbjct  238  WSIVPSNWQFGQTFVGKNFR  257



>ref|XP_010557251.1| PREDICTED: expansin-A6-like [Tarenaya hassleriana]
Length=259

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKGSRT W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  179  VLITNVAGAGDIVRVSVKGSRTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTS  238

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P++WQFGQT+ GKNFR
Sbjct  239  WNIVPSHWQFGQTYVGKNFR  258



>ref|XP_007205748.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
 gb|EMJ06947.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
Length=258

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKG+ T W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRVSVKGANTEWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP +WQFGQTF GKNFR
Sbjct  238  WNVAPGHWQFGQTFSGKNFR  257



>gb|ABM66430.1| expansin 3 [Musa acuminata AAA Group]
Length=250

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +  VKGSRT W+ +SRNWGQNW+++A LVGQ LSFRV  SDRR  TS
Sbjct  170  VLITNVAGAGDIVRASVKGSRTGWMPMSRNWGQNWQSNAVLVGQPLSFRVTGSDRRTSTS  229

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF+GKN R
Sbjct  230  WNIVPSNWQFGQTFEGKNHR  249



>ref|XP_002881024.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57283.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAG G+I ++ VKG+ T W+++SRNWGQNW++++ LVGQSLSFRV  SDRR  TS
Sbjct  177  VLVTNVAGVGNIVRLGVKGTHTSWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRSSTS  236

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+APANWQFGQTF GKNFR
Sbjct  237  WNIAPANWQFGQTFMGKNFR  256



>dbj|BAH36862.1| alpha expansin [Rosa hybrid cultivar]
Length=258

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGD+  V VKG+ T W+ +SRNWGQNW++++ LVGQ+LSFRVR SDRR  T+
Sbjct  178  VLITNVAGAGDVVSVSVKGTNTGWMPMSRNWGQNWQSNSVLVGQALSFRVRGSDRRSSTT  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            +NVAPANWQFGQT+ GKNFR
Sbjct  238  YNVAPANWQFGQTYSGKNFR  257



>ref|XP_008240857.1| PREDICTED: expansin-A6-like [Prunus mume]
Length=258

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGAGDI +V VKG+ T W+ +SRNWGQNW+++A LVGQ+LSFRV  SDRR  TS
Sbjct  178  VLITNVAGAGDIVRVSVKGANTEWMPMSRNWGQNWQSNADLVGQTLSFRVTGSDRRTSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WNVAP +WQFGQTF GKNFR
Sbjct  238  WNVAPGHWQFGQTFSGKNFR  257



>gb|ABN09942.1| expansin A5 [Musa acuminata AAA Group]
Length=239

 Score =   123 bits (309),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VL+TNVAGA DI    VKGSRT W+ +SRNWGQNW+++A LVGQSLSFR+  SDRR  TS
Sbjct  159  VLITNVAGASDIVHASVKGSRTGWMPMSRNWGQNWQSNAVLVGQSLSFRLTGSDRRTSTS  218

Query  79   WNVAPANWQFGQTFQGKNFR  20
            WN+ P+NWQFGQTF+GKNFR
Sbjct  219  WNIVPSNWQFGQTFEGKNFR  238



>emb|CDY10456.1| BnaCnng03570D [Brassica napus]
Length=258

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  259  VLVTNVAGAGDIQKVLVKGSRTPWITLSRNWGQNWETSAFLVGQSLSFRVRASDRRQVTS  80
            VLVTNVAGAG++Q V VKGS T W+ LSRNWGQNW+++A LVGQSLSFRVRASD R  TS
Sbjct  178  VLVTNVAGAGNVQMVSVKGSNTGWLGLSRNWGQNWQSNAILVGQSLSFRVRASDGRSSTS  237

Query  79   WNVAPANWQFGQTFQGKNFR  20
             N+ P+NWQFGQTF GKNFR
Sbjct  238  NNIVPSNWQFGQTFSGKNFR  257



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 571209109800