BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF048L02

Length=394
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010321856.1|  PREDICTED: pectinesterase                          170   6e-47   Solanum lycopersicum
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    168   2e-46   Solanum tuberosum [potatoes]
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     168   3e-46   Solanum lycopersicum
dbj|BAF95866.1|  pectin methylesterase isoform alpha                    160   5e-46   Vitis hybrid cultivar
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     165   9e-46   
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     166   1e-45   Nicotiana sylvestris
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     164   6e-45   Nicotiana tomentosiformis
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     164   7e-45   Nicotiana tomentosiformis
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     163   1e-44   Vitis vinifera
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     162   3e-44   Nicotiana sylvestris
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     162   4e-44   Nicotiana tomentosiformis
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     160   1e-43   Nicotiana sylvestris
emb|CDP15270.1|  unnamed protein product                                157   2e-42   Coffea canephora [robusta coffee]
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     156   4e-42   Sesamum indicum [beniseed]
gb|EPS62329.1|  pectinesterase                                          153   4e-41   Genlisea aurea
gb|EYU46749.1|  hypothetical protein MIMGU_mgv1a0044631mg               149   8e-41   Erythranthe guttata [common monkey flower]
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                     151   3e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     151   3e-40   Phoenix dactylifera
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   149   4e-40   Citrus sinensis [apfelsine]
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            150   6e-40   
gb|AHB84678.1|  pectin methylesterase                                   150   7e-40   Citrus reticulata [mandarin orange]
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    150   7e-40   Citrus sinensis [apfelsine]
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     149   1e-39   Populus euphratica
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     149   1e-39   Populus euphratica
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          148   3e-39   Amborella trichopoda
ref|XP_008386773.1|  PREDICTED: pectinesterase-like                     142   7e-39   
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             147   8e-39   
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     147   8e-39   Prunus mume [ume]
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             147   8e-39   
ref|XP_009388374.1|  PREDICTED: pectinesterase-like                     141   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS67066.1|  pectinesterase                                          148   2e-38   Genlisea aurea
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     145   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     145   4e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGG23325.1|  pectin methylesterase 1                                 145   4e-38   Musa acuminata AAA Group [Cavendish banana]
gb|ACQ85264.1|  pectin methylesterase                                   145   5e-38   Musa acuminata AAA Group [Cavendish banana]
ref|XP_004307817.2|  PREDICTED: pectinesterase 2-like                   144   5e-38   Fragaria vesca subsp. vesca
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    144   6e-38   
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     145   6e-38   
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     144   9e-38   
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               144   1e-37   Ricinus communis
ref|XP_010921648.1|  PREDICTED: pectinesterase-like                     138   2e-37   Elaeis guineensis
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         142   2e-37   Jatropha curcas
ref|XP_002322401.1|  putative pectin methylesterase family protein      143   2e-37   Populus trichocarpa [western balsam poplar]
gb|AFG69043.1|  hypothetical protein 2_5100_02                          134   3e-37   Pinus taeda
sp|P85076.1|PME_ACTDE  RecName: Full=Pectinesterase; Short=PE; Al...    139   3e-37   Actinidia deliciosa [Chinese gooseberry]
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    142   4e-37   Cicer arietinum [garbanzo]
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 142   5e-37   Medicago truncatula
ref|XP_010098938.1|  Pectinesterase 2                                   142   5e-37   Morus notabilis
ref|XP_011010931.1|  PREDICTED: pectinesterase 2-like                   142   6e-37   Populus euphratica
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     142   6e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFG69049.1|  hypothetical protein 2_5100_02                          133   7e-37   Pinus taeda
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...    141   8e-37   Morus notabilis
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             141   9e-37   
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               140   9e-37   
ref|XP_006367816.1|  PREDICTED: probable pectinesterase/pectinest...    140   1e-36   
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     140   1e-36   Elaeis guineensis
gb|EYU24970.1|  hypothetical protein MIMGU_mgv1a022192mg                140   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             140   2e-36   Phaseolus vulgaris [French bean]
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     140   2e-36   Eucalyptus grandis [rose gum]
emb|CBI38888.3|  unnamed protein product                                136   2e-36   Vitis vinifera
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        140   2e-36   Prunus mume [ume]
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     140   2e-36   Glycine soja [wild soybean]
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             140   3e-36   Prunus persica
ref|XP_010552690.1|  PREDICTED: probable pectinesterase/pectinest...    140   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_004299718.2|  PREDICTED: pectinesterase-like                     140   3e-36   Fragaria vesca subsp. vesca
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    140   3e-36   Glycine max [soybeans]
gb|EEC70505.1|  hypothetical protein OsI_01594                          140   3e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     139   4e-36   Nicotiana sylvestris
gb|EEE54425.1|  hypothetical protein OsJ_01485                          139   5e-36   Oryza sativa Japonica Group [Japonica rice]
emb|CBI24582.3|  unnamed protein product                                135   5e-36   Vitis vinifera
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     139   6e-36   Nicotiana sylvestris
ref|XP_002318285.1|  putative pectin methylesterase family protein      139   6e-36   Populus trichocarpa [western balsam poplar]
gb|ABK24761.1|  unknown                                                 139   6e-36   Picea sitchensis
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   139   7e-36   Pyrus x bretschneideri [bai li]
ref|XP_004290811.1|  PREDICTED: pectinesterase-like                     139   7e-36   Fragaria vesca subsp. vesca
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                139   9e-36   Erythranthe guttata [common monkey flower]
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   138   9e-36   Pyrus x bretschneideri [bai li]
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    138   9e-36   
ref|XP_006401715.1|  hypothetical protein EUTSA_v10013056mg             139   1e-35   Eutrema salsugineum [saltwater cress]
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             138   1e-35   Phaseolus vulgaris [French bean]
ref|XP_007199770.1|  hypothetical protein PRUPE_ppa003639mg             138   1e-35   Prunus persica
gb|AAF35897.1|AF229849_1  pectin methylesterase isoform alpha           134   1e-35   Vigna radiata [mung bean]
ref|XP_010271283.1|  PREDICTED: pectinesterase                          138   1e-35   
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     137   1e-35   Eucalyptus grandis [rose gum]
emb|CDO97716.1|  unnamed protein product                                137   2e-35   Coffea canephora [robusta coffee]
ref|XP_007050982.1|  Plant invertase/pectin methylesterase inhibi...    137   2e-35   
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     137   2e-35   Phoenix dactylifera
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    137   2e-35   Solanum lycopersicum
ref|XP_010088304.1|  putative pectinesterase/pectinesterase inhib...    137   2e-35   
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     137   2e-35   Nicotiana tomentosiformis
ref|XP_011010924.1|  PREDICTED: pectinesterase-like isoform X1          137   3e-35   Populus euphratica
ref|XP_011010930.1|  PREDICTED: pectinesterase-like                     137   3e-35   Populus euphratica
ref|XP_011010925.1|  PREDICTED: pectinesterase-like isoform X2          137   3e-35   Populus euphratica
gb|AFW03479.1|  pectin methylesterase 5                                 137   3e-35   Gossypium barbadense [Egyptian cotton]
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        137   3e-35   
gb|KHG19575.1|  Uncharacterized protein F383_07269                      137   3e-35   Gossypium arboreum [tree cotton]
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   137   4e-35   Eucalyptus grandis [rose gum]
gb|AGR44472.1|  pectin methylesterase 3                                 137   4e-35   Pyrus x bretschneideri [bai li]
emb|CDY35644.1|  BnaC09g29660D                                          136   4e-35   Brassica napus [oilseed rape]
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   136   4e-35   Eucalyptus grandis [rose gum]
dbj|BAF42040.1|  pectin methylesterase 3                                137   4e-35   Pyrus communis
gb|ABZ89800.1|  pectin methylesterase-like protein                      137   4e-35   Taiwania cryptomerioides
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   136   4e-35   Prunus mume [ume]
ref|XP_004306939.1|  PREDICTED: probable pectinesterase/pectinest...    136   5e-35   Fragaria vesca subsp. vesca
emb|CAA96436.1|  pectin methylesterase                                  133   5e-35   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KDO40320.1|  hypothetical protein CISIN_1g048471mg                   130   6e-35   Citrus sinensis [apfelsine]
gb|KJB49891.1|  hypothetical protein B456_008G143800                    136   6e-35   Gossypium raimondii
ref|XP_010537086.1|  PREDICTED: probable pectinesterase/pectinest...    136   7e-35   Tarenaya hassleriana [spider flower]
gb|KJB49890.1|  hypothetical protein B456_008G143800                    136   7e-35   Gossypium raimondii
emb|CDP20891.1|  unnamed protein product                                135   7e-35   Coffea canephora [robusta coffee]
emb|CAA96434.1|  pectin methylesterase                                  133   7e-35   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CAA96435.1|  pectin methylesterase                                  133   7e-35   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   135   7e-35   Vitis vinifera
gb|KJB49889.1|  hypothetical protein B456_008G143700                    136   8e-35   Gossypium raimondii
ref|XP_008377824.1|  PREDICTED: pectinesterase 2-like                   135   8e-35   
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                   135   8e-35   Nicotiana sylvestris
ref|XP_004299719.1|  PREDICTED: probable pectinesterase/pectinest...    136   8e-35   Fragaria vesca subsp. vesca
ref|NP_001042866.1|  Os01g0312500                                       135   9e-35   
gb|KJB41089.1|  hypothetical protein B456_007G090100                    135   9e-35   Gossypium raimondii
ref|XP_006576427.1|  PREDICTED: pectinesterase 2-like                   132   1e-34   Glycine max [soybeans]
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     135   1e-34   Phoenix dactylifera
ref|XP_008389982.1|  PREDICTED: pectinesterase                          135   1e-34   
ref|XP_008235120.1|  PREDICTED: probable pectinesterase/pectinest...    135   1e-34   Prunus mume [ume]
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     135   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_002890570.1|  predicted protein                                  135   1e-34   Arabidopsis lyrata subsp. lyrata
emb|CDP17208.1|  unnamed protein product                                135   1e-34   Coffea canephora [robusta coffee]
ref|XP_008219291.1|  PREDICTED: probable pectinesterase/pectinest...    135   1e-34   Prunus mume [ume]
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   135   2e-34   Populus euphratica
ref|XP_009340592.1|  PREDICTED: pectinesterase 2-like                   135   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_009374493.1|  PREDICTED: pectinesterase 2-like                   134   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          135   2e-34   Sorghum bicolor [broomcorn]
ref|XP_008347782.1|  PREDICTED: probable pectinesterase/pectinest...    135   2e-34   Malus domestica [apple tree]
gb|KJB41904.1|  hypothetical protein B456_007G127000                    134   2e-34   Gossypium raimondii
ref|XP_010442899.1|  PREDICTED: probable pectinesterase/pectinest...    135   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004299720.1|  PREDICTED: probable pectinesterase/pectinest...    134   2e-34   Fragaria vesca subsp. vesca
ref|XP_009625476.1|  PREDICTED: pectinesterase-like                     134   3e-34   Nicotiana tomentosiformis
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    134   3e-34   Nicotiana tomentosiformis
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     134   3e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010269594.1|  PREDICTED: probable pectinesterase/pectinest...    134   3e-34   Nelumbo nucifera [Indian lotus]
gb|ABD47733.1|  pectin methylesterase                                   126   3e-34   Eucalyptus globulus subsp. globulus
dbj|BAM05617.1|  pectin methylesterase 2                                125   3e-34   Eucalyptus globulus subsp. globulus
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   134   3e-34   
emb|CDY18942.1|  BnaC04g04080D                                          130   3e-34   Brassica napus [oilseed rape]
gb|KJB41905.1|  hypothetical protein B456_007G127100                    134   3e-34   Gossypium raimondii
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       134   3e-34   Cucumis sativus [cucumbers]
gb|KHN35616.1|  Pectinesterase 2                                        132   3e-34   Glycine soja [wild soybean]
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   134   3e-34   Citrus sinensis [apfelsine]
ref|XP_009335714.1|  PREDICTED: probable pectinesterase/pectinest...    134   3e-34   
ref|XP_009335708.1|  PREDICTED: probable pectinesterase/pectinest...    134   4e-34   Pyrus x bretschneideri [bai li]
ref|XP_003588521.1|  Pectinesterase                                     134   4e-34   Medicago truncatula
gb|KJB09419.1|  hypothetical protein B456_001G140500                    134   4e-34   Gossypium raimondii
emb|CBI36882.3|  unnamed protein product                                134   4e-34   Vitis vinifera
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             134   4e-34   Citrus clementina [clementine]
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     134   4e-34   Solanum lycopersicum
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   134   4e-34   Citrus sinensis [apfelsine]
ref|XP_002268492.2|  PREDICTED: probable pectinesterase/pectinest...    134   4e-34   Vitis vinifera
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    134   4e-34   Glycine max [soybeans]
ref|XP_004498516.1|  PREDICTED: probable pectinesterase/pectinest...    134   4e-34   Cicer arietinum [garbanzo]
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     134   5e-34   
ref|XP_003564371.1|  PREDICTED: pectinesterase                          134   5e-34   Brachypodium distachyon [annual false brome]
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   135   5e-34   
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     133   5e-34   Glycine soja [wild soybean]
ref|XP_007222884.1|  hypothetical protein PRUPE_ppa003581mg             134   5e-34   Prunus persica
ref|XP_002518523.1|  Pectinesterase precursor, putative                 134   5e-34   Ricinus communis
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   133   5e-34   Nelumbo nucifera [Indian lotus]
ref|NP_001274785.1|  pectin methyl esterase                             133   5e-34   Solanum tuberosum [potatoes]
ref|XP_006279604.1|  hypothetical protein CARUB_v10026136mg             134   5e-34   Capsella rubella
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 133   5e-34   Solanum tuberosum [potatoes]
gb|ABK92615.1|  unknown                                                 126   5e-34   Populus trichocarpa [western balsam poplar]
gb|AAF23891.1|  pectin methyl esterase                                  133   6e-34   Solanum tuberosum [potatoes]
gb|AFW03484.1|  pectin methylesterase 5                                 133   6e-34   Gossypium hirsutum [American cotton]
gb|KDO87166.1|  hypothetical protein CISIN_1g0440421mg                  129   6e-34   Citrus sinensis [apfelsine]
ref|XP_009799791.1|  PREDICTED: probable pectinesterase/pectinest...    133   6e-34   Nicotiana sylvestris
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    134   6e-34   Solanum tuberosum [potatoes]
ref|NP_001044480.1|  Os01g0788400                                       133   6e-34   
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     134   6e-34   Nelumbo nucifera [Indian lotus]
gb|AAN84553.1|  methyl pectinesterase                                   129   6e-34   Lolium perenne [perennial ryegrass]
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     133   7e-34   
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...    133   7e-34   Solanum lycopersicum
ref|XP_010460102.1|  PREDICTED: probable pectinesterase/pectinest...    133   7e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     133   7e-34   Solanum lycopersicum
dbj|BAK05307.1|  predicted protein                                      133   8e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   133   8e-34   Cucumis sativus [cucumbers]
gb|EAY76103.1|  hypothetical protein OsI_04029                          132   1e-33   Oryza sativa Indica Group [Indian rice]
gb|ABQ42392.1|  pectin methylesterase-like protein                      133   1e-33   Taiwania cryptomerioides
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         132   1e-33   Jatropha curcas
ref|XP_009776000.1|  PREDICTED: probable pectinesterase/pectinest...    133   1e-33   Nicotiana sylvestris
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   132   1e-33   Nelumbo nucifera [Indian lotus]
ref|XP_004972208.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    132   1e-33   
ref|XP_010253281.1|  PREDICTED: probable pectinesterase/pectinest...    132   1e-33   Nelumbo nucifera [Indian lotus]
ref|XP_007038413.1|  Pectinesterase                                     132   1e-33   
ref|XP_002322399.1|  putative pectin methylesterase family protein      132   1e-33   Populus trichocarpa [western balsam poplar]
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    132   1e-33   Gossypium arboreum [tree cotton]
ref|XP_010692197.1|  PREDICTED: pectinesterase 2                        132   1e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   132   1e-33   Cucumis melo [Oriental melon]
ref|XP_010035249.1|  PREDICTED: probable pectinesterase/pectinest...    132   1e-33   Eucalyptus grandis [rose gum]
gb|KHN47891.1|  Pectinesterase 2                                        132   1e-33   Glycine soja [wild soybean]
emb|CAN76835.1|  hypothetical protein VITISV_043176                     132   2e-33   Vitis vinifera
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    132   2e-33   Cucumis sativus [cucumbers]
ref|XP_011000694.1|  PREDICTED: pectinesterase                          132   2e-33   Populus euphratica
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    132   2e-33   
ref|XP_006646399.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    132   2e-33   
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    132   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006644119.1|  PREDICTED: probable pectinesterase/pectinest...    132   2e-33   Oryza brachyantha
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    132   2e-33   Citrus sinensis [apfelsine]
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   132   2e-33   Vitis vinifera
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   132   2e-33   Citrus sinensis [apfelsine]
ref|XP_010069899.1|  PREDICTED: probable pectinesterase/pectinest...    132   2e-33   Eucalyptus grandis [rose gum]
ref|XP_008386683.1|  PREDICTED: probable pectinesterase/pectinest...    132   2e-33   
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        131   2e-33   Malus domestica [apple tree]
ref|XP_008219290.1|  PREDICTED: probable pectinesterase/pectinest...    132   2e-33   Prunus mume [ume]
gb|KGN44975.1|  Pectinesterase                                          132   2e-33   Cucumis sativus [cucumbers]
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     131   2e-33   Nelumbo nucifera [Indian lotus]
emb|CDX95641.1|  BnaC03g25220D                                          131   2e-33   
gb|KDO87167.1|  hypothetical protein CISIN_1g045495mg                   132   2e-33   Citrus sinensis [apfelsine]
ref|XP_006444391.1|  hypothetical protein CICLE_v10024391mg             132   2e-33   Citrus clementina [clementine]
gb|AER38244.1|  PME5                                                    131   3e-33   Gossypium barbadense [Egyptian cotton]
ref|XP_006480113.1|  PREDICTED: probable pectinesterase/pectinest...    132   3e-33   Citrus sinensis [apfelsine]
ref|XP_007052106.1|  Pectinesterase 2                                   131   3e-33   
ref|XP_010556724.1|  PREDICTED: pectinesterase-like                     131   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_009614734.1|  PREDICTED: probable pectinesterase/pectinest...    132   3e-33   Nicotiana tomentosiformis
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          131   3e-33   Amborella trichopoda
ref|XP_002865971.1|  pectinesterase family protein                      132   3e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_007222925.1|  hypothetical protein PRUPE_ppa005208mg             131   3e-33   
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   131   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    131   3e-33   Tarenaya hassleriana [spider flower]
emb|CAN78759.1|  hypothetical protein VITISV_000562                     131   3e-33   Vitis vinifera
ref|XP_006442946.1|  hypothetical protein CICLE_v10023535mg             131   3e-33   Citrus clementina [clementine]
gb|KHN47892.1|  Pectinesterase 2                                        131   3e-33   Glycine soja [wild soybean]
emb|CBI24284.3|  unnamed protein product                                127   3e-33   Vitis vinifera
gb|KHN43319.1|  Putative pectinesterase/pectinesterase inhibitor 7      129   3e-33   Glycine soja [wild soybean]
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             131   3e-33   Citrus clementina [clementine]
ref|XP_010482728.1|  PREDICTED: probable pectinesterase/pectinest...    131   4e-33   Camelina sativa [gold-of-pleasure]
emb|CDX74715.1|  BnaA05g04610D                                          130   4e-33   
ref|XP_002456465.1|  hypothetical protein SORBIDRAFT_03g036790          131   4e-33   Sorghum bicolor [broomcorn]
ref|XP_003517028.1|  PREDICTED: pectinesterase 2-like                   131   4e-33   Glycine max [soybeans]
ref|XP_010257625.1|  PREDICTED: pectinesterase 2-like                   131   4e-33   Nelumbo nucifera [Indian lotus]
gb|KGN49865.1|  hypothetical protein Csa_5G139430                       132   4e-33   Cucumis sativus [cucumbers]
ref|XP_004172937.1|  PREDICTED: probable pectinesterase/pectinest...    132   4e-33   
ref|XP_010937248.1|  PREDICTED: pectinesterase-like                     131   4e-33   Elaeis guineensis
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        130   4e-33   Populus euphratica
ref|XP_010515266.1|  PREDICTED: probable pectinesterase/pectinest...    131   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     130   4e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010260073.1|  PREDICTED: pectinesterase-like                     131   5e-33   Nelumbo nucifera [Indian lotus]
ref|XP_008221458.1|  PREDICTED: pectinesterase                          130   5e-33   
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   130   5e-33   
gb|EMT05022.1|  Pectinesterase 3                                        130   5e-33   
ref|XP_009763675.1|  PREDICTED: probable pectinesterase/pectinest...    131   5e-33   Nicotiana sylvestris
gb|KHN24739.1|  Putative pectinesterase/pectinesterase inhibitor 7      130   5e-33   Glycine soja [wild soybean]
ref|XP_008437596.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    131   5e-33   Cucumis melo [Oriental melon]
ref|NP_001146685.1|  pectinesterase precursor                           130   5e-33   Zea mays [maize]
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 130   5e-33   Nicotiana sylvestris
gb|AHC69829.1|  pectin methylesterase PME2.1                            130   5e-33   Nicotiana tabacum [American tobacco]
emb|CDX83392.1|  BnaA03g21140D                                          130   6e-33   
ref|XP_008363719.1|  PREDICTED: probable pectinesterase/pectinest...    130   6e-33   
ref|XP_010550514.1|  PREDICTED: probable pectinesterase/pectinest...    131   6e-33   Tarenaya hassleriana [spider flower]
gb|KHN35618.1|  Pectinesterase 2                                        129   6e-33   Glycine soja [wild soybean]
emb|CDO97717.1|  unnamed protein product                                127   6e-33   Coffea canephora [robusta coffee]
gb|KHN25547.1|  Pectinesterase 2                                        129   6e-33   Glycine soja [wild soybean]
emb|CAN83663.1|  hypothetical protein VITISV_017689                     130   6e-33   Vitis vinifera
emb|CBI24285.3|  unnamed protein product                                130   6e-33   Vitis vinifera
ref|XP_010544633.1|  PREDICTED: probable pectinesterase/pectinest...    130   6e-33   Tarenaya hassleriana [spider flower]
ref|XP_006577155.1|  PREDICTED: probable pectinesterase/pectinest...    130   7e-33   Glycine max [soybeans]
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             130   7e-33   Phaseolus vulgaris [French bean]
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        130   7e-33   Vitis vinifera
ref|XP_010684347.1|  PREDICTED: pectinesterase                          130   7e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          130   7e-33   
ref|XP_006444392.1|  hypothetical protein CICLE_v10023588mg             130   7e-33   
gb|KDO64577.1|  hypothetical protein CISIN_1g047288mg                   130   8e-33   Citrus sinensis [apfelsine]
ref|XP_009133718.1|  PREDICTED: probable pectinesterase/pectinest...    130   8e-33   Brassica rapa
ref|XP_002266980.1|  PREDICTED: pectinesterase                          130   9e-33   Vitis vinifera
ref|XP_002882002.1|  predicted protein                                  130   9e-33   Arabidopsis lyrata subsp. lyrata
gb|ACN40984.1|  unknown                                                 130   9e-33   Picea sitchensis
ref|XP_010910890.1|  PREDICTED: probable pectinesterase/pectinest...    130   9e-33   Elaeis guineensis
ref|XP_006469215.1|  PREDICTED: probable pectinesterase/pectinest...    130   9e-33   Citrus sinensis [apfelsine]
ref|XP_008803383.1|  PREDICTED: pectinesterase                          130   9e-33   Phoenix dactylifera
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    130   9e-33   Solanum tuberosum [potatoes]
ref|XP_010508199.1|  PREDICTED: probable pectinesterase/pectinest...    130   9e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010498826.1|  PREDICTED: probable pectinesterase/pectinest...    130   9e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        130   1e-32   
ref|XP_006307093.1|  hypothetical protein CARUB_v10008680mg             130   1e-32   
ref|XP_007134831.1|  hypothetical protein PHAVU_010G079900g             130   1e-32   
ref|NP_566038.1|  putative pectinesterase/pectinesterase inhibito...    130   1e-32   
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   130   1e-32   
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     129   1e-32   
ref|XP_006828612.1|  hypothetical protein AMTR_s00129p00073090          130   1e-32   
ref|XP_010506460.1|  PREDICTED: probable pectinesterase/pectinest...    129   1e-32   
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   129   1e-32   
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               129   1e-32   
ref|XP_009389951.1|  PREDICTED: probable pectinesterase/pectinest...    130   1e-32   
ref|XP_010477609.1|  PREDICTED: probable pectinesterase/pectinest...    130   1e-32   
gb|KHN35620.1|  Pectinesterase 2                                        128   1e-32   
ref|XP_009119880.1|  PREDICTED: probable pectinesterase/pectinest...    130   1e-32   
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   129   1e-32   
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         129   1e-32   
ref|XP_003591484.1|  Pectinesterase                                     127   1e-32   
ref|XP_010426432.1|  PREDICTED: probable pectinesterase/pectinest...    130   2e-32   
ref|XP_006604725.1|  PREDICTED: probable pectinesterase/pectinest...    129   2e-32   
ref|XP_008812398.1|  PREDICTED: probable pectinesterase/pectinest...    129   2e-32   
ref|XP_006433466.1|  hypothetical protein CICLE_v10003641mg             129   2e-32   
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    130   2e-32   
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    129   2e-32   
emb|CDY14384.1|  BnaA10g06710D                                          129   2e-32   
ref|XP_010520512.1|  PREDICTED: probable pectinesterase/pectinest...    129   2e-32   
ref|XP_010503572.1|  PREDICTED: probable pectinesterase/pectinest...    129   2e-32   
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   128   2e-32   
dbj|BAJ96804.1|  predicted protein                                      129   2e-32   
emb|CDY21422.1|  BnaA09g30050D                                          129   2e-32   
ref|XP_006444393.1|  hypothetical protein CICLE_v10023718mg             129   2e-32   
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   129   2e-32   
ref|XP_010501561.1|  PREDICTED: probable pectinesterase/pectinest...    122   2e-32   
emb|CAN60506.1|  hypothetical protein VITISV_022717                     125   2e-32   
emb|CDY65637.1|  BnaAnng20820D                                          129   2e-32   
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   129   2e-32   
ref|XP_010069898.1|  PREDICTED: probable pectinesterase/pectinest...    129   2e-32   
gb|EAY73715.1|  hypothetical protein OsI_01593                          129   2e-32   
ref|XP_007222797.1|  hypothetical protein PRUPE_ppa003578mg             129   2e-32   
ref|XP_006293950.1|  hypothetical protein CARUB_v10022941mg             129   3e-32   
ref|XP_003565712.1|  PREDICTED: pectinesterase-like                     129   3e-32   
ref|XP_006480114.1|  PREDICTED: probable pectinesterase/pectinest...    129   3e-32   
ref|NP_173733.1|  probable pectinesterase/pectinesterase inhibitor 6    129   3e-32   
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             128   3e-32   
emb|CDP05068.1|  unnamed protein product                                129   3e-32   
gb|EMS63917.1|  putative pectinesterase/pectinesterase inhibitor 41     127   3e-32   
ref|XP_006853048.1|  hypothetical protein AMTR_s00038p00046180          129   3e-32   
ref|XP_006388577.1|  hypothetical protein POPTR_0150s00220g             121   3e-32   
ref|XP_006493306.1|  PREDICTED: probable pectinesterase/pectinest...    129   3e-32   
sp|Q96575.1|PME22_SOLLC  RecName: Full=Pectinesterase 2.2; Short=...    129   3e-32   
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    128   3e-32   
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     129   3e-32   
ref|XP_008451544.1|  PREDICTED: probable pectinesterase/pectinest...    129   3e-32   
ref|XP_008376726.1|  PREDICTED: probable pectinesterase/pectinest...    129   3e-32   
ref|XP_002515774.1|  Pectinesterase-2 precursor, putative               129   3e-32   
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   128   3e-32   
ref|NP_001234151.1|  pectinesterase 1 precursor                         129   3e-32   
ref|XP_009335753.1|  PREDICTED: probable pectinesterase/pectinest...    128   3e-32   
ref|XP_008369099.1|  PREDICTED: probable pectinesterase/pectinest...    128   3e-32   
dbj|BAM05616.1|  pectin methylesterase 2                                120   3e-32   
ref|NP_001042865.1|  Os01g0311800                                       129   3e-32   
ref|XP_004513409.1|  PREDICTED: probable pectinesterase/pectinest...    129   3e-32   
ref|XP_006441080.1|  hypothetical protein CICLE_v10019376mg             129   3e-32   
gb|AAL66865.1|  pectin methylesterase                                   122   3e-32   
ref|XP_009378757.1|  PREDICTED: probable pectinesterase/pectinest...    128   3e-32   
gb|KJB57093.1|  hypothetical protein B456_009G147900                    129   3e-32   
gb|KHG08631.1|  Pectinesterase 3                                        129   3e-32   
gb|AFW03480.1|  pectin methylesterase 1                                 129   3e-32   
gb|AFW03475.1|  pectin methylesterase 1                                 129   3e-32   
gb|AFB77929.1|  pectin methylesterase                                   129   3e-32   
gb|KHN20388.1|  Putative pectinesterase/pectinesterase inhibitor 7      128   4e-32   
dbj|BAM05615.1|  pectin methylesterase 2                                120   4e-32   
emb|CDY68840.1|  BnaCnng60750D                                          127   4e-32   
ref|XP_010445741.1|  PREDICTED: probable pectinesterase/pectinest...    129   4e-32   
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                     129   4e-32   
ref|XP_006828577.1|  hypothetical protein AMTR_s00129p00031200          129   4e-32   
dbj|BAM05614.1|  pectin methylesterase 2                                120   4e-32   
gb|AGV54687.1|  pectinesterase                                          129   4e-32   
ref|XP_003521574.1|  PREDICTED: probable pectinesterase/pectinest...    128   4e-32   
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               128   4e-32   
ref|XP_008795770.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    128   4e-32   
ref|XP_004514850.1|  PREDICTED: pectinesterase 2-like                   128   4e-32   
gb|KDP23442.1|  hypothetical protein JCGZ_23275                         126   4e-32   
ref|XP_003521947.1|  PREDICTED: pectinesterase 2-like                   128   4e-32   
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             129   4e-32   
gb|KDO53806.1|  hypothetical protein CISIN_1g0081982mg                  126   4e-32   
ref|XP_002519324.1|  Pectinesterase-3 precursor, putative               128   4e-32   
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    128   4e-32   
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         128   4e-32   
ref|XP_003521940.1|  PREDICTED: pectinesterase 2-like                   128   5e-32   
ref|XP_009111298.1|  PREDICTED: probable pectinesterase/pectinest...    128   5e-32   
ref|XP_006416115.1|  hypothetical protein EUTSA_v10007274mg             128   5e-32   
ref|XP_007012506.1|  Pectinesterase                                     129   5e-32   
ref|XP_006448208.1|  hypothetical protein CICLE_v10014888mg             128   5e-32   
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   128   5e-32   
gb|KJB30790.1|  hypothetical protein B456_005G160000                    128   5e-32   
ref|XP_006396438.1|  hypothetical protein EUTSA_v10029453mg             128   5e-32   
ref|XP_009143104.1|  PREDICTED: probable pectinesterase/pectinest...    127   6e-32   
ref|XP_004513410.1|  PREDICTED: probable pectinesterase/pectinest...    128   6e-32   
ref|XP_010544635.1|  PREDICTED: probable pectinesterase/pectinest...    127   6e-32   
ref|XP_003591482.1|  Pectinesterase                                     128   6e-32   
ref|XP_010069897.1|  PREDICTED: probable pectinesterase/pectinest...    128   6e-32   
ref|XP_004513411.1|  PREDICTED: probable pectinesterase/pectinest...    127   7e-32   
ref|XP_002317777.2|  hypothetical protein POPTR_0012s02170g             128   7e-32   
ref|XP_003536881.1|  PREDICTED: probable pectinesterase/pectinest...    128   7e-32   
ref|XP_010548770.1|  PREDICTED: pectinesterase-like                     128   7e-32   
ref|XP_010089423.1|  putative pectinesterase/pectinesterase inhib...    127   7e-32   
ref|XP_010273980.1|  PREDICTED: putative pectinesterase/pectinest...    128   7e-32   
ref|XP_008344546.1|  PREDICTED: probable pectinesterase/pectinest...    124   8e-32   
ref|XP_011024825.1|  PREDICTED: probable pectinesterase/pectinest...    128   8e-32   
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            127   8e-32   
gb|KJB45339.1|  hypothetical protein B456_007G302100                    127   8e-32   
emb|CDO99718.1|  unnamed protein product                                127   8e-32   
ref|XP_004290810.1|  PREDICTED: probable pectinesterase/pectinest...    127   8e-32   
ref|XP_008235210.1|  PREDICTED: probable pectinesterase/pectinest...    127   9e-32   
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                   127   9e-32   
gb|KJB52586.1|  hypothetical protein B456_008G268900                    128   9e-32   
ref|XP_006838619.1|  hypothetical protein AMTR_s00002p00230630          127   9e-32   
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     127   9e-32   
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   126   9e-32   
ref|XP_010674141.1|  PREDICTED: probable pectinesterase/pectinest...    125   9e-32   
ref|XP_003521573.1|  PREDICTED: probable pectinesterase/pectinest...    127   9e-32   
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     127   9e-32   
ref|XP_009115554.1|  PREDICTED: probable pectinesterase/pectinest...    127   1e-31   
emb|CDY52779.1|  BnaCnng23240D                                          127   1e-31   
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    127   1e-31   
ref|XP_010932734.1|  PREDICTED: pectinesterase-like                     127   1e-31   
ref|XP_010260072.1|  PREDICTED: pectinesterase-like                     127   1e-31   
ref|XP_003622696.1|  Pectinesterase                                     127   1e-31   
emb|CDX68522.1|  BnaC01g26000D                                          123   1e-31   
gb|KFK26958.1|  hypothetical protein AALP_AA8G315400                    127   1e-31   
ref|XP_011076457.1|  PREDICTED: probable pectinesterase/pectinest...    127   1e-31   
ref|NP_001275775.1|  pectinesterase 2 precursor                         127   1e-31   
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             127   1e-31   
emb|CDX83076.1|  BnaA01g20760D                                          123   1e-31   
ref|XP_010938361.1|  PREDICTED: probable pectinesterase/pectinest...    127   1e-31   
gb|EMS52976.1|  putative pectinesterase/pectinesterase inhibitor 21     129   1e-31   
ref|XP_002457749.1|  hypothetical protein SORBIDRAFT_03g012820          127   1e-31   
ref|XP_010247589.1|  PREDICTED: probable pectinesterase/pectinest...    127   1e-31   
ref|XP_003591498.1|  Pectinesterase                                     125   1e-31   
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    127   1e-31   
ref|XP_004231159.2|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    126   1e-31   
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                   127   1e-31   
ref|XP_006432534.1|  hypothetical protein CICLE_v10000705mg             127   1e-31   
ref|NP_001275859.1|  pectinesterase 1 precursor                         127   1e-31   
ref|NP_190491.1|  putative pectinesterase/pectinesterase inhibito...    127   1e-31   
ref|XP_003554529.1|  PREDICTED: probable pectinesterase/pectinest...    127   1e-31   
gb|KJB49322.1|  hypothetical protein B456_008G113200                    126   1e-31   
ref|XP_002523112.1|  Pectinesterase-2 precursor, putative               127   1e-31   
gb|AAB38794.1|  pectin methylesterase                                   126   2e-31   
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    127   2e-31   
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   126   2e-31   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             127   2e-31   
gb|KJB67143.1|  hypothetical protein B456_010G177500                    126   2e-31   
gb|KDO36280.1|  hypothetical protein CISIN_1g027636mg                   122   2e-31   
emb|CDY08117.1|  BnaA06g16090D                                          126   2e-31   
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    126   2e-31   
ref|XP_010917364.1|  PREDICTED: pectinesterase                          126   2e-31   
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 126   2e-31   
ref|XP_007199619.1|  hypothetical protein PRUPE_ppa024812mg             126   2e-31   
ref|XP_007146998.1|  hypothetical protein PHAVU_006G088100g             126   2e-31   
ref|XP_010260187.1|  PREDICTED: probable pectinesterase/pectinest...    126   2e-31   
gb|AFI23411.1|  pectin methylesterase                                   127   2e-31   
gb|AAB67740.1|  PME1.9                                                  125   2e-31   
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             126   2e-31   
ref|XP_002317208.1|  pectin methylesterase family protein               126   2e-31   
emb|CDY05911.1|  BnaC08g20880D                                          126   2e-31   
ref|XP_010939847.1|  PREDICTED: pectinesterase-like                     127   2e-31   
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg             127   2e-31   
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                     126   2e-31   
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         126   2e-31   
ref|XP_010058942.1|  PREDICTED: pectinesterase-like                     123   2e-31   
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   126   2e-31   
ref|XP_009111301.1|  PREDICTED: probable pectinesterase/pectinest...    126   2e-31   
gb|EYU19222.1|  hypothetical protein MIMGU_mgv1a003983mg                126   2e-31   
ref|XP_011046483.1|  PREDICTED: probable pectinesterase/pectinest...    126   2e-31   
ref|XP_003553884.1|  PREDICTED: probable pectinesterase/pectinest...    125   2e-31   
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      126   2e-31   
ref|XP_002273427.2|  PREDICTED: probable pectinesterase/pectinest...    126   2e-31   
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     127   2e-31   
ref|XP_006604099.1|  PREDICTED: probable pectinesterase/pectinest...    125   2e-31   
ref|XP_006396440.1|  hypothetical protein EUTSA_v10028546mg             126   2e-31   
gb|EMT19669.1|  Putative pectinesterase/pectinesterase inhibitor 21     129   2e-31   
ref|XP_009596446.1|  PREDICTED: probable pectinesterase/pectinest...    127   2e-31   
ref|XP_010430937.1|  PREDICTED: probable pectinesterase/pectinest...    120   2e-31   
ref|XP_003627458.1|  Pectinesterase                                     126   2e-31   
ref|XP_007163132.1|  hypothetical protein PHAVU_001G209100g             126   2e-31   
ref|XP_004240956.1|  PREDICTED: probable pectinesterase/pectinest...    127   2e-31   
ref|XP_009590338.1|  PREDICTED: pectinesterase 3-like                   122   2e-31   
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                     126   3e-31   
ref|XP_008673992.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    126   3e-31   
ref|XP_007220646.1|  hypothetical protein PRUPE_ppa003474mg             126   3e-31   
ref|XP_002875955.1|  pectinesterase family protein                      126   3e-31   
ref|XP_008339018.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    122   3e-31   
ref|XP_006397702.1|  hypothetical protein EUTSA_v10001409mg             125   3e-31   
ref|XP_004155863.1|  PREDICTED: pectinesterase 2-like                   122   3e-31   
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 125   3e-31   
ref|XP_002304257.2|  pectinesterase family protein                      126   3e-31   
ref|XP_008438193.1|  PREDICTED: pectinesterase 2                        125   3e-31   
emb|CDP20872.1|  unnamed protein product                                125   3e-31   
ref|XP_010058468.1|  PREDICTED: pectinesterase 2-like                   127   3e-31   
gb|ACJ68111.1|  pectinesterase                                          125   3e-31   
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    126   3e-31   
ref|XP_011079963.1|  PREDICTED: probable pectinesterase/pectinest...    126   3e-31   
ref|XP_008231877.1|  PREDICTED: probable pectinesterase/pectinest...    126   3e-31   
emb|CDY24663.1|  BnaA05g30620D                                          126   3e-31   
gb|KEH41800.1|  pectinesterase/pectinesterase inhibitor                 126   3e-31   
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                     126   3e-31   
ref|XP_004173650.1|  PREDICTED: probable pectinesterase/pectinest...    124   4e-31   
gb|KHN42767.1|  Pectinesterase 2                                        125   4e-31   
ref|XP_002872845.1|  pectinesterase family protein                      125   4e-31   
ref|XP_003526378.1|  PREDICTED: probable pectinesterase/pectinest...    125   4e-31   
ref|XP_010088299.1|  putative pectinesterase/pectinesterase inhib...    126   4e-31   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    126   4e-31   
ref|XP_004967522.1|  PREDICTED: probable pectinesterase/pectinest...    125   4e-31   
emb|CDY04739.1|  BnaC05g18500D                                          125   4e-31   
ref|XP_004502642.1|  PREDICTED: probable pectinesterase/pectinest...    126   4e-31   
ref|XP_002874923.1|  pectinesterase family protein                      126   4e-31   
ref|XP_006382446.1|  hypothetical protein POPTR_0005s02250g             125   4e-31   
ref|XP_008783207.1|  PREDICTED: probable pectinesterase/pectinest...    126   4e-31   
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     126   4e-31   
emb|CDY18944.1|  BnaC04g04060D                                          125   4e-31   



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV ++SN+GSLIDPAGWLEW G+FAL TLYYGEY NRGPGSNTSARVKWPGYR
Sbjct  468  PWKQYSRTVILISNIGSLIDPAGWLEWSGDFALNTLYYGEYLNRGPGSNTSARVKWPGYR  527

Query  213  ILN-TSEANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++N +SEA+QFTVGNFI G +WIPATGVPFY  LT+S
Sbjct  528  VINSSSEASQFTVGNFIQGSEWIPATGVPFYSGLTSS  564



>ref|XP_006359860.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=562

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFML+++GSLIDPAG+LEW+G FAL TLYYGEY NRGPGSNTSARVKWPGYR
Sbjct  466  PWKEYSRTVFMLTHIGSLIDPAGFLEWNGSFALSTLYYGEYMNRGPGSNTSARVKWPGYR  525

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++N S EA+ FTVGNFI G++W+P TG PFYVNLTAS
Sbjct  526  VINNSAEASLFTVGNFIEGKEWLPDTGFPFYVNLTAS  562



>ref|XP_004247400.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=562

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFML+++GSLIDPAG+LEW+G FAL TLYYGEY NRGPGSNTSARV WPGYR
Sbjct  466  PWKEYSRTVFMLTHIGSLIDPAGFLEWNGSFALSTLYYGEYMNRGPGSNTSARVTWPGYR  525

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++NTS EA+ FTVGNFI G++W+P TG PFYVNLTAS
Sbjct  526  VINTSAEASLFTVGNFIEGKEWLPDTGFPFYVNLTAS  562



>dbj|BAF95866.1| pectin methylesterase isoform alpha [Vitis hybrid cultivar]
Length=234

 Score =   160 bits (405),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 84/95 (88%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M SN+G LIDPAGWLEWDG+FAL TLYYGEY+NRGPGSNTS RV WPGYR
Sbjct  106  PWKEYSRTVYMQSNIGDLIDPAGWLEWDGDFALSTLYYGEYKNRGPGSNTSGRVTWPGYR  165

Query  213  ILNTSE-ANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++N+S  A+QFTVG FI G +W+PATG+P+Y NLT
Sbjct  166  VINSSSVASQFTVGAFIQGDEWLPATGIPYYSNLT  200



>ref|XP_006355816.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=479

 Score =   165 bits (418),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV + SN+GSLIDPAGWLEW G+FAL TLYYGEY NRGPGSNTSARVKWPGYR
Sbjct  383  PWKQYSRTVILFSNIGSLIDPAGWLEWSGDFALNTLYYGEYLNRGPGSNTSARVKWPGYR  442

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++N+S EA+QFTVGNFI G +WIPAT VPFY  LT+S
Sbjct  443  VINSSTEASQFTVGNFIQGSEWIPATEVPFYSGLTSS  479



>ref|XP_009771845.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=561

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVF+LSN+GSLIDPAGWLEWDG FAL TLYYGEY N+GPGSNT+ARVKWPGYR
Sbjct  464  PWKQYSRTVFLLSNIGSLIDPAGWLEWDGNFALNTLYYGEYLNKGPGSNTNARVKWPGYR  523

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++N+S EA+QF VGNF+ G QW+PATG PF++ LT+S
Sbjct  524  VINSSAEASQFNVGNFLQGSQWLPATGFPFFLGLTSS  560



>ref|XP_009628637.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=567

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV ML+++GSLI+PAG+LEW+G FAL TLYYGEY+NRGPGSNTSARV WPGYR
Sbjct  471  PWKEYSRTVIMLTHIGSLIEPAGYLEWNGTFALDTLYYGEYRNRGPGSNTSARVNWPGYR  530

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++N S EA+QFTVGNFI G++W+P TG PFY+NLTAS
Sbjct  531  VINNSAEASQFTVGNFIEGKEWLPDTGFPFYLNLTAS  567



>ref|XP_009614504.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=563

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 87/97 (90%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVF+ SN+GSLIDPAGWLEWDG FAL TLYYGEY N GPGS TSARVKWPGYR
Sbjct  464  PWKQYSRTVFLRSNIGSLIDPAGWLEWDGNFALNTLYYGEYLNNGPGSITSARVKWPGYR  523

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++N+S EA+QFTVGNFI G QW+PATG PF+++LT+S
Sbjct  524  VINSSAEASQFTVGNFIQGSQWLPATGFPFFLSLTSS  560



>ref|XP_002271665.2| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=561

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 85/95 (89%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M SN+G+LIDPAGWLEWDG+FAL TLYYGEY+NRGPGSNTS RV WPGYR
Sbjct  465  PWKEYSRTVYMQSNIGNLIDPAGWLEWDGDFALSTLYYGEYKNRGPGSNTSGRVTWPGYR  524

Query  213  ILNTSE-ANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++N+S  A+QFTVG FI G +W+PATG+P+Y NLT
Sbjct  525  VINSSSVASQFTVGAFIQGDEWLPATGIPYYSNLT  559



>ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=567

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV + S +GSLI+PAGWLEW+G+FALKTLYYGEY NRGPGS+TSARVKWPGYR
Sbjct  471  PWKEYSRTVVLQSYIGSLIEPAGWLEWNGDFALKTLYYGEYMNRGPGSSTSARVKWPGYR  530

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++N+S EA+QFTVGNFI G +W+P TG PFY+NLT+S
Sbjct  531  VINSSIEASQFTVGNFIQGGEWLPPTGFPFYLNLTSS  567



>ref|XP_009592542.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=568

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 85/97 (88%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ S +GSLI+PAGWLEW+G FALKTLYYGEY NRGPGSNTS RVKWPGYR
Sbjct  472  PWKEYSRTVFLQSYIGSLIEPAGWLEWNGNFALKTLYYGEYMNRGPGSNTSVRVKWPGYR  531

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++N+S E +QFTVGNFI G +W+PATG PFY+N T S
Sbjct  532  VINSSAETSQFTVGNFIQGGEWLPATGFPFYLNFTFS  568



>ref|XP_009765668.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=566

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV ML+++GSLI+PAG+LEW+G FAL TLYYGEY NRGPGSNTSARV W GYR
Sbjct  470  PWKEYSRTVIMLTHIGSLIEPAGYLEWNGTFALDTLYYGEYMNRGPGSNTSARVNWSGYR  529

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++N S EA+QFTVGNFI G++W+P TG PFY+NLTAS
Sbjct  530  VINNSAEASQFTVGNFIEGKEWLPDTGFPFYLNLTAS  566



>emb|CDP15270.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 85/97 (88%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW+EYSRTV++LSN+ SLIDPAGWL W+G FAL TL+YGEY+NRGPGSNT+ARVKWPGYR
Sbjct  491  PWREYSRTVYLLSNMESLIDPAGWLPWNGSFALSTLFYGEYKNRGPGSNTTARVKWPGYR  550

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++ NT+ A+QFTVGNFI G  W+P TG+PFY NLT S
Sbjct  551  VITNTTVASQFTVGNFIQGTAWLPNTGIPFYPNLTPS  587



>ref|XP_011079629.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=566

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 82/96 (85%), Gaps = 1/96 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM S + +++DP GWLEW+G FAL TLYYGEY NRGPGSNTSARV WPGYR
Sbjct  467  PWKQYSRTVFMYSKMENVVDPQGWLEWNGSFALDTLYYGEYMNRGPGSNTSARVTWPGYR  526

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTA  109
            ++N+S EA+QFTV NFI G QW+PAT +PFY NLTA
Sbjct  527  VINSSTEASQFTVANFIQGNQWLPATAIPFYPNLTA  562



>gb|EPS62329.1| pectinesterase [Genlisea aurea]
Length=560

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV++LS + S++DP GWLEW+G FAL TLYYGEYQNRGPGSNTS RV WPGY 
Sbjct  463  PWKQYSRTVYLLSKIESVVDPKGWLEWNGTFALSTLYYGEYQNRGPGSNTSGRVNWPGYH  522

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++N+S EA+QFTV NFI G  W+P++G+PFY+NLTA+
Sbjct  523  VINSSAEASQFTVENFIQGSLWLPSSGLPFYLNLTAT  559



>gb|EYU46749.1| hypothetical protein MIMGU_mgv1a0044631mg, partial [Erythranthe 
guttata]
Length=325

 Score =   149 bits (376),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVFM SN+ +++DP GWLEWDG+FAL T YY EY+NRGPGSNT+ARV W GY 
Sbjct  229  PWKLYSRTVFMFSNMEAVVDPKGWLEWDGDFALNTSYYREYKNRGPGSNTTARVTWTGYA  288

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            +LN+S EA+QFTV NFI G QW+PATG PF+ NLTA+
Sbjct  289  VLNSSTEASQFTVANFIQGNQWLPATGFPFFPNLTAT  325



>ref|XP_010684346.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=576

 Score =   151 bits (381),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 61/94 (65%), Positives = 81/94 (86%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRT+FMLS +  ++DPAGWLEW G+FAL TLYYGEY+NRGPG+NTSARV WPGY 
Sbjct  482  PWKDYSRTIFMLSYIDDVVDPAGWLEWSGDFALSTLYYGEYKNRGPGANTSARVTWPGYN  541

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ N+S+A+ FTVG FILG +W+ + G+P+Y++L
Sbjct  542  VINNSSDASNFTVGKFILGGEWLQSYGIPYYLDL  575



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   151 bits (381),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM S LGSLIDPAGWLEWDG+FAL TLYYGEY N+GPGSNTS RV WPGYR
Sbjct  464  PWKQYSRTVFMQSFLGSLIDPAGWLEWDGDFALSTLYYGEYMNQGPGSNTSRRVTWPGYR  523

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + +EA+ FTV +FI G QW+ AT VPF   L
Sbjct  524  VITSAAEASNFTVASFIQGDQWLGATSVPFTSGL  557



>gb|KDO87160.1| hypothetical protein CISIN_1g015794mg [Citrus sinensis]
Length=400

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFMLS LG LI PAGWLEW+G FAL TL+YGEY+NRGPGSNTSARV WPGYR
Sbjct  305  PWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGPGSNTSARVTWPGYR  364

Query  213  ILNTSE-ANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++N S  A QFT G F+ G +W+ +TG+PFY+NLT
Sbjct  365  VINNSAVAAQFTAGPFLQGSEWLNSTGIPFYLNLT  399



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFMLS LG LI PAGWLEW+G FAL TL+YGEY+NRGPGSNTSARV WPGYR
Sbjct  453  PWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGPGSNTSARVTWPGYR  512

Query  213  ILNTSE-ANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++N S  A QFT G F+ G +W+ +TG+PFY+NLT
Sbjct  513  VINNSAVAAQFTAGPFLQGSEWLNSTGIPFYLNLT  547



>gb|AHB84678.1| pectin methylesterase [Citrus reticulata]
Length=569

 Score =   150 bits (379),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFMLS LG LI PAGWLEW+G FAL TL+YGEY+NRGPGSNTSARV WPGYR
Sbjct  474  PWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGPGSNTSARVTWPGYR  533

Query  213  ILNTSE-ANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++N S  A QFT G F+ G +W+ +TG+PFY+NLT
Sbjct  534  VINNSAVAAQFTAGPFLQGSEWLNSTGIPFYLNLT  568



>ref|XP_006480001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Citrus sinensis]
Length=569

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFMLS LG LI PAGWLEW+G FAL TL+YGEY+NRGPGSNTSARV WPGYR
Sbjct  474  PWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGPGSNTSARVTWPGYR  533

Query  213  ILNTSE-ANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++N S  A QFT G F+ G +W+ +TG+PFY+NLT
Sbjct  534  VINNSAVAAQFTAGPFLQGSEWLNSTGIPFYLNLT  568



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   149 bits (377),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 63/94 (67%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ S +  L+DPAGWLEW+  FAL TLYYGEY NRGPGSNTSARV WPGYR
Sbjct  464  PWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYGEYMNRGPGSNTSARVTWPGYR  523

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ N++EA+QFTVG FI G  W+ +T +P+++NL
Sbjct  524  VITNSTEASQFTVGAFIQGNTWLNSTDIPYFLNL  557



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   149 bits (377),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 63/94 (67%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ S +  L+DPAGWLEW+  FAL TLYYGEY NRGPGSNTSARV WPGYR
Sbjct  464  PWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYGEYMNRGPGSNTSARVTWPGYR  523

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ N++EA+QFTVG FI G  W+ +T +P+++NL
Sbjct  524  VITNSTEASQFTVGAFIQGNTWLNSTDIPYFLNL  557



>ref|XP_006841486.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRT+FM S++G LIDPAGW EW G+FAL TLYYGEY NRGPG++TS RVKWPGYR
Sbjct  446  PWKQYSRTIFMQSDIGDLIDPAGWFEWSGDFALSTLYYGEYMNRGPGADTSNRVKWPGYR  505

Query  213  ILN-TSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N +SEA+QFTV +FI G +W+PA+ V FY  L
Sbjct  506  VINSSSEASQFTVASFIQGNEWLPASNVAFYAGL  539



>ref|XP_008386773.1| PREDICTED: pectinesterase-like, partial [Malus domestica]
Length=238

 Score =   142 bits (357),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV++ S +  L+DPAGWLEW+G FAL TLYYGEY NRGPGSNTSARV WPGYR
Sbjct  143  PWKEYSRTVYLKSYIDDLVDPAGWLEWNGSFALSTLYYGEYLNRGPGSNTSARVTWPGYR  202

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTA  109
            ++N+S EA+QFTVG FI G  W+ +T +P+++ LT+
Sbjct  203  VINSSVEASQFTVGEFIQGSDWLNSTNIPYFLGLTS  238



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   147 bits (371),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ S +  L+DPAGWLEW+  FAL TLYY EY NRGPGSNTSARV WPGYR
Sbjct  464  PWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYREYMNRGPGSNTSARVTWPGYR  523

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            I+ N++EA+QFTVG FI G  W+ +T +P+++NL
Sbjct  524  IITNSTEASQFTVGAFIQGNTWLNSTDIPYFLNL  557



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   147 bits (371),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S +  L+ PAGWLEW+G FAL TLYYGEY NRGPGSNTSARVKWPGYR
Sbjct  467  PWKEYSRTVYMKSYIDDLVQPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVKWPGYR  526

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++N+S EANQFTVG FI G +W+ +T +P+++ LT
Sbjct  527  VINSSDEANQFTVGPFIQGNEWLNSTNIPYFIGLT  561



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   147 bits (371),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S +  L++PAGWLEW+G FAL TLYYGEY NRGPGSNTSARV WPGYR
Sbjct  483  PWKEYSRTVYMKSYIDDLVEPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVTWPGYR  542

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++N+S EANQFTVG FI G +W+ AT +P+++ LT
Sbjct  543  VINSSAEANQFTVGPFIQGNEWLNATNIPYFIGLT  577



>ref|XP_009388374.1| PREDICTED: pectinesterase-like, partial [Musa acuminata subsp. 
malaccensis]
Length=239

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 77/90 (86%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKE+SRTVFM S L +LIDPAGWLEW+G+FAL TLYYGEY NRGPGSNT+ RVKWPGYR
Sbjct  145  PWKEFSRTVFMQSYLDNLIDPAGWLEWNGDFALNTLYYGEYMNRGPGSNTTGRVKWPGYR  204

Query  213  ILN-TSEANQFTVGNFILGQQWIPATGVPF  127
            ++N T+EA+ FTV +FI G QW+ +T VPF
Sbjct  205  VINSTAEASNFTVTSFIQGDQWLGSTSVPF  234



>gb|EPS67066.1| pectinesterase [Genlisea aurea]
Length=955

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV++LSN+ S++DPAGWLEW+G F L TLYYGEY NRGPGSNT+ RV WPGYR
Sbjct  860  PWKAYSRTVYLLSNMESVVDPAGWLEWNGTFGLSTLYYGEYSNRGPGSNTTGRVNWPGYR  919

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTA  109
            ++N+S EA  F V NFI G QW+P TG+PFY++LTA
Sbjct  920  VINSSTEAGLFAVDNFIQGSQWLPLTGLPFYLSLTA  955



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ S L  LIDPAGWLEW G+FAL TLYYGEY NRGPG+NTS+RV WPGYR
Sbjct  467  PWKEYSRTVFLRSFLDDLIDPAGWLEWSGDFALTTLYYGEYMNRGPGANTSSRVSWPGYR  526

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N+S EA+QFTV +FI G +W+ +TGVP++  L
Sbjct  527  VINSSTEASQFTVASFIQGNEWLSSTGVPYFSGL  560



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   145 bits (366),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 65/94 (69%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+M S L SLI+PAGWLEWDG+FAL TLYYGEY NRGPGS+T+ RVKWPGYR
Sbjct  472  PWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWPGYR  531

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N+S EA+ FTV +FI G QW+ +T VPF   L
Sbjct  532  VINSSAEASMFTVESFIEGDQWLGSTSVPFTAGL  565



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   145 bits (366),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 65/94 (69%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+M S L SLI+PAGWLEWDG+FAL TLYYGEY NRGPGS+T+ RVKWPGYR
Sbjct  472  PWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWPGYR  531

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N+S EA+ FTV +FI G QW+ +T VPF   L
Sbjct  532  VINSSAEASMFTVESFIEGDQWLGSTSVPFTAGL  565



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   145 bits (365),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 65/94 (69%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+M S L SLI+PAGWLEWDG+FAL TLYYGEY NRGPGS+T+ RVKWPGYR
Sbjct  471  PWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWPGYR  530

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N+S EA+ FTV +FI G QW+ +T VPF   L
Sbjct  531  VINSSAEASMFTVESFIEGDQWLGSTSVPFTAGL  564



>ref|XP_004307817.2| PREDICTED: pectinesterase 2-like [Fragaria vesca subsp. vesca]
Length=518

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVF+ S L SL+DPAGWLEWDG FALKTLYYGEY+N+GPGS TS RVKW GYR
Sbjct  425  PWKTYSRTVFLQSYLDSLVDPAGWLEWDGNFALKTLYYGEYKNKGPGSGTSGRVKWGGYR  484

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++SEA++FTVGN I G  W+PATGVPF   L
Sbjct  485  VITSSSEASKFTVGNLIAGSSWLPATGVPFTSGL  518



>ref|XP_011076334.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Sesamum indicum]
Length=475

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM + L SL+DPAGWLEWDG FAL TLYYGEY+N GPGS+TS RV+W GYR
Sbjct  382  PWKEYSRTVFMQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNTGPGSSTSRRVRWRGYR  441

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + +EA +FTV NFI GQ W+PATGVPF   L
Sbjct  442  VITSAAEAGRFTVANFIAGQSWLPATGVPFTAGL  475



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV++ S +  L+DPAGWLEW+G FAL TLYYGEY NRGPGSNTSARV WPGYR
Sbjct  484  PWKEYSRTVYLKSYIDDLVDPAGWLEWNGSFALSTLYYGEYLNRGPGSNTSARVTWPGYR  543

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLTA  109
            ++N+S EA+QFTVG FI G  W+ +T +P+++ LT+
Sbjct  544  VINSSVEASQFTVGEFIQGSDWLNSTNIPYFLGLTS  579



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   144 bits (363),  Expect = 9e-38, Method: Composition-based stats.
 Identities = 64/94 (68%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW+EYSRTVFM ++L SLIDPAGWLEW G FAL TLYYGEY N GPG++TS RVKWPGY 
Sbjct  423  PWQEYSRTVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGPGADTSQRVKWPGYH  482

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + +EA++FTVGNF+ G  WIPAT VPF   L
Sbjct  483  VITSAAEASKFTVGNFLSGNSWIPATEVPFTSGL  516



>ref|XP_002523113.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF39298.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=557

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ S +  ++DP GWLEW+G FAL TLYYGEY NRGPGSNTSARV WPGYR
Sbjct  463  PWKEYSRTVFLRSYIDDVVDPVGWLEWNGAFALSTLYYGEYMNRGPGSNTSARVTWPGYR  522

Query  213  ILN-TSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++N T+EA+QFTV  FI G +W+ ATG+PF++ L+
Sbjct  523  VINSTTEASQFTVRPFIQGSEWLNATGIPFFLGLS  557



>ref|XP_010921648.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=240

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM S LGSLI+PAGWLEWDG+FAL TLYYGEY N GPGSNTS RV WPGYR
Sbjct  146  PWKQYSRTVFMQSYLGSLINPAGWLEWDGDFALSTLYYGEYMNLGPGSNTSRRVTWPGYR  205

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + +EA+ FTV +FI G QW+ AT VPF
Sbjct  206  VITSAAEASNFTVQSFIQGDQWLGATSVPF  235



>gb|KDP28190.1| hypothetical protein JCGZ_13961 [Jatropha curcas]
Length=430

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV++ S +  LIDPAGWLEW+G+FALKTLYYGEY NRGPGSNTS RV WPGYR
Sbjct  336  PWKEYSRTVYITSYIDDLIDPAGWLEWNGDFALKTLYYGEYMNRGPGSNTSGRVTWPGYR  395

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N S EA+QF V  FI G +W+ ATGVPF + L
Sbjct  396  VINNSAEASQFAVEPFIQGSEWLNATGVPFSLGL  429



>ref|XP_002322401.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06528.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=517

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ + L SL+DPAGWLEWDG FAL TLYYGEY+N GPG++T  RVKW GYR
Sbjct  424  PWKEYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSGPGASTRGRVKWRGYR  483

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ +S EA++FTV NFI G+ W+PATGVPFY  L
Sbjct  484  VITSSTEASRFTVANFIAGRSWLPATGVPFYPGL  517



>gb|AFG69043.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69044.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69045.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69046.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69047.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69048.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69050.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69051.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69052.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69053.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
 gb|AFG69054.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
Length=123

 Score =   134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM S LG LI PAGWLEW+G FAL TLYYGEY NRGPG+ T+ RVKWPGYR
Sbjct  23   PWKEYSRTVFMQSFLGDLIQPAGWLEWNGSFALSTLYYGEYMNRGPGAGTTNRVKWPGYR  82

Query  213  ILN-TSEANQFTVGNFILGQQWIPATGVPF  127
            ++N +SEA+ FTV  FI G  W+P+TGV +
Sbjct  83   VINSSSEASSFTVSKFIEGDSWLPSTGVKY  112



>sp|P85076.1|PME_ACTDE RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase [Actinidia deliciosa]
Length=321

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+LS + SLIDPAGWLEW G+FAL TLYY EY+N GPGSNT+ARV WPGY 
Sbjct  227  PWKEYSRTVFLLSQMESLIDPAGWLEWSGDFALTTLYYREYKNTGPGSNTTARVTWPGYA  286

Query  213  I-LNTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            +  N +E  QFTVGNFI G QW+ +  +P Y+NLT
Sbjct  287  VTTNETEVIQFTVGNFIQGSQWLTSYNIPVYLNLT  321



>ref|XP_004494389.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cicer arietinum]
Length=549

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV++ S +  LIDPAGWL W+G FAL TLYYGEY+NRGPGSNTSARV WPGYR
Sbjct  455  PWKQYSRTVYLQSLIEDLIDPAGWLPWNGTFALDTLYYGEYKNRGPGSNTSARVTWPGYR  514

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ NT+EA+QFTV NFI G  W+ +TG+PF+ +L+
Sbjct  515  VITNTTEASQFTVRNFIQGNDWLNSTGIPFFPDLS  549



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV++ S + +LIDPAGWLEW+G FAL TL+YGEY+NRGPGSNTSARV WPGY+
Sbjct  463  PWKKYSRTVYLNSFIDNLIDPAGWLEWNGTFALDTLFYGEYKNRGPGSNTSARVTWPGYK  522

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ N +EA+QFTV  FI G +W+ +TGVPF+++L+
Sbjct  523  VITNATEASQFTVRQFIQGNEWLNSTGVPFFLDLS  557



>ref|XP_010098938.1| Pectinesterase 2 [Morus notabilis]
 gb|EXB76240.1| Pectinesterase 2 [Morus notabilis]
Length=518

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M +NLGSLI+PAGWLEW G FALKTLYY EY N GPGS+TS RVKW GY 
Sbjct  426  PWKEYSRTVVMKTNLGSLINPAGWLEWSGNFALKTLYYAEYANTGPGSSTSNRVKWTGYH  485

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++  SEA++FTVGNFI G  W+PAT VP+
Sbjct  486  VIGASEASKFTVGNFIAGGSWLPATNVPY  514



>ref|XP_011010931.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=517

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ + L SL+DPAGWLEWDG FAL TLYYGEY+N GPG++T  RVKW GYR
Sbjct  424  PWKEYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNFGPGASTRGRVKWRGYR  483

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ +S EA++FTV NFI G+ W+PATGVPFY  L
Sbjct  484  VITSSTEASRFTVANFIAGRSWLPATGVPFYPGL  517



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   142 bits (357),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM S L SLI PAGWLEW+G FAL TLYYGEY NRGPGSNTS+RV WPG+R
Sbjct  473  PWKEYSRTVFMQSYLDSLISPAGWLEWNGSFALSTLYYGEYMNRGPGSNTSSRVAWPGFR  532

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + +EA+ FT   F+ G QW+ +T VPF + L
Sbjct  533  VIGDAAEASNFTAAAFVQGDQWLGSTSVPFSLGL  566



>gb|AFG69049.1| hypothetical protein 2_5100_02, partial [Pinus taeda]
Length=123

 Score =   133 bits (335),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM S LG LI PAGWLEW+G FAL TLYYGEY NRGPG+ T+ RVKWPGYR
Sbjct  23   PWKEYSRTVFMQSFLGDLIQPAGWLEWNGSFALSTLYYGEYMNRGPGAGTTNRVKWPGYR  82

Query  213  ILN-TSEANQFTVGNFILGQQWIPATGVPF  127
            ++N +SEA+ FTV  FI G  W+P+TGV +
Sbjct  83   VINSSSEASSFTVSKFIEGDLWLPSTGVKY  112



>ref|XP_010101099.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
 gb|EXC45243.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
Length=523

 Score =   141 bits (356),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L SL+DPAGWLEWDG+FAL TLYYGEY+N GP ++TS RVKW GYR
Sbjct  430  PWKQYSRTVFMQTYLDSLVDPAGWLEWDGDFALNTLYYGEYRNLGPAASTSRRVKWSGYR  489

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++SEA+QFTV NFI GQ W+PATGV F   L
Sbjct  490  VITSSSEASQFTVANFIAGQSWLPATGVRFTAGL  523



>ref|XP_007220109.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
 gb|EMJ21308.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
Length=482

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ S L +L+DPAGWLEWDG FALKTLYYGEY+N GPGS+TS RV W GY 
Sbjct  389  PWKEYSRTVFLQSYLDTLVDPAGWLEWDGNFALKTLYYGEYKNTGPGSSTSGRVNWGGYH  448

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++SEA++FTVGNFI G  W+PAT VPF   L
Sbjct  449  VITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  482



>ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=455

 Score =   140 bits (354),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVF+ + L SL+DPAGWLEWDG FAL TLYYGEY+N GP S+TS RVKW GYR
Sbjct  362  PWKQYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNMGPASSTSGRVKWRGYR  421

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + +EA+QFTV NFI G+ W+PATGVPF   L
Sbjct  422  VITSATEASQFTVANFIAGRSWLPATGVPFSSGL  455



>ref|XP_006367816.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Solanum tuberosum]
Length=474

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L SL+DPAGWLEWDG+FAL TLYYGEY+N GPG++TS+RVKW GYR
Sbjct  381  PWKQYSRTVFMKTYLDSLVDPAGWLEWDGDFALSTLYYGEYRNAGPGASTSSRVKWSGYR  440

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ N++EA +F+V NFI G+ W+PAT VPF   L
Sbjct  441  VITNSNEAARFSVENFIAGRSWLPATNVPFRAGL  474



>ref|XP_010910881.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=515

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 76/90 (84%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV+M + L SLIDPAGWLEWDG+FALKTLYYGEY N G G++TS RV WPGY 
Sbjct  422  PWKKYSRTVYMKTFLDSLIDPAGWLEWDGDFALKTLYYGEYMNTGAGADTSQRVTWPGYH  481

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + +EA+QFTVGNF+ G  WIPATGVP+
Sbjct  482  VITSAAEASQFTVGNFLSGNSWIPATGVPY  511



>gb|EYU24970.1| hypothetical protein MIMGU_mgv1a022192mg [Erythranthe guttata]
Length=530

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+M + + SLIDP GWLEWDG FAL TLYYGEY+N GPGSNT+ RV W GYR
Sbjct  437  PWKLYSRTVYMQTYIDSLIDPVGWLEWDGSFALDTLYYGEYRNSGPGSNTTRRVNWSGYR  496

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ N SEA+ FTV NFI GQ W+PATGVPF   L
Sbjct  497  VITNASEASTFTVANFIAGQSWLPATGVPFTAGL  530



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV++ S +  LIDPAGWLEWDG FAL TLYYGEY NRGPG+NTS RV WPGYR
Sbjct  507  PWKKYSRTVYLNSLMEDLIDPAGWLEWDGNFALDTLYYGEYNNRGPGANTSRRVTWPGYR  566

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ N++EA+QFTV NFI G +W+ + G+PF+  L+
Sbjct  567  VITNSTEASQFTVANFIQGNEWLTSLGIPFFSGLS  601



>ref|XP_010069896.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=561

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+MLSN+  ++DPAGWLEW+G FAL TLYY EY+N+GPGSNTSARV WPGY+
Sbjct  467  PWKEYSRTVYMLSNIEDVVDPAGWLEWNGTFALNTLYYAEYRNQGPGSNTSARVTWPGYK  526

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +L N +EA QFTV +FI G  W+  T +P+Y+ L
Sbjct  527  VLTNVTEATQFTVSSFIQGNDWLNGTSIPYYLGL  560



>emb|CBI38888.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM + L SLI+PAGW+EW G FALKTLYYGEY N GPGS+TS RV W GY 
Sbjct  166  PWKEYSRTVFMKTYLDSLINPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVNWAGYH  225

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++SEA++FTVGNFI G  W+PAT VPF   L
Sbjct  226  VITSSSEASKFTVGNFIAGNSWLPATNVPFTSGL  259



>ref|XP_008232606.1| PREDICTED: pectinesterase 2 [Prunus mume]
Length=511

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW+EYSRTVFM + L SLIDPAGW+EW G FALKTLYYGEY N GPGS+TS RVKW GY 
Sbjct  418  PWREYSRTVFMKTYLDSLIDPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVKWAGYH  477

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + SEA++FTVGNFI G  W+PAT VPF
Sbjct  478  VITSASEASKFTVGNFIAGNSWLPATNVPF  507



>gb|KHN43496.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=481

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV++ S +  LIDP GWLEW+G FAL TLYYGEY NRGPGSNTSARV WPGYR
Sbjct  387  PWKKYSRTVYLNSYMEDLIDPKGWLEWNGTFALDTLYYGEYNNRGPGSNTSARVTWPGYR  446

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ N +EANQFTV NFI G +W+ +T +PF+ + +
Sbjct  447  VIKNATEANQFTVRNFIQGNEWLSSTDIPFFSDFS  481



>ref|XP_007220661.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
 gb|EMJ21860.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
Length=511

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW+EYSRTVFM + L SLIDPAGW+EW G FALKTLYYGEY N GPGS+TS RVKW GY 
Sbjct  418  PWREYSRTVFMKTYLDSLIDPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVKWAGYH  477

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + SEA++FTVGNFI G  W+PAT VPF
Sbjct  478  VITSASEASKFTVGNFIAGNSWLPATNVPF  507



>ref|XP_010552690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6 
[Tarenaya hassleriana]
Length=543

 Score =   140 bits (352),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 60/90 (67%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW+ YSRTVFM   LG ++ P GWLEW G+FAL TLYYGEY N GPG+N S RVKWPG++
Sbjct  450  PWRMYSRTVFMKCFLGGVVSPVGWLEWSGDFALSTLYYGEYMNSGPGANISDRVKWPGFQ  509

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            +L T SEA++FTVGNF+ G  WIPA GVPF
Sbjct  510  VLMTASEASKFTVGNFLAGNSWIPAAGVPF  539



>ref|XP_004299718.2| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=575

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV++ + + SLIDP GWLEWDG+FAL TLYY EY NRGPGSNTS+RV WPGY 
Sbjct  482  PWKEYSRTVYLQNFMDSLIDPVGWLEWDGDFALSTLYYAEYDNRGPGSNTSSRVTWPGYH  541

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            I+  ++A  FTV NF++G  W+P TGVP+
Sbjct  542  IIGATDAANFTVSNFLVGDNWLPQTGVPY  570



>ref|XP_003553658.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39-like 
[Glycine max]
Length=615

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV++ S +  LIDP GWLEW+G FAL TLYYGEY NRGPGSNTSARV WPGYR
Sbjct  521  PWKKYSRTVYLNSYMEDLIDPKGWLEWNGTFALDTLYYGEYNNRGPGSNTSARVTWPGYR  580

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ N +EANQFTV NFI G +W+ +T +PF+ + +
Sbjct  581  VIKNATEANQFTVRNFIQGNEWLSSTDIPFFSDFS  615



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score =   140 bits (352),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM S L S+++PAGWLEW G FAL TLYYGEYQN GPG++TS RVKW GYR
Sbjct  472  PWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGASTSNRVKWKGYR  531

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + SEA+ FTVGNFI G  W+  T VPF V L
Sbjct  532  VITSASEASTFTVGNFIDGDVWLAGTSVPFTVGL  565



>ref|XP_009769268.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=548

 Score =   139 bits (351),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVFM SN+G  IDP GW  W G+FALKTLYYGEY N+GPG+ TS RVKWPGY 
Sbjct  456  PWKAYSRTVFMQSNIGDHIDPEGWSVWQGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYH  515

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ILN +EA +FTVG  I G  W+ +TGV +
Sbjct  516  ILNAAEARKFTVGQLIQGGAWLKSTGVAY  544



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score =   139 bits (351),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM S L S+++PAGWLEW G FAL TLYYGEYQN GPG++TS RVKW GYR
Sbjct  491  PWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGASTSNRVKWKGYR  550

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + SEA+ FTVGNFI G  W+  T VPF V L
Sbjct  551  VITSASEASTFTVGNFIDGDVWLAGTSVPFTVGL  584



>emb|CBI24582.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   135 bits (339),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV++ + L +L+D AGWLEWDG FAL TLYYGEY+N GPGS+TS RVKW GYR
Sbjct  167  PWKEYSRTVYLGTYLDTLVDSAGWLEWDGNFALNTLYYGEYKNFGPGSSTSGRVKWRGYR  226

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + +EA++F+V NFI GQ W+PATGVPF   L
Sbjct  227  VITSATEASKFSVANFIAGQSWLPATGVPFRSGL  260



>ref|XP_009771261.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=547

 Score =   139 bits (350),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVFM SN+G  IDP GW  WDG+FALKTLYYGEY N+GPG+  S RVKWPGY 
Sbjct  455  PWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKTLYYGEYMNKGPGAGISKRVKWPGYH  514

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            IL+ SEA +FTVG  I G  W+ +TGV +
Sbjct  515  ILSASEATKFTVGQLIQGGVWLKSTGVAY  543



>ref|XP_002318285.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE96505.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=520

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ + L SL+D AGWLEWDG FAL TLYYGEY+N GPG++TS RVKW GYR
Sbjct  427  PWKEYSRTVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSGPGASTSGRVKWRGYR  486

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + +EA++FTV NFI G+ W+PATGVPF
Sbjct  487  VITSATEASRFTVANFIAGRSWLPATGVPF  516



>gb|ABK24761.1| unknown [Picea sitchensis]
Length=557

 Score =   139 bits (350),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 62/95 (65%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM S +   I PAGWLEWDG+FALKTLYYGEY N GPGS T  RVKWPGYR
Sbjct  462  PWKEYSRTVFMQSYIDGFIQPAGWLEWDGDFALKTLYYGEYMNTGPGSGTGNRVKWPGYR  521

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ +  EA++FTVG FI G  W+ +TGV +   LT
Sbjct  522  VIKSPQEASKFTVGEFIQGDSWLQSTGVHYVDGLT  556



>ref|XP_009372890.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   139 bits (349),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM S L +L+DPAGWLEW G FALKTLYYGEY+N GPG+ TS RVKW GYR
Sbjct  426  PWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGAPTSGRVKWGGYR  485

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++SEA++FTV NFI G  W+PAT VPF   L
Sbjct  486  VITSSSEASKFTVNNFIAGSSWLPATNVPFTAGL  519



>ref|XP_004290811.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=567

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV++ SN+   +DPAGWLEW+G FAL TLYYGEY NRG GS T+ARV WPGYR
Sbjct  473  PWKEYSRTVYLRSNIDDTVDPAGWLEWNGTFALSTLYYGEYLNRGNGSGTTARVTWPGYR  532

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++N S EA+QFTVG FI G +W+ +TG+P++  L+
Sbjct  533  VINNSTEASQFTVGAFIQGNEWLNSTGIPYFAGLS  567



>gb|EYU19641.1| hypothetical protein MIMGU_mgv1a003247mg [Erythranthe guttata]
Length=597

 Score =   139 bits (349),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+MLS+LG  +DP GWLEW+  FAL TLYYGEY N GPG+    RVKWPGYR
Sbjct  501  PWKLYSRTVYMLSDLGGHVDPRGWLEWNDTFALDTLYYGEYMNYGPGAELGRRVKWPGYR  560

Query  213  ILN-TSEANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++N T EA+QFTV  FI G  W+P+TGV F   L+ +
Sbjct  561  VINSTEEADQFTVAKFIYGSSWLPSTGVAFLAGLSTT  597



>ref|XP_009370475.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   138 bits (348),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM S L +L+DPAGWLEW G FALKTLYYGEY+N GPG+ TS RVKW GYR
Sbjct  426  PWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGAPTSRRVKWGGYR  485

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++SEA++FTV NFI G  W+PAT VPF   L
Sbjct  486  VITSSSEASKFTVNNFIAGSSWLPATNVPFTAGL  519



>ref|XP_009589961.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase-like [Nicotiana 
tomentosiformis]
Length=548

 Score =   138 bits (348),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVFM SN+G  IDP GW  WDG+FALKTLYYGEY N+GPG+ TS RVKWPGY 
Sbjct  456  PWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYH  515

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            +L+ SEA +FTV   I G  W+ +TGV +
Sbjct  516  VLSASEATKFTVSQLIQGGAWLKSTGVAY  544



>ref|XP_006401715.1| hypothetical protein EUTSA_v10013056mg [Eutrema salsugineum]
 gb|ESQ43168.1| hypothetical protein EUTSA_v10013056mg [Eutrema salsugineum]
Length=589

 Score =   139 bits (349),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR V+M+S++G  IDP GWLEW+G FAL TLYYGEY NRG GS T  RVKWPGYR
Sbjct  494  PWKLYSRVVYMMSDMGDHIDPRGWLEWNGPFALDTLYYGEYMNRGAGSGTGQRVKWPGYR  553

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ +T EA++FTV  FI G  W+P+TGV F+  L+
Sbjct  554  VITSTVEASKFTVAQFIAGSAWLPSTGVAFFSGLS  588



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV++ S +  LIDPAGWLEW+  FAL TLYYGEY NRGPGSNTSARV WPGYR
Sbjct  459  PWKTYSRTVYLKSYIEDLIDPAGWLEWNDTFALDTLYYGEYMNRGPGSNTSARVTWPGYR  518

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLT  112
            I+N+S EA+QFTV  FI G  W+  TG+PF   L+
Sbjct  519  IINSSTEASQFTVAQFIQGNDWLNTTGIPFLSGLS  553



>ref|XP_007199770.1| hypothetical protein PRUPE_ppa003639mg [Prunus persica]
 gb|EMJ00969.1| hypothetical protein PRUPE_ppa003639mg [Prunus persica]
Length=560

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S + S++DPAGW  WDGEFAL TLYY EY N GPGSNT++RV WPGY 
Sbjct  467  PWKEYSRTVYMQSYIDSVVDPAGWRAWDGEFALSTLYYAEYNNTGPGSNTTSRVTWPGYH  526

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N ++A  FTV NF+LG  W+P TGVP+
Sbjct  527  VINATDAANFTVTNFLLGDDWLPQTGVPY  555



>gb|AAF35897.1|AF229849_1 pectin methylesterase isoform alpha [Vigna radiata]
Length=277

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVF+ S +  LI+PAGWLEW+G FAL TLYYGEY NRGPG+NTS RV WPGYR
Sbjct  183  PWKMYSRTVFLNSLMEDLIEPAGWLEWNGTFALDTLYYGEYNNRGPGANTSGRVTWPGYR  242

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ N++EA+QFTV NFI G +W+ + G+PF+  LT
Sbjct  243  VITNSTEASQFTVQNFIQGNEWLNSYGIPFFSGLT  277



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM ++L SLIDP GWLEW G FAL TLYYGEY N G G++TS RVKWPG+ 
Sbjct  439  PWQKYSRTVFMKTSLDSLIDPDGWLEWSGSFALSTLYYGEYMNTGVGASTSQRVKWPGFH  498

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            +++ S+A +FTVGNF+ G  WIPATGVPF
Sbjct  499  VMSASDAGKFTVGNFLGGDTWIPATGVPF  527



>ref|XP_010062184.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=519

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 77/90 (86%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV++ + L +LIDPAGWLEWDG FAL TLYYGEY+N GP + TS RVKWPGYR
Sbjct  426  PWKQYSRTVYLQTYLDTLIDPAGWLEWDGNFALSTLYYGEYKNLGPAAWTSGRVKWPGYR  485

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ ++SEA++FTV NFI GQ W+P+TGVPF
Sbjct  486  VITSSSEASKFTVANFIAGQSWLPSTGVPF  515



>emb|CDO97716.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L SLI PAGWL W G FAL TLYYGEY N GPGS+T+ RVKWPGY 
Sbjct  422  PWKQYSRTVFMKTFLDSLIAPAGWLPWSGSFALTTLYYGEYMNTGPGSSTANRVKWPGYH  481

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +++T++A++FTV NFI G  WIPAT VPF  NL
Sbjct  482  VMSTADASKFTVRNFISGNSWIPATNVPFTSNL  514



>ref|XP_007050982.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOX95139.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=562

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M + +GSLI+PAGW EWDG FAL TLYY EY NRGPGSNTS+RV W GY 
Sbjct  469  PWKEYSRTVYMQNYMGSLINPAGWKEWDGTFALSTLYYAEYDNRGPGSNTSSRVSWSGYH  528

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N ++A  FTV +F+LG  W+P +GVP+  +L
Sbjct  529  VINATDAANFTVSSFLLGDDWLPNSGVPYTASL  561



>ref|XP_008775930.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   137 bits (345),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 60/94 (64%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTV+M ++L SLIDPAGWLEW+G+FAL TLYYGEY N G G++TS RV WPGY 
Sbjct  422  PWQKYSRTVYMKTSLDSLIDPAGWLEWNGDFALSTLYYGEYMNTGAGADTSRRVNWPGYH  481

Query  213  ILNTSE-ANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++  A+QFTVGNF+ G  WIPATGVP+  +L
Sbjct  482  VITSAAVASQFTVGNFLSGGSWIPATGVPYTSDL  515



>ref|XP_004234932.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Solanum lycopersicum]
Length=523

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV M + L SL+DPAGWLEWDG+FAL TLYYGEY+N GPG++TS+RVKWPGYR
Sbjct  430  PWKQYSRTVIMKTYLDSLVDPAGWLEWDGDFALNTLYYGEYRNNGPGASTSSRVKWPGYR  489

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ N++EA +F+V N I G  W+PAT VPF   L
Sbjct  490  VITNSNEAARFSVENLIAGGSWLPATNVPFRAGL  523



>ref|XP_010088304.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
 gb|EXB33529.1| putative pectinesterase/pectinesterase inhibitor 39 [Morus notabilis]
Length=553

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM S +  L+DPAGWLEW+  FAL TLYYGEY N GPGSNTSARV WPGYR
Sbjct  459  PWKEYSRTVFMKSYIDDLVDPAGWLEWNATFALTTLYYGEYMNHGPGSNTSARVTWPGYR  518

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N+S EA++F+V  FI G +W+ +T VP++ NL
Sbjct  519  VINSSVEASRFSVDAFIQGGEWLNSTQVPYFANL  552



>ref|XP_009589755.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=548

 Score =   137 bits (345),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVFM SN+G  IDP GW  WDG+FALKTLYYGEY N+GPG+ TS RVKWPGY 
Sbjct  456  PWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYH  515

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            +L+ SEA +FTV   I G  W+ +TGV +
Sbjct  516  VLSASEATKFTVSQLIQGGVWLKSTGVAY  544



>ref|XP_011010924.1| PREDICTED: pectinesterase-like isoform X1 [Populus euphratica]
Length=516

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVF+ + L SL+DPAGWLEWDG FAL TLYYGEY+N GPG++TS RVKWPGY+
Sbjct  423  PWRKYSRTVFLSTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNTGPGASTSGRVKWPGYK  482

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++ EA++FTV NFI G+ W+PATGV F   L
Sbjct  483  VITSAEEASEFTVANFIGGRSWLPATGVQFAAGL  516



>ref|XP_011010930.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=516

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVF+ + L SL+DPAGWLEWDG FAL TLYYGEY+N GPG++TS RVKWPGY+
Sbjct  423  PWRKYSRTVFLSTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNTGPGASTSGRVKWPGYK  482

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++ EA++FTV NFI G+ W+PATGV F   L
Sbjct  483  VITSAEEASKFTVANFIGGRSWLPATGVQFAAGL  516



>ref|XP_011010925.1| PREDICTED: pectinesterase-like isoform X2 [Populus euphratica]
Length=518

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVF+ + L SL+DPAGWLEWDG FAL TLYYGEY+N GPG++TS RVKWPGY+
Sbjct  425  PWRKYSRTVFLSTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNTGPGASTSGRVKWPGYK  484

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++ EA++FTV NFI G+ W+PATGV F   L
Sbjct  485  VITSAEEASEFTVANFIGGRSWLPATGVQFAAGL  518



>gb|AFW03479.1| pectin methylesterase 5 [Gossypium barbadense]
Length=519

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L SLI+PAGW+EWDG+FALKTLYY EY N GPGS+TS RVKW GY 
Sbjct  426  PWKQYSRTVFMKTYLDSLINPAGWMEWDGDFALKTLYYAEYMNTGPGSSTSNRVKWGGYH  485

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            +L + SE ++FTVGNF+ G  W+P+TGVPF
Sbjct  486  VLKSASEVSKFTVGNFLAGNSWLPSTGVPF  515



>ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM + L SLI+PAGW+EW G FALKTLYYGEY N GPGS+TS RV W GY 
Sbjct  420  PWKEYSRTVFMKTYLDSLINPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVNWAGYH  479

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ ++SEA++FTVGNFI G  W+PAT VPF
Sbjct  480  VITSSSEASKFTVGNFIAGNSWLPATNVPF  509



>gb|KHG19575.1| Uncharacterized protein F383_07269 [Gossypium arboreum]
Length=519

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L SLI+PAGW+EWDG+FALKTLYY EY N GPGS+TS RVKW GY 
Sbjct  426  PWKQYSRTVFMKTYLDSLINPAGWMEWDGDFALKTLYYAEYMNTGPGSSTSNRVKWGGYH  485

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            +L + SE ++FTVGNF+ G  W+P+TGVPF
Sbjct  486  VLKSASEVSKFTVGNFLAGNSWLPSTGVPF  515



>ref|XP_010056337.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM + L SLI+PAGW+EW+G FALKTLYYGEY N GPGS+T  RVKW GYR
Sbjct  422  PWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALKTLYYGEYMNTGPGSSTKNRVKWGGYR  481

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + SEA++FTVG+ I G  W+PATGVPF
Sbjct  482  VITSASEASKFTVGSLIAGNSWLPATGVPF  511



>gb|AGR44472.1| pectin methylesterase 3 [Pyrus x bretschneideri]
Length=564

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M + +GSLIDPAGWL W G+FAL TLYY EY N GPGSNT+ RV WPGY 
Sbjct  471  PWKEYSRTVYMQTFMGSLIDPAGWLAWSGDFALSTLYYAEYNNTGPGSNTTNRVTWPGYH  530

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N + A  FTV NF+LG  W+P TGVP+
Sbjct  531  VINATVAANFTVSNFLLGDNWLPDTGVPY  559



>emb|CDY35644.1| BnaC09g29660D [Brassica napus]
Length=456

 Score =   136 bits (343),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 58/95 (61%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR V+M+S++G  I+P GWLEW+G FAL +LYYGEY NRGPGS+T  RVKWPGY 
Sbjct  361  PWKLYSRVVYMMSDMGDHINPRGWLEWNGPFALDSLYYGEYMNRGPGSSTGQRVKWPGYH  420

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ +T EA++FTVG FI G  W+P+TGV F+  L+
Sbjct  421  VITSTVEASKFTVGQFIGGSSWLPSTGVAFFSGLS  455



>ref|XP_010058467.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=438

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM + L SLI+PAGW+EW+G FALKTLYYGEY N GPGS+T  RVKW GYR
Sbjct  345  PWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALKTLYYGEYMNTGPGSSTKNRVKWGGYR  404

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + SEA++FTVG+ I G  W+PATGVPF
Sbjct  405  VITSASEASKFTVGSLIAGNSWLPATGVPF  434



>dbj|BAF42040.1| pectin methylesterase 3 [Pyrus communis]
Length=564

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M + +GSLIDPAGWL W G+FAL TLYY EY N GPGSNT+ RV WPGY 
Sbjct  471  PWKEYSRTVYMQTFMGSLIDPAGWLAWSGDFALSTLYYAEYNNTGPGSNTTNRVTWPGYH  530

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N + A  FTV NF+LG  W+P TGVP+
Sbjct  531  VINATVAANFTVSNFLLGDNWLPDTGVPY  559



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   137 bits (344),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV + S+L  LI PAGW EWDG FAL TLYYGEY NRGPG+ T+ RVKW G+R
Sbjct  490  PWKQYSRTVILQSHLDDLIHPAGWHEWDGNFALSTLYYGEYMNRGPGAATANRVKWGGHR  549

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ ++SEANQFTV  F+ G  W+PATGV +    T
Sbjct  550  VITSSSEANQFTVNQFLQGDSWLPATGVQYTAGFT  584



>ref|XP_008234391.1| PREDICTED: pectinesterase 2-like [Prunus mume]
Length=517

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ S L +L+D AGWLEWDG FALKTLYYGEY+N GPGS+T  RV W GY 
Sbjct  424  PWKEYSRTVFLQSYLDTLVDSAGWLEWDGNFALKTLYYGEYKNTGPGSSTRGRVNWGGYH  483

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++SEA++FTVGNFI G  W+PAT VPF   L
Sbjct  484  VITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  517



>ref|XP_004306939.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Fragaria vesca subsp. vesca]
Length=508

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW+EYSRT+FM + L SLI+ AGWLEWDG FAL+TLYYGEY N GPGS+TS RVKW GY 
Sbjct  415  PWREYSRTIFMKTYLDSLINSAGWLEWDGTFALETLYYGEYMNTGPGSSTSGRVKWGGYH  474

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++SEA++FTVGNFI G  W+PAT VPF   L
Sbjct  475  VITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  508



>emb|CAA96436.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=274

 Score =   133 bits (334),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVFM SN+G  IDP GW  WDG+FALKTLYYGEY N+GPG+ TS RVKWPGY 
Sbjct  182  PWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYH  241

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            IL+ +EA +FTVG  I G  W+ +TGV +
Sbjct  242  ILSAAEATKFTVGQLIQGGVWLKSTGVAY  270



>gb|KDO40320.1| hypothetical protein CISIN_1g048471mg, partial [Citrus sinensis]
Length=183

 Score =   130 bits (327),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S + SLI+PAGW EW G+FAL TLYY EY N GPGS+T+ RV WPGY+
Sbjct  90   PWKEYSRTVYMQSFMDSLINPAGWHEWSGDFALATLYYAEYNNTGPGSDTTNRVTWPGYQ  149

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N ++A  FTV NF+LG  W+P T VP+
Sbjct  150  VINATDAANFTVSNFLLGDNWLPQTAVPY  178



>gb|KJB49891.1| hypothetical protein B456_008G143800 [Gossypium raimondii]
Length=523

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M + +GSLIDPAGW EW+G+FAL TLYY EY N GPGSNTS+RV W GY 
Sbjct  429  PWKEYSRTVYMQNFMGSLIDPAGWREWNGDFALSTLYYAEYDNSGPGSNTSSRVTWSGYH  488

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPFYVNLTA  109
             +N ++A  FTV  F+LG  W+P TGVP+  +L A
Sbjct  489  TINATDAANFTVSGFLLGNDWLPNTGVPYTASLLA  523



>ref|XP_010537086.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Tarenaya hassleriana]
Length=586

 Score =   136 bits (343),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 60/95 (63%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR+V+M+S +G  I P GWLEW G FAL TLYYGEY NRGPGS T  RVKWPGYR
Sbjct  491  PWKLYSRSVYMMSYMGDHIHPRGWLEWSGGFALDTLYYGEYMNRGPGSGTGQRVKWPGYR  550

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ + SEA++FTV  FI G  W+P+TGV F   LT
Sbjct  551  VITSASEASKFTVAQFISGSAWLPSTGVAFLAGLT  585



>gb|KJB49890.1| hypothetical protein B456_008G143800 [Gossypium raimondii]
Length=566

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M + +GSLIDPAGW EW+G+FAL TLYY EY N GPGSNTS+RV W GY 
Sbjct  472  PWKEYSRTVYMQNFMGSLIDPAGWREWNGDFALSTLYYAEYDNSGPGSNTSSRVTWSGYH  531

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPFYVNLTA  109
             +N ++A  FTV  F+LG  W+P TGVP+  +L A
Sbjct  532  TINATDAANFTVSGFLLGNDWLPNTGVPYTASLLA  566



>emb|CDP20891.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVF+ + L SL+DPAGWLEWDG FA  TLYYGEY+N GPGS+TS RVKW GY 
Sbjct  430  PWKQYSRTVFIQTYLDSLVDPAGWLEWDGNFAFNTLYYGEYKNSGPGSSTSRRVKWRGYH  489

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ N +EA++FTV NFI G+ W+PAT VPF   L
Sbjct  490  VITNPTEASRFTVANFIAGRSWLPATNVPFAAGL  523



>emb|CAA96434.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVFM SN+G  IDP GW  WDG+FALKTLYYGEY N+GPG+ TS RVKWPGY 
Sbjct  223  PWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYH  282

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            IL+ +EA +FTVG  I G  W+ +TGV +
Sbjct  283  ILSAAEATKFTVGQLIQGGVWLKSTGVAY  311



>emb|CAA96435.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVFM SN+G  IDP GW  WDG+FALKTLYYGEY N+GPG+ TS RVKWPGY 
Sbjct  223  PWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYH  282

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            IL+ +EA +FTVG  I G  W+ +TGV +
Sbjct  283  ILSAAEATKFTVGQLIQGGVWLKSTGVAY  311



>ref|XP_003634048.1| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=520

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV++ + L +L+D AGWLEWDG FAL TLYYGEY+N GPGS+TS RVKW GYR
Sbjct  427  PWKEYSRTVYLGTYLDTLVDSAGWLEWDGNFALNTLYYGEYKNFGPGSSTSGRVKWRGYR  486

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + +EA++F+V NFI GQ W+PATGVPF   L
Sbjct  487  VITSATEASKFSVANFIAGQSWLPATGVPFRSGL  520



>gb|KJB49889.1| hypothetical protein B456_008G143700 [Gossypium raimondii]
Length=558

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S +  L+DPAGWLEW+G FAL TLYYGE+ NRGPGS+TS RV WPGYR
Sbjct  464  PWKEYSRTVIMRSYIDDLVDPAGWLEWNGNFALNTLYYGEFLNRGPGSDTSRRVTWPGYR  523

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + ++ANQFTVG FI G QW+ +T +PF + L
Sbjct  524  VITSFADANQFTVGAFIQGNQWLNSTDIPFNLGL  557



>ref|XP_008377824.1| PREDICTED: pectinesterase 2-like [Malus domestica]
Length=518

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM S L +L+DPAGWL+W G+FALKTLYYGEY+N GPG+ T+ RVKW GYR
Sbjct  425  PWKEYSRTVFMQSFLDTLVDPAGWLQWSGDFALKTLYYGEYKNIGPGAPTTGRVKWGGYR  484

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            I+ ++SEA++FTV NFI G  W+PAT  PF   L
Sbjct  485  IITSSSEASKFTVDNFIAGSSWLPATNXPFTAXL  518



>ref|XP_009773838.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=524

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L SL+DPAGWLEWDG FAL TLYYGEY+N GPG++TS RV+W GYR
Sbjct  431  PWKQYSRTVFMKTYLHSLVDPAGWLEWDGNFALNTLYYGEYRNSGPGASTSRRVRWRGYR  490

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ N++EA +F+V NFI G+ W+PAT VPF   L
Sbjct  491  VITNSNEAAKFSVENFIGGRSWLPATNVPFRAGL  524



>ref|XP_004299719.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20 
[Fragaria vesca subsp. vesca]
Length=566

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV++ + + SLIDPAGWL W G+FAL TLYYGEY N+GPG++TS RV WPGY 
Sbjct  473  PWKEYSRTVYLQNFMDSLIDPAGWLAWSGDFALSTLYYGEYDNKGPGADTSNRVTWPGYH  532

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            I+  ++A+ FTV NF+LG  W+P TGVP+
Sbjct  533  IIGATDASNFTVSNFVLGDSWLPQTGVPY  561



>ref|NP_001042866.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAD45460.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF04780.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAG97493.1| unnamed protein product [Oryza sativa Japonica Group]
Length=426

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM S L S+++PAGWLEW G FAL TLYYGEYQN GPG++TS RVKW GYR
Sbjct  333  PWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGASTSNRVKWKGYR  392

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + SEA+ FTVGNFI G  W+  T VPF V L
Sbjct  393  VITSASEASTFTVGNFIDGDVWLAGTSVPFTVGL  426



>gb|KJB41089.1| hypothetical protein B456_007G090100 [Gossypium raimondii]
Length=519

 Score =   135 bits (341),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L SLI+PAGW+EWDG FALKTLYY EY N GPGS+TS RVKW GY 
Sbjct  426  PWKQYSRTVFMKTYLDSLINPAGWMEWDGNFALKTLYYAEYMNTGPGSSTSNRVKWGGYH  485

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            +L + SE ++FTVGNF+ G  W+P+TGVPF
Sbjct  486  VLKSASEVSKFTVGNFLAGNSWLPSTGVPF  515



>ref|XP_006576427.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=299

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM + L SLI+PAGW+EWDG FAL TLYY EY N GPGSNT+ RV W GY 
Sbjct  206  PWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVTWKGYH  265

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +L + SEA+ FTVGNFI G  WIP++GVPF   L
Sbjct  266  VLTSASEASPFTVGNFIAGSNWIPSSGVPFTSGL  299



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   135 bits (340),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM ++L  LIDPAGWLEW G FAL TLYYGEY N G G++TS RVKWPGY 
Sbjct  422  PWKKYSRTVFMKTSLDCLIDPAGWLEWSGNFALSTLYYGEYMNTGAGADTSQRVKWPGYH  481

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + +EA++FTV NF+ G  WIPATGV F   L
Sbjct  482  VITSATEASKFTVANFLSGNSWIPATGVAFTSGL  515



>ref|XP_008389982.1| PREDICTED: pectinesterase [Malus domestica]
 ref|XP_008367067.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=537

 Score =   135 bits (340),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/94 (63%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV M SNL  LIDPAGW  W G FAL TLYYGEY N G G+ T  RV WPGYR
Sbjct  444  PWKKYSRTVIMKSNLDGLIDPAGWFPWSGSFALSTLYYGEYMNSGAGAGTGGRVNWPGYR  503

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + +EA +FTVGN + G  WIP TGVPF   L
Sbjct  504  VIRSATEAGKFTVGNLLAGDSWIPGTGVPFTTGL  537



>ref|XP_008235120.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Prunus mume]
Length=560

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S + S++DPAGW  WDGEFAL TLYY EY N GPGSNT++RV W GY 
Sbjct  467  PWKEYSRTVYMQSYIDSVVDPAGWRAWDGEFALSTLYYAEYNNTGPGSNTTSRVTWTGYH  526

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N ++A  FTV NF+LG  W+P TGVP+
Sbjct  527  VINATDAANFTVTNFLLGDDWLPQTGVPY  555



>ref|XP_010271268.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM ++L SLIDPAGWLEW G FAL TLYYGEY N G G++TS RVKWPG+ 
Sbjct  437  PWQKYSRTVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGAGASTSRRVKWPGFH  496

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +++ S+A +FTVGNF+ G  WI A GVPF   L
Sbjct  497  VMSASDAGKFTVGNFLGGGSWIAAAGVPFTSGL  529



>ref|XP_002890570.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66829.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=552

 Score =   135 bits (340),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVFM  NLG+L++PAGWL W+GEFAL TLYYGEY N G G++ S RVKWPGY 
Sbjct  459  PWKSYSRTVFMKCNLGALVNPAGWLPWNGEFALSTLYYGEYANTGAGASVSGRVKWPGYH  518

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVP  130
            +L T +EA +FTV NF+ G  WI A GVP
Sbjct  519  VLKTATEAGKFTVENFLDGNYWITAAGVP  547



>emb|CDP17208.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S LGSLIDPAGW  W G+FAL TLYY EY N GPGS+T+ RV WPGY 
Sbjct  418  PWKEYSRTVYMQSFLGSLIDPAGWTPWSGDFALSTLYYAEYDNSGPGSDTTNRVTWPGYH  477

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N ++A  FTV NFILG  W+P TGV +
Sbjct  478  VINAADAANFTVANFILGDNWLPQTGVTY  506



>ref|XP_008219291.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20 
[Prunus mume]
Length=564

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M + + SLIDPAGWL W G+FAL TLYY EY N GPGSNT+ RV WPGY 
Sbjct  471  PWKEYSRTVYMQTFMASLIDPAGWLAWSGDFALSTLYYAEYNNTGPGSNTTNRVTWPGYH  530

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N++ A  FTV NF+ G  W+PATGVP+
Sbjct  531  VINSTVAANFTVTNFLTGDNWLPATGVPY  559



>ref|XP_011029953.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=519

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVF+ + L SL+D AGWLEWDG FAL TLYYGEY+N GPG++TS RVKW GYR
Sbjct  426  PWKAYSRTVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSGPGASTSGRVKWRGYR  485

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + +EA++FT  NFI G+ W+PATGVPF
Sbjct  486  VITSATEASRFTAANFIAGRSWLPATGVPF  515



>ref|XP_009340592.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM S L +L+DPAGWL+W G+FALKTLYYGEY+N GPG+ T+ RVKW GYR
Sbjct  425  PWKEYSRTVFMQSFLDTLVDPAGWLKWSGDFALKTLYYGEYKNIGPGAPTTGRVKWGGYR  484

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            I+ ++SEA++FTV NFI G  W+PAT V F   L
Sbjct  485  IITSSSEASKFTVDNFIAGSSWLPATNVAFAAGL  518



>ref|XP_009374493.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM S L +L+DPAGWL+W G+FALKTLYYGEY+N GPG+ T+ RVKW GYR
Sbjct  425  PWKEYSRTVFMQSFLDTLVDPAGWLKWSGDFALKTLYYGEYKNIGPGAPTTGRVKWGGYR  484

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            I+ ++SEA++FTV NFI G  W+PAT V F   L
Sbjct  485  IITSSSEASKFTVDNFIAGSSWLPATNVAFAAGL  518



>ref|XP_002455538.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
 gb|EES00658.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
Length=576

 Score =   135 bits (339),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVF+ S L SLI PAGWLEWDG FAL TLYYGEY N GPG+ TS RVKW GYR
Sbjct  483  PWKQYSRTVFLQSELDSLIAPAGWLEWDGNFALDTLYYGEYMNTGPGAGTSGRVKWKGYR  542

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + +EA+ FTVG+FI G  W+  T +PF   L
Sbjct  543  VITSAAEASAFTVGSFIDGDVWLAGTSIPFTTGL  576



>ref|XP_008347782.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20 
[Malus domestica]
Length=564

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M + +GSLIDPAGWL W G+FAL TLYY EY N GPGS+T+ RV WPGY 
Sbjct  471  PWKEYSRTVYMQTFMGSLIDPAGWLAWSGDFALSTLYYAEYNNTGPGSSTTNRVTWPGYH  530

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N + A  FTV NF+LG  W+P TGVP+
Sbjct  531  VINATVAANFTVSNFLLGDNWLPDTGVPY  559



>gb|KJB41904.1| hypothetical protein B456_007G127000 [Gossypium raimondii]
Length=560

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S +   +DPAGWLEW+G FAL TLYYGEY NRGPGSNTSARV WPGYR
Sbjct  466  PWKEYSRTVIMRSYIDDSVDPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVTWPGYR  525

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N+S EA QFT+  FI G +W+ ++ +PF + L
Sbjct  526  VINSSTEATQFTIEPFIQGNEWLNSSNIPFALGL  559



>ref|XP_010442899.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Camelina sativa]
Length=589

 Score =   135 bits (339),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 55/95 (58%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR V+M+S++G  IDP GWLEW+G FAL TLYYGEY N+GPGS    R+KWPGY 
Sbjct  494  PWKLYSRVVYMMSDMGDHIDPRGWLEWNGPFALDTLYYGEYMNKGPGSGMGQRIKWPGYH  553

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ ++ EA +FTV  FI G  W+P+TGV F+  L+
Sbjct  554  VITSAVEATKFTVAQFISGSSWLPSTGVAFFSGLS  588



>ref|XP_004299720.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41 
[Fragaria vesca subsp. vesca]
Length=565

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRT+FM   + S IDPAGWL W+G+FAL TLYY EY N GPGSNT+ RV WPGY 
Sbjct  472  PWKEYSRTIFMQGFIDSFIDPAGWLAWNGDFALSTLYYAEYNNSGPGSNTNNRVTWPGYH  531

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++  +EA  FTV NFILG  W+P TGVP+
Sbjct  532  VIGATEAANFTVSNFILGDNWLPQTGVPY  560



>ref|XP_009625476.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=566

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S + SLI+PAGW  W G+FAL TLYY EY N GPGSNTS+RV WPGY 
Sbjct  473  PWKEYSRTVYMQSFMDSLINPAGWAAWSGDFALSTLYYAEYNNTGPGSNTSSRVTWPGYH  532

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N+++A  FTV NFI G  W+PATGVP+
Sbjct  533  VINSTDAISFTVSNFIAGNFWLPATGVPY  561



>ref|XP_009627969.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Nicotiana tomentosiformis]
Length=521

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L SL+DPAGWLEWDG FAL TLYYGEY+N G G++TS RV+W GYR
Sbjct  428  PWKQYSRTVFMKTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSGAGASTSRRVRWRGYR  487

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ N++EA +F+V NFI G+ W+PAT VPF   L
Sbjct  488  VITNSNEAAKFSVENFIAGRSWLPATNVPFRAGL  521



>ref|XP_010271372.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM ++L SLIDPAGWLEW G FAL TLYYGE+ N G G++TS RV WPGYR
Sbjct  434  PWQKYSRTVFMKTSLDSLIDPAGWLEWSGSFALSTLYYGEFMNSGAGASTSGRVTWPGYR  493

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++++ EA +FTVG+F+ G  WI A GVPF   L
Sbjct  494  VMSSEEAGEFTVGSFLGGGSWIAAAGVPFTSGL  526



>ref|XP_010269594.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Nelumbo nucifera]
Length=568

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S + SL++P+GW  W G+FAL TLYY EY N GPGSNTS RV WPGY 
Sbjct  475  PWKEYSRTVYMQSFIDSLVEPSGWSIWTGDFALSTLYYAEYNNWGPGSNTSNRVTWPGYH  534

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPFY  124
            ++N ++A  FTV NFILG  WIPATGVP+Y
Sbjct  535  VINATDAANFTVSNFILGDAWIPATGVPYY  564



>gb|ABD47733.1| pectin methylesterase [Eucalyptus globulus subsp. globulus]
Length=100

 Score =   126 bits (316),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR V+MLS +G  I P GWLEW+G+FAL TLYYGEY N GPG+    RVKWPG+R
Sbjct  5    PWKMYSRVVYMLSYMGDHIHPEGWLEWNGDFALDTLYYGEYMNDGPGAAVGRRVKWPGFR  64

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ +T+EAN+FTV  FI G  W+P+TGV F   L+
Sbjct  65   VITSTTEANKFTVAQFIFGSSWLPSTGVAFVAGLS  99



>dbj|BAM05617.1| pectin methylesterase 2, partial [Eucalyptus globulus subsp. 
globulus]
Length=98

 Score =   125 bits (315),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR V+MLS +G  I P GWLEW+G+FAL TLYYGEY N GPG+    RVKWPG+R
Sbjct  3    PWKMYSRVVYMLSYMGDHIHPEGWLEWNGDFALDTLYYGEYMNDGPGAAVGRRVKWPGFR  62

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ +T+EAN+FTV  FI G  W+P+TGV F   L+
Sbjct  63   VITSTTEANKFTVAQFIFGSSWLPSTGVAFVAGLS  97



>ref|XP_004148139.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=526

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM + + SL+DPAGWLEWDG+FAL TLYYGEY N GPGS  S RVKW GY 
Sbjct  433  PWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWKGYH  492

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ N +EA++FTV NFI GQ W+P T VPF
Sbjct  493  VITNLTEASEFTVQNFIAGQSWLPDTEVPF  522



>emb|CDY18942.1| BnaC04g04080D [Brassica napus]
Length=258

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 77/94 (82%), Gaps = 2/94 (2%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM ++L SLIDP GWLEW+G FAL TL+Y E+QN GPG++TS RVKWPG+R
Sbjct  166  PWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALSTLFYAEFQNTGPGASTSGRVKWPGFR  225

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +L + SEA++FTVG+FI G  WIP++ VPF   L
Sbjct  226  VLRSASEASRFTVGSFIAGSSWIPSS-VPFTSGL  258



>gb|KJB41905.1| hypothetical protein B456_007G127100 [Gossypium raimondii]
Length=559

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S + +LIDPAGW EWDG+FAL TLYY EY N G GSNTS RV WPGY 
Sbjct  466  PWKEYSRTVYMQSFMDNLIDPAGWREWDGDFALSTLYYAEYDNNGLGSNTSNRVTWPGYH  525

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N ++A  FTV +F+LG  W+P TGVP+   L
Sbjct  526  VINATDAINFTVSSFLLGDDWLPDTGVPYNATL  558



>gb|KGN57272.1| hypothetical protein Csa_3G175720 [Cucumis sativus]
Length=571

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM + + SL+DPAGWLEWDG+FAL TLYYGEY N GPGS  S RVKW GY 
Sbjct  478  PWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWKGYH  537

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ N +EA++FTV NFI GQ W+P T VPF
Sbjct  538  VITNLTEASEFTVQNFIAGQSWLPDTEVPF  567



>gb|KHN35616.1| Pectinesterase 2 [Glycine soja]
Length=358

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM + L SLI+PAGW+EWDG FAL TLYY EY N GPGSNT+ RV W GY 
Sbjct  265  PWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVTWKGYH  324

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +L + SEA+ FTVGNFI G  WIP++GVPF   L
Sbjct  325  VLTSASEASPFTVGNFIAGSNWIPSSGVPFTSGL  358



>ref|XP_006490097.1| PREDICTED: pectinesterase 2-like [Citrus sinensis]
Length=518

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M + L SL+DPAGWLEW G FAL TL+YGEY+N GP ++TS RVKW GYR
Sbjct  425  PWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWRGYR  484

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + +EA++FTVG+FI G  W+PATGVPF
Sbjct  485  VITSATEASKFTVGSFIAGNSWLPATGVPF  514



>ref|XP_009335714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Pyrus x bretschneideri]
Length=569

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S + SL++P GW  WDG+FAL TLYY EY N GPGSNT+ RV WPGY 
Sbjct  476  PWKEYSRTVYMQSYIDSLVEPVGWRAWDGDFALSTLYYAEYNNTGPGSNTTNRVTWPGYH  535

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N+++A  FTV NF+LG  W+P TGVP+
Sbjct  536  VINSTDAANFTVTNFLLGDDWLPQTGVPY  564



>ref|XP_009335708.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Pyrus x bretschneideri]
Length=569

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S + SL++P GW  WDG+FAL TLYY EY N GPGSNT+ RV WPGY 
Sbjct  476  PWKEYSRTVYMQSYIDSLVEPVGWRAWDGDFALSTLYYAEYNNTGPGSNTTNRVTWPGYH  535

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N+++A  FTV NF+LG  W+P TGVP+
Sbjct  536  VINSTDAANFTVTNFLLGDDWLPQTGVPY  564



>ref|XP_003588521.1| Pectinesterase [Medicago truncatula]
 gb|AES58772.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=609

 Score =   134 bits (338),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+MLS +G  + P GWLEW+G+FALKTLYYGEY N GPG+    RVKWPGYR
Sbjct  514  PWKMYSRTVYMLSYMGDHVHPHGWLEWNGDFALKTLYYGEYMNFGPGAAIGQRVKWPGYR  573

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ +T EAN++TV  FI G  W+P+TGV F   L+
Sbjct  574  VITSTLEANRYTVAQFISGSSWLPSTGVAFLAGLS  608



>gb|KJB09419.1| hypothetical protein B456_001G140500 [Gossypium raimondii]
Length=561

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKE+SRTV M S +   +DPAGWLEW+G FAL TLYYGEY NRG GSNTSARV WPGYR
Sbjct  466  PWKEFSRTVIMRSYIDDSVDPAGWLEWNGTFALSTLYYGEYLNRGAGSNTSARVTWPGYR  525

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N+S EA+QFT G FI G  W+ +T +PF + L
Sbjct  526  VINSSTEADQFTAGAFIQGNDWLNSTDIPFSLGL  559



>emb|CBI36882.3| unnamed protein product [Vitis vinifera]
Length=566

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M SN+GSLI+P+GW  W G+FAL TLYY EY N GPGSNTS RV W GY 
Sbjct  473  PWKEYSRTVYMQSNMGSLINPSGWSIWSGDFALSTLYYAEYNNTGPGSNTSNRVTWSGYH  532

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++  S+A  FTVGNF+LG  W+P TGVP+
Sbjct  533  VIGPSDAANFTVGNFLLGGDWLPQTGVPY  561



>ref|XP_006421695.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
 gb|ESR34935.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
Length=518

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M + L SL+DPAGWLEW G FAL TL+YGEY+N GP ++TS RVKW GYR
Sbjct  425  PWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWRGYR  484

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + +EA++FTVG+FI G  W+PATGVPF
Sbjct  485  VITSATEASKFTVGSFIAGNSWLPATGVPF  514



>ref|XP_004232737.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=546

 Score =   134 bits (336),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGY-  217
            PWK YSRTV+M SN+G  IDPAGW EWDG+FALKTLYYGEY N+G G+  S RV WPGY 
Sbjct  453  PWKAYSRTVYMQSNIGDHIDPAGWSEWDGDFALKTLYYGEYMNKGAGAGISKRVNWPGYH  512

Query  216  RILNTSEANQFTVGNFILGQQWIPATGVPF  127
            + L TSEA +FTVG  I G  W+ +TGV +
Sbjct  513  KALTTSEATKFTVGQLIQGAAWLKSTGVAY  542



>gb|KDO65446.1| hypothetical protein CISIN_1g010103mg [Citrus sinensis]
Length=518

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M + L SL+DPAGWLEW G FAL TL+YGEY+N GP ++TS RVKW GYR
Sbjct  425  PWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWRGYR  484

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + +EA++FTVG+FI G  W+PATGVPF
Sbjct  485  VITSATEASKFTVGSFITGNSWLPATGVPF  514



>ref|XP_002268492.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Vitis vinifera]
Length=556

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M SN+GSLI+P+GW  W G+FAL TLYY EY N GPGSNTS RV W GY 
Sbjct  463  PWKEYSRTVYMQSNMGSLINPSGWSIWSGDFALSTLYYAEYNNTGPGSNTSNRVTWSGYH  522

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++  S+A  FTVGNF+LG  W+P TGVP+
Sbjct  523  VIGPSDAANFTVGNFLLGGDWLPQTGVPY  551



>ref|XP_003519757.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Glycine max]
Length=562

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV + S +  LIDPAGWLEW+  FAL TLYYGEY NRGPG+NT+ RV WPGYR
Sbjct  468  PWKMYSRTVVLKSFVEDLIDPAGWLEWNETFALDTLYYGEYMNRGPGANTNGRVTWPGYR  527

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N+S EA QFTVG FI G  W+ +TG+PF+  L
Sbjct  528  VINSSTEATQFTVGQFIQGNDWLNSTGIPFFSGL  561



>ref|XP_004498516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34-like 
[Cicer arietinum]
Length=606

 Score =   134 bits (337),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR V+MLS +G  +DP GWLEW+G+FAL TLYYGEY N GPG+    RVKWPGYR
Sbjct  511  PWKMYSRAVYMLSYMGDHVDPHGWLEWNGDFALDTLYYGEYMNYGPGAAIGQRVKWPGYR  570

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ ++ EAN++TV  FI G  W+P+TGV F   L+
Sbjct  571  VITSNVEANRYTVAQFISGSSWLPSTGVAFLAGLS  605



>ref|XP_008451545.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=595

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK +SRTVF+ S +G L++P GWLEW+G FAL TLYYGEY NRGPGSNT+ RV WPGYR
Sbjct  499  PWKLHSRTVFLRSFIGQLVEPVGWLEWNGTFALDTLYYGEYLNRGPGSNTTGRVTWPGYR  558

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLTA  109
            ++ N +EA+QFTV  FI G  W+ +TG+PF+  LT+
Sbjct  559  VITNATEASQFTVEEFIQGSSWLNSTGIPFFSGLTS  594



>ref|XP_003564371.1| PREDICTED: pectinesterase [Brachypodium distachyon]
Length=549

 Score =   134 bits (336),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+M S LG  +DP GWLEWDGEFAL+TL+YGEYQN GPG+ T+ RV+WPGY 
Sbjct  456  PWKAYSRTVYMQSFLGPHVDPKGWLEWDGEFALRTLFYGEYQNEGPGAGTAGRVRWPGYH  515

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ + + A QFTVG FI G +W+  TGV +
Sbjct  516  VITDRAVALQFTVGKFIQGGRWLKDTGVDY  545



>ref|XP_004160886.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=742

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM + + SL+DPAGWLEWDG+FAL TLYYGEY N GPGS  S RVKW GY 
Sbjct  649  PWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWKGYH  708

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ N +EA++FTV NFI GQ W+P T VPF
Sbjct  709  VITNLTEASEFTVQNFIAGQSWLPDTEVPF  738



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV + S +  LIDPAGWLEW+  FAL TLYYGEY NRGPG+NT+ RV WPGYR
Sbjct  377  PWKMYSRTVVLKSFVEDLIDPAGWLEWNETFALDTLYYGEYMNRGPGANTNGRVTWPGYR  436

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N+S EA QFTVG FI G  W+ +TG+PF+  L
Sbjct  437  VINSSTEATQFTVGQFIQGNDWLNSTGIPFFSGL  470



>ref|XP_007222884.1| hypothetical protein PRUPE_ppa003581mg [Prunus persica]
 gb|EMJ24083.1| hypothetical protein PRUPE_ppa003581mg [Prunus persica]
Length=564

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M + + SLIDPAGWL W G+FAL TLYY EY N GPGSNT+ RV WPGY 
Sbjct  471  PWKEYSRTVYMQTFMASLIDPAGWLAWSGDFALSTLYYAEYNNTGPGSNTTNRVTWPGYH  530

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N++ A  FTV NF++G  W+ ATGVP+
Sbjct  531  VINSTVAANFTVTNFLMGDNWLAATGVPY  559



>ref|XP_002518523.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF43910.1| Pectinesterase precursor, putative [Ricinus communis]
Length=547

 Score =   134 bits (336),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M SN+G  IDPAGW  WDGEFALKTLYYGEY N+G G+ TS RVKWPGY 
Sbjct  454  PWKEYSRTVVMQSNIGDHIDPAGWSIWDGEFALKTLYYGEYMNKGAGAGTSKRVKWPGYH  513

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + +EA +FTV   I G  W+ +TGV F
Sbjct  514  VITSATEAKKFTVAELIQGGAWLKSTGVAF  543



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV++ + L +L+DPAGW+EW G FAL TLYYGEY+N GP S+T+ RVKW GYR
Sbjct  435  PWKEYSRTVYLQTYLDTLVDPAGWMEWSGNFALNTLYYGEYRNFGPASSTARRVKWRGYR  494

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ N SEA++FTVGNFI G  W+PATGVPF
Sbjct  495  VITNPSEASRFTVGNFISGGSWLPATGVPF  524



>ref|NP_001274785.1| pectin methyl esterase [Solanum tuberosum]
 emb|CBY44654.1| pectin methyl esterase [Solanum tuberosum]
Length=545

 Score =   133 bits (335),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S LG LIDPAGW EW GEFALKTLYYGEY N GPG+ TS RVKWPGY 
Sbjct  450  PWKEYSRTVVMQSYLGGLIDPAGWAEWSGEFALKTLYYGEYMNNGPGAGTSKRVKWPGYH  509

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ + +EA  FTV   I G  W+ +TGV +
Sbjct  510  VITDPAEAMPFTVAELIQGGSWLSSTGVAY  539



>ref|XP_006279604.1| hypothetical protein CARUB_v10026136mg [Capsella rubella]
 gb|EOA12502.1| hypothetical protein CARUB_v10026136mg [Capsella rubella]
Length=587

 Score =   134 bits (336),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR V+M+S++G  IDP GWLEW+G FAL TLYYGEY N+GPGS    RVKWPGY 
Sbjct  492  PWKLYSRVVYMMSDMGDHIDPRGWLEWNGPFALDTLYYGEYMNKGPGSGMGQRVKWPGYH  551

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ ++ EA++FTV  FI G  W+P TGV F+  L+
Sbjct  552  VITSAVEASKFTVAQFISGSSWLPPTGVAFFSGLS  586



>ref|XP_006360083.1| PREDICTED: pectinesterase 2.1-like [Solanum tuberosum]
Length=550

 Score =   133 bits (335),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S LG LIDPAGW EWDG+FALKTLYYGE+ N GPG+ TS RVKWPGY 
Sbjct  455  PWKEYSRTVVMQSYLGGLIDPAGWAEWDGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYH  514

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ + +EA  FTV   I G  W+ +TGV +
Sbjct  515  VITDPAEAMPFTVAELIQGGSWLSSTGVAY  544



>gb|ABK92615.1| unknown [Populus trichocarpa]
Length=144

 Score =   126 bits (317),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+MLS +G  I P GWLEWD  FAL TLYYGEY N GPG+    RVKWPGYR
Sbjct  49   PWKLYSRTVYMLSFMGDHIHPRGWLEWDASFALDTLYYGEYMNYGPGAAVGQRVKWPGYR  108

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ +T EAN+FTV  FI G  W+P+TGV F   L+
Sbjct  109  VITSTVEANKFTVAQFIYGSSWLPSTGVAFLAGLS  143



>gb|AAF23891.1| pectin methyl esterase [Solanum tuberosum]
Length=530

 Score =   133 bits (335),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S LG LIDPAGW EW GEFALKTLYYGEY N GPG+ TS RVKWPGY 
Sbjct  435  PWKEYSRTVVMQSYLGGLIDPAGWAEWSGEFALKTLYYGEYMNNGPGAGTSKRVKWPGYH  494

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ + +EA  FTV   I G  W+ +TGV +
Sbjct  495  VITDPAEAMPFTVAELIQGGSWLSSTGVAY  524



>gb|AFW03484.1| pectin methylesterase 5 [Gossypium hirsutum]
Length=519

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L SLI+PA W+EWDG FALKTLYY EY N GPGS+TS RVKW GY 
Sbjct  426  PWKQYSRTVFMKTYLDSLINPADWMEWDGNFALKTLYYAEYMNTGPGSSTSNRVKWGGYH  485

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            +L + SE ++FTVGNF+ G  W+P+TGVPF
Sbjct  486  VLKSASEVSKFTVGNFLAGNSWLPSTGVPF  515



>gb|KDO87166.1| hypothetical protein CISIN_1g0440421mg, partial [Citrus sinensis]
Length=230

 Score =   129 bits (324),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S + SLI+P+GW  W G+FAL TLYY EY NRGPGSN++ RV WPGY 
Sbjct  136  PWKEYSRTVIMQSFMDSLINPSGWQIWTGDFALSTLYYAEYDNRGPGSNSANRVTWPGYH  195

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N ++A  FTV NF+LG  W+P TGVP+
Sbjct  196  VINATDAANFTVSNFLLGDVWLPQTGVPY  224



>ref|XP_009799791.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20 
[Nicotiana sylvestris]
Length=539

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S + SLI+PAGW  W G+FAL TLYY EY N GPGSNTS+RV WPGY 
Sbjct  446  PWKEYSRTVYMQSFMDSLINPAGWAAWSGDFALSTLYYAEYNNTGPGSNTSSRVTWPGYH  505

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N+++A  +TV NFI G  W+PATGVP+
Sbjct  506  VINSTDAISYTVSNFIAGNFWLPATGVPY  534



>ref|XP_006350555.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61-like 
[Solanum tuberosum]
Length=585

 Score =   134 bits (336),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 57/95 (60%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+MLSN+G  I P GWLEW+G+FAL TLYYGEY N GPG+    RV WPGYR
Sbjct  490  PWKMYSRTVYMLSNMGDHIHPHGWLEWNGDFALNTLYYGEYMNFGPGAAVGQRVTWPGYR  549

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ +  EA++FTV  FI G  W+P+TGV F   L+
Sbjct  550  VIKSVEEASKFTVSKFIYGSSWLPSTGVSFLAGLS  584



>ref|NP_001044480.1| Os01g0788400 [Oryza sativa Japonica Group]
 dbj|BAD53265.1| putative pectin esterase [Oryza sativa Japonica Group]
 dbj|BAF06394.1| Os01g0788400 [Oryza sativa Japonica Group]
 dbj|BAH00252.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55512.1| hypothetical protein OsJ_03720 [Oryza sativa Japonica Group]
Length=546

 Score =   133 bits (335),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 2/91 (2%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDG-EFALKTLYYGEYQNRGPGSNTSARVKWPGY  217
            PWKEYSRTV+MLS L S +DP GWLEW+G +FALKTL+YGEYQN+GPG++T+ RV WPGY
Sbjct  452  PWKEYSRTVYMLSYLDSHVDPRGWLEWNGADFALKTLFYGEYQNQGPGASTAGRVNWPGY  511

Query  216  RIL-NTSEANQFTVGNFILGQQWIPATGVPF  127
             ++ + S A QFTVG FI G  W+ ATGV +
Sbjct  512  HVITDQSVAMQFTVGQFIQGGNWLKATGVNY  542



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ S L  LI+PAGWLEW G F L TLYYGEY N+GPGS+T+ RVKWPGYR
Sbjct  489  PWKEYSRTVFIGSYLDDLINPAGWLEWSGNFGLSTLYYGEYMNKGPGSDTTNRVKWPGYR  548

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++N+S EA QFTV +FI G  W+ +TG+P+   L+
Sbjct  549  VINSSTEATQFTVASFIQGGGWLSSTGIPYSAGLS  583



>gb|AAN84553.1| methyl pectinesterase [Lolium perenne]
Length=226

 Score =   129 bits (323),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV++ S L S++DP GWLEWDG FAL TLYYGEYQN G G++TS RVKW GYR
Sbjct  133  PWKQYSRTVYLQSELDSVVDPKGWLEWDGTFALDTLYYGEYQNTGAGASTSNRVKWKGYR  192

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++SEA+ FTVG+FI G  W+  T +PF   L
Sbjct  193  VISSSSEASTFTVGSFIDGDVWLAGTSIPFSTGL  226



>ref|XP_008439095.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=571

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM + + SL+DP GWLEWDG+FAL TLYYGEY N GPGS  S RVKW GY 
Sbjct  478  PWKEYSRTVFMKTYIDSLVDPTGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWKGYH  537

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ N++EA++FTV NFI GQ W+P T VPF
Sbjct  538  VISNSTEASEFTVQNFIAGQSWLPNTEVPF  567



>ref|XP_004234960.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Solanum lycopersicum]
Length=583

 Score =   133 bits (335),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 57/95 (60%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+MLSN+G  I P GWLEW+G+FAL TLYYGEY N GPG+    RV WPGYR
Sbjct  488  PWKMYSRTVYMLSNMGDHIHPHGWLEWNGDFALNTLYYGEYMNFGPGAAVGQRVTWPGYR  547

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ +  EA++FTV  FI G  W+P+TGV F   L+
Sbjct  548  VIKSVEEASKFTVSKFIYGSSWLPSTGVSFLAGLS  582



>ref|XP_010460102.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6 
isoform X1 [Camelina sativa]
 ref|XP_010460103.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6 
isoform X2 [Camelina sativa]
Length=553

 Score =   133 bits (335),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVFM  NLG L++PAGWL W+GEFAL+TLYYGEY N G G++ + RVKWPGY 
Sbjct  460  PWKSYSRTVFMKCNLGGLVNPAGWLPWNGEFALRTLYYGEYGNTGAGASVAGRVKWPGYH  519

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVP  130
            ++ T +EA +FTV NF+ G  WI A GVP
Sbjct  520  VIKTATEAGKFTVENFLDGNYWITAAGVP  548



>ref|XP_010316615.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   133 bits (335),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGY-  217
            PWK YSRTV+M SN+G  IDPAGW EWDG+FALKTLYYGEY N+G G+  S RV WPGY 
Sbjct  455  PWKAYSRTVYMQSNIGDHIDPAGWSEWDGDFALKTLYYGEYMNKGAGAGISKRVNWPGYH  514

Query  216  RILNTSEANQFTVGNFILGQQWIPATGVPF  127
            + L TSEA +FTVG  I G  W+ +TGV +
Sbjct  515  KALTTSEATKFTVGQLIQGAAWLKSTGVAY  544



>dbj|BAK05307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=548

 Score =   133 bits (334),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+M S LG+ + P GWLEWDG+FAL+TL+YGEY N GPG+ T+ RVKWPGYR
Sbjct  455  PWKAYSRTVYMQSYLGAHVHPRGWLEWDGDFALRTLFYGEYANEGPGAGTAGRVKWPGYR  514

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ + S A QFTVG FI G  WI  TGV +
Sbjct  515  VITDRSVAVQFTVGRFIQGANWIKGTGVAY  544



>ref|XP_004143735.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN50327.1| hypothetical protein Csa_5G167190 [Cucumis sativus]
Length=520

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV++ S + SL++PAGWLEW G FAL TLYYGE++N GPGS+T+ RVKW GYR
Sbjct  427  PWKEYSRTVYLQSFMDSLVNPAGWLEWSGNFALNTLYYGEFKNSGPGSSTANRVKWKGYR  486

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + SEA +FTVG+FI G  W+P TGVPF   L
Sbjct  487  VITSASEAAKFTVGSFIAGNSWLPGTGVPFTAGL  520



>gb|EAY76103.1| hypothetical protein OsI_04029 [Oryza sativa Indica Group]
Length=546

 Score =   132 bits (333),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 2/91 (2%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDG-EFALKTLYYGEYQNRGPGSNTSARVKWPGY  217
            PWKEYSRTV+MLS L S +DP GWLEW+G +FALKTL+YGEYQN+GPG+ T+ RV WPGY
Sbjct  452  PWKEYSRTVYMLSYLDSHVDPRGWLEWNGADFALKTLFYGEYQNQGPGAGTAGRVNWPGY  511

Query  216  RIL-NTSEANQFTVGNFILGQQWIPATGVPF  127
             ++ + S A QFTVG FI G  W+ ATGV +
Sbjct  512  HVITDQSVAMQFTVGQFIQGGNWLKATGVNY  542



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score =   133 bits (334),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 58/94 (62%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ S L  LI PAGWLEW+  FAL TLYYGEY N GPG+ T+ RV WPGYR
Sbjct  501  PWKEYSRTVFLQSYLDDLIHPAGWLEWNETFALSTLYYGEYMNTGPGAGTANRVNWPGYR  560

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ + +EA+QFTV  FI G  W+P+TGV +   L
Sbjct  561  VITSATEASQFTVNQFIEGDTWLPSTGVEYSSGL  594



>gb|KDP22414.1| hypothetical protein JCGZ_26245 [Jatropha curcas]
Length=523

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV++ + L SL+DPAGWLEWDG+FAL TLYYGEY+N GP ++TS RV W GYR
Sbjct  430  PWKQYSRTVYLQTYLDSLVDPAGWLEWDGDFALNTLYYGEYKNVGPSASTSGRVTWRGYR  489

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPF  127
            ++ +S EAN+FTV NFI G  W+PA+ VPF
Sbjct  490  VITSSTEANRFTVANFIAGGSWLPASSVPF  519



>ref|XP_009776000.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Nicotiana sylvestris]
Length=598

 Score =   133 bits (334),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 56/94 (60%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+MLSN+G  I P+GWLEW+G+FAL TLYYGEY N GPG+    RV WPGYR
Sbjct  503  PWKMYSRTVYMLSNMGDHIHPSGWLEWNGDFALDTLYYGEYMNFGPGAAVGKRVTWPGYR  562

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ +  EA++FTV  FI G  W+P+TGV +   L
Sbjct  563  VIKSVEEASKFTVAKFIYGSSWLPSTGVAYLAGL  596



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV++ S + +L+DPAGW+EW G FAL TLYYGEY+N GPGS+T+ RV W GYR
Sbjct  434  PWKQYSRTVYLTSYIDTLVDPAGWMEWSGNFALDTLYYGEYKNYGPGSSTANRVNWGGYR  493

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++  +SEA+QFTVG FI G  W+PATGVPF
Sbjct  494  VITKSSEASQFTVGKFISGDSWLPATGVPF  523



>ref|XP_004972208.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 2.1-like, partial 
[Setaria italica]
Length=525

 Score =   132 bits (333),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 57/93 (61%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+M S +G+ +DP GWLEW+G FALKTL+YGEY+N GPG+ T+ARV+WPGY 
Sbjct  432  PWKAYSRTVYMRSYVGAHVDPRGWLEWNGNFALKTLFYGEYENEGPGAGTAARVRWPGYH  491

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVN  118
            ++ + S A QFTVG FI G  W+ +TGV  Y+N
Sbjct  492  VITDRSVAVQFTVGQFIQGGSWLKSTGVA-YIN  523



>ref|XP_010253281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41 
[Nelumbo nucifera]
Length=560

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S + SLIDPAGW EW G FAL TLYY EY N GPGS T+ RV WPGY 
Sbjct  467  PWKEYSRTVYMQSIIDSLIDPAGWKEWSGNFALSTLYYAEYNNTGPGSVTTDRVSWPGYH  526

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N ++A  FTV NFILG  W+PAT VP+
Sbjct  527  LINATDAANFTVSNFILGDSWLPATIVPY  555



>ref|XP_007038413.1| Pectinesterase [Theobroma cacao]
 gb|EOY22914.1| Pectinesterase [Theobroma cacao]
Length=516

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM + L SL+DPAGW EWDG+FAL TLYYGEY+N GP + TS RV W GYR
Sbjct  423  PWKEYSRTVFMQTYLDSLVDPAGWFEWDGDFALNTLYYGEYKNIGPAAPTSRRVTWKGYR  482

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + +EA++FTV NFI G+ W+P TG+PF
Sbjct  483  VITSATEASKFTVTNFIAGRSWLPDTGIPF  512



>ref|XP_002322399.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06526.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=516

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVF+ + L S +DPAGWLEW+G FAL TLYYGEY+N GPG++TS RVKWPGY+
Sbjct  423  PWRKYSRTVFLSTYLDSSVDPAGWLEWNGSFALNTLYYGEYKNTGPGASTSGRVKWPGYK  482

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++ EA++FTV NFI G+ W+PATGV F   L
Sbjct  483  VITSAEEASEFTVANFIGGRSWLPATGVQFAAGL  516



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S +   +DPAGWLEW+G FAL TLYYGEY NRGPGS+TSARV WPGYR
Sbjct  466  PWKEYSRTVIMRSYIDDSVDPAGWLEWNGTFALSTLYYGEYLNRGPGSSTSARVTWPGYR  525

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N+S EA QFT+  FI G +W+ ++ +PF + L
Sbjct  526  VINSSTEATQFTIEPFIQGNEWLNSSNIPFALGL  559



>ref|XP_010692197.1| PREDICTED: pectinesterase 2 [Beta vulgaris subsp. vulgaris]
Length=527

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L  ++DP GWLEW+G+FAL TLYYGEY N GPGS+TS RVKW GY 
Sbjct  434  PWKKYSRTVFMKTYLSGIVDPKGWLEWNGDFALSTLYYGEYANTGPGSSTSNRVKWSGYH  493

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ +S EA +F VGNFI G  W+P+TGVPF   L
Sbjct  494  VITSSAEAGKFNVGNFIAGNNWLPSTGVPFKSGL  527



>ref|XP_008436965.1| PREDICTED: pectinesterase 2-like [Cucumis melo]
Length=519

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV++ S + SL++PAGWLEW G FAL TLYYGE++N GPGS+T+ RVKW GYR
Sbjct  426  PWKEYSRTVYLQSFMESLVNPAGWLEWSGNFALNTLYYGEFKNYGPGSSTANRVKWKGYR  485

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++ EA +FTVGNFI G  W+P TGVPF   L
Sbjct  486  VITSANEAAKFTVGNFIAGNSWLPGTGVPFTAGL  519



>ref|XP_010035249.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Eucalyptus grandis]
Length=596

 Score =   132 bits (333),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR V+MLS +G  I P GWLEW+G+FAL TLYYGEY N GPG+    RVKWPG+R
Sbjct  501  PWKMYSRVVYMLSYMGDHIHPEGWLEWNGDFALDTLYYGEYMNDGPGAAVGLRVKWPGFR  560

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ +T+EAN+FTV  FI G  W+P+TGV F   L+
Sbjct  561  VITSTTEANKFTVAQFIFGSSWLPSTGVAFVAGLS  595



>gb|KHN47891.1| Pectinesterase 2 [Glycine soja]
Length=513

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM + L SLI+PAGW+EWDG FAL TLYY EY N GPGSNT+ RV W GY 
Sbjct  420  PWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVTWKGYH  479

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +L + SEA+ FTVGNFI G  WIP++GVPF   L
Sbjct  480  VLTSASEASPFTVGNFIAGSNWIPSSGVPFTSGL  513



>emb|CAN76835.1| hypothetical protein VITISV_043176 [Vitis vinifera]
Length=497

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ + L SLI+ AGW+EW G+FALKTLYYGEY N GPGS+TS RV W GY 
Sbjct  404  PWKEYSRTVFLKTYLDSLINSAGWMEWSGDFALKTLYYGEYMNTGPGSSTSGRVDWAGYH  463

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPF  127
            ++ +S EA +FTVGNFI G  W+P+T VPF
Sbjct  464  VITSSTEAAKFTVGNFISGNSWLPSTNVPF  493



>ref|XP_004136014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=561

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVF+ S +G LI+P GWLEW+G FAL TLYYGEY NRGPGSNT+ RV WPGYR
Sbjct  465  PWKLYSRTVFLRSFIGQLIEPVGWLEWNGTFALDTLYYGEYLNRGPGSNTTMRVTWPGYR  524

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ N +EA+QFTV  FI G  W+ +T +PF+  LT
Sbjct  525  VITNATEASQFTVERFIQGSSWLNSTEIPFFSGLT  559



>ref|XP_011000694.1| PREDICTED: pectinesterase [Populus euphratica]
Length=557

 Score =   132 bits (332),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M SN+G LIDPAGW  WDGEFALKTLYYGEY N+G G+ TS RVKWPGY 
Sbjct  464  PWKEYSRTVVMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVKWPGYH  523

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPF  127
            ++ ++ EA +FTV   I G  W+ +TGV +
Sbjct  524  VITSANEAKKFTVAELIQGGVWLKSTGVSY  553



>ref|XP_004171768.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=591

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVF+ S +G LI+P GWLEW+G FAL TLYYGEY NRGPGSNT+ RV WPGYR
Sbjct  495  PWKLYSRTVFLRSFIGQLIEPVGWLEWNGTFALDTLYYGEYLNRGPGSNTTMRVTWPGYR  554

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ N +EA+QFTV  FI G  W+ +T +PF+  LT
Sbjct  555  VITNATEASQFTVEGFIQGSSWLNSTEIPFFSGLT  589



>ref|XP_006646399.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 2.2-like [Oryza 
brachyantha]
Length=523

 Score =   132 bits (331),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/92 (65%), Positives = 72/92 (78%), Gaps = 3/92 (3%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+MLS L + +DPAGWL W+G+FALKTL+YGEYQN+GPG+ T+ARV WPG R
Sbjct  428  PWKEYSRTVYMLSYLDAHVDPAGWLAWNGDFALKTLFYGEYQNQGPGAGTAARVGWPGDR  487

Query  213  ILNT---SEANQFTVGNFILGQQWIPATGVPF  127
             + T   S A QFTVG FI G  W+ ATGV +
Sbjct  488  GITTGDRSVAMQFTVGQFIQGGDWLNATGVTY  519



>ref|XP_010518135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
isoform X1 [Camelina sativa]
 ref|XP_010518136.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
isoform X2 [Camelina sativa]
Length=510

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 77/94 (82%), Gaps = 2/94 (2%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM ++L SLIDP GWLEWDG FAL+TL+Y E+QN GPG++TSARV WPG+R
Sbjct  418  PWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTSARVTWPGFR  477

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +L + SEA++FTVG F+ G  WIP++ VPF   L
Sbjct  478  VLRSASEASKFTVGTFLAGSSWIPSS-VPFTSGL  510



>ref|XP_006644119.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41-like 
[Oryza brachyantha]
Length=553

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV M S +G+LIDPAGW+ WDG++AL TLYY EY N GPG++TS RV WPGY 
Sbjct  459  PWKLYSRTVVMQSVVGALIDPAGWMPWDGDYALSTLYYAEYNNSGPGADTSRRVSWPGYH  518

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +L NT++A  FTVGN +LG  W+P TGVPF   L
Sbjct  519  VLNNTADAGNFTVGNMVLGDFWLPQTGVPFTSGL  552



>ref|XP_006467993.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Citrus 
sinensis]
Length=556

 Score =   132 bits (332),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S++G  IDPAGW EW G+FALKTLYYGEY NRGPG+ TS RVKWPGY 
Sbjct  463  PWKEYSRTVVMQSHIGDHIDPAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYH  522

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ +  EA +FTV   I G  W+ +TGV +
Sbjct  523  VITDPEEAKKFTVAELIGGGSWLKSTGVAY  552



>ref|XP_002265740.2| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=512

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ + L SLI+ AGW+EW G+FALKTLYYGEY N GPGS+TS RV W GY 
Sbjct  419  PWKEYSRTVFLKTYLDSLINSAGWMEWSGDFALKTLYYGEYMNTGPGSSTSGRVDWAGYH  478

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPF  127
            ++ +S EA +FTVGNFI G  W+P+T VPF
Sbjct  479  VITSSTEAAKFTVGNFISGNSWLPSTNVPF  508



>gb|KDO75533.1| hypothetical protein CISIN_1g008722mg [Citrus sinensis]
Length=556

 Score =   132 bits (331),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S++G  IDPAGW EW G+FALKTLYYGEY NRGPG+ TS RVKWPGY 
Sbjct  463  PWKEYSRTVVMQSHIGDHIDPAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYH  522

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ +  EA +FTV   I G  W+ +TGV +
Sbjct  523  VITDPEEAKKFTVAELIGGGSWLKSTGVAY  552



>ref|XP_010069899.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41 
[Eucalyptus grandis]
Length=568

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV+M S + SLI+PAGW  WDG+FAL TLYY EY N GPGSNT+ RV WPGY 
Sbjct  475  PWKQYSRTVYMQSFMDSLINPAGWQIWDGDFALATLYYAEYNNTGPGSNTTNRVTWPGYH  534

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N ++A  FTV +F+LG  W+P TGVP+
Sbjct  535  VINATDAANFTVSSFLLGDNWLPQTGVPY  563



>ref|XP_008386683.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Malus domestica]
Length=569

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S + S++DP GW EW+G+FAL TLYY EY N GPGSNT+ RV W GY 
Sbjct  476  PWKEYSRTVYMQSYIDSVVDPVGWQEWNGDFALTTLYYAEYNNTGPGSNTTNRVTWSGYH  535

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N+++A  FTV NF+LG  W+P TGVP+
Sbjct  536  VINSTDAANFTVTNFLLGDDWLPQTGVPY  564



>ref|XP_008343201.1| PREDICTED: pectinesterase 2 [Malus domestica]
Length=511

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L SLI+PAGW+EW G+FALKTLYYGEY N GPG++T  RV W GY 
Sbjct  418  PWKQYSRTVFMKTYLDSLINPAGWMEWSGDFALKTLYYGEYMNTGPGASTKNRVSWAGYH  477

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + SEA++F+VGNFI G  W+PAT VPF
Sbjct  478  VITSASEASEFSVGNFIAGGSWLPATNVPF  507



>ref|XP_008219290.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Prunus mume]
Length=564

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M + + S IDPAGW +W G+FAL TLYY EY N GPGS+T+ RV WPGY 
Sbjct  471  PWKEYSRTVYMQTFMDSFIDPAGWHDWSGDFALSTLYYAEYNNTGPGSSTANRVTWPGYH  530

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N+++A  FTV NF+LG  W+P TGVP+
Sbjct  531  VINSTDAANFTVSNFLLGDNWLPQTGVPY  559



>gb|KGN44975.1| Pectinesterase [Cucumis sativus]
Length=614

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVF+ S +G LI+P GWLEW+G FAL TLYYGEY NRGPGSNT+ RV WPGYR
Sbjct  518  PWKLYSRTVFLRSFIGQLIEPVGWLEWNGTFALDTLYYGEYLNRGPGSNTTMRVTWPGYR  577

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ N +EA+QFTV  FI G  W+ +T +PF+  LT
Sbjct  578  VITNATEASQFTVERFIQGSSWLNSTEIPFFSGLT  612



>ref|XP_010271269.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM ++L SL+DPAGWLEW G FAL TLYYGEY N G G++TS RVKWPG+ 
Sbjct  437  PWQKYSRTVFMKTSLDSLVDPAGWLEWSGNFALSTLYYGEYMNIGGGASTSRRVKWPGFH  496

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +++ S+A +FTV NF+ G  WI ATGVPF   L
Sbjct  497  VMSASDAGKFTVENFLGGGSWIAATGVPFTSGL  529



>emb|CDX95641.1| BnaC03g25220D [Brassica napus]
Length=445

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 77/94 (82%), Gaps = 2/94 (2%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM ++L SLIDP GWLEWDG FAL+TL+Y E+QN GPG++TS RV WPG+R
Sbjct  353  PWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTSGRVTWPGFR  412

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +L +TSEA++FTVG+F+ G  WIP+  VPF   L
Sbjct  413  VLSSTSEASRFTVGSFLAGSSWIPS-DVPFTSGL  445



>gb|KDO87167.1| hypothetical protein CISIN_1g045495mg [Citrus sinensis]
Length=549

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S L  LI+PAGW  W G+FAL TLYY EY NRGPGSNT+ RV WPGY 
Sbjct  455  PWKEYSRTVVMQSFLDGLINPAGWQIWTGDFALSTLYYAEYDNRGPGSNTANRVTWPGYH  514

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
             +N ++A  FTV NF+LG QW+P TGVP+
Sbjct  515  AINATDAANFTVSNFLLGDQWLPRTGVPY  543



>ref|XP_006444391.1| hypothetical protein CICLE_v10024391mg [Citrus clementina]
 gb|ESR57631.1| hypothetical protein CICLE_v10024391mg [Citrus clementina]
Length=566

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S L  LI+PAGW  W G+FAL TLYY EY NRGPGSNT+ RV WPGY 
Sbjct  472  PWKEYSRTVVMQSFLDGLINPAGWQIWTGDFALSTLYYAEYDNRGPGSNTANRVTWPGYH  531

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
             +N ++A  FTV NF+LG QW+P TGVP+
Sbjct  532  AINATDAANFTVSNFLLGDQWLPRTGVPY  560



>gb|AER38244.1| PME5 [Gossypium barbadense]
Length=519

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L SLI+PAGW+EWD +FA KTLYY EY N GPGS+TS RVKW GY 
Sbjct  426  PWKQYSRTVFMKTYLDSLINPAGWMEWDDDFAPKTLYYAEYMNTGPGSSTSNRVKWGGYH  485

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +L + SE ++FTVGNF+ G  W+P+TGVPF   L
Sbjct  486  VLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>ref|XP_006480113.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7-like 
[Citrus sinensis]
Length=566

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S L  LI+PAGW  W G+FAL TLYY EY NRGPGSNT+ RV WPGY 
Sbjct  472  PWKEYSRTVVMQSFLDGLINPAGWQIWTGDFALSTLYYAEYDNRGPGSNTANRVTWPGYH  531

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
             +N ++A  FTV NF+LG QW+P TGVP+
Sbjct  532  AINATDAANFTVSNFLLGDQWLPRTGVPY  560



>ref|XP_007052106.1| Pectinesterase 2 [Theobroma cacao]
 gb|EOX96263.1| Pectinesterase 2 [Theobroma cacao]
Length=517

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L SLI+PAGW+EWDG FAL TLYY EY N G GS+TS RVKW GY 
Sbjct  424  PWKQYSRTVFMKTFLDSLINPAGWMEWDGNFALNTLYYAEYMNTGTGSSTSNRVKWRGYH  483

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            +L + SEA++FTV NF+ G  W+PATGVPF
Sbjct  484  VLTSASEASKFTVSNFLAGNSWLPATGVPF  513



>ref|XP_010556724.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=547

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTVF+ S +   +DPAGWLEW+G+FAL TLYYGEY NRGPGSNT+ RVKW GYR
Sbjct  453  PWKAYSRTVFIKSYIDDAVDPAGWLEWNGDFALDTLYYGEYMNRGPGSNTTNRVKWAGYR  512

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N+S EA++FTVG F+ G  W+ +T +PF + L
Sbjct  513  VINSSTEASKFTVGPFVQGDAWLNSTKIPFSLGL  546



>ref|XP_009614734.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Nicotiana tomentosiformis]
Length=585

 Score =   132 bits (331),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 56/94 (60%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV+MLSN+G  I P+GWLEW+G FAL TLYYGEY N GPG+    RV WPGYR
Sbjct  490  PWKLYSRTVYMLSNMGDHIHPSGWLEWNGNFALDTLYYGEYMNFGPGAAVGQRVTWPGYR  549

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ +  EA++FTV  FI G  W+P+TGV +   L
Sbjct  550  VIKSVEEASKFTVAKFIYGSSWLPSTGVAYLAGL  583



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   131 bits (330),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S +  +I+PAGW EW+G FAL TLYYGEYQN G G+ TS RVKW GY+
Sbjct  471  PWKEYSRTVIMQSTISDVINPAGWHEWNGNFALNTLYYGEYQNTGAGAGTSGRVKWKGYK  530

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + SEA QFTVG+FI G  W+ +TG PF
Sbjct  531  VITSASEAKQFTVGDFINGGSWLGSTGFPF  560



>ref|XP_002865971.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42230.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=587

 Score =   132 bits (331),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR V+M+S++G  IDP GWLEW+G +AL TLYYGEY N+GPGS    R+KWPGY 
Sbjct  492  PWKLYSRVVYMMSDMGDHIDPRGWLEWNGPYALDTLYYGEYMNKGPGSGMGQRIKWPGYH  551

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ +  EA++FTV  FI G  W+P+TGV F+  L+
Sbjct  552  VITSMVEASKFTVAQFISGSSWLPSTGVAFFSGLS  586



>ref|XP_007222925.1| hypothetical protein PRUPE_ppa005208mg [Prunus persica]
 gb|EMJ24124.1| hypothetical protein PRUPE_ppa005208mg [Prunus persica]
Length=472

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV M S+L  LIDPAGW  W G FAL TLYYGEY N G G  T  RVKWPGYR
Sbjct  379  PWKKYSRTVIMKSDLDGLIDPAGWFPWSGSFALSTLYYGEYMNSGAGGATGGRVKWPGYR  438

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++ EA +FTVGN + G+ WIPATGVPF   L
Sbjct  439  VITSAVEAGKFTVGNILAGESWIPATGVPFSAGL  472



>ref|XP_009378667.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
 ref|XP_009339421.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=510

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM + L SLI+PAGW+EW G+FALKTLYYGEY N GPG++T  RV W GY 
Sbjct  417  PWKQYSRTVFMKTYLDSLINPAGWMEWSGDFALKTLYYGEYMNTGPGASTKNRVSWAGYH  476

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            ++ + SEA++F+VGNFI G  W+PAT VPF
Sbjct  477  VITSASEASKFSVGNFIAGGSWLPATNVPF  506



>ref|XP_010524372.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM + L  LIDP GWLEW+G FAL TL+Y EYQN GPGS+TS RV WPG+R
Sbjct  420  PWRQYSRTVFMKTFLDGLIDPRGWLEWNGNFALSTLFYAEYQNTGPGSSTSGRVTWPGFR  479

Query  213  ILN-TSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +L   S+A++FTVG+FI G  WIPAT VPF   L
Sbjct  480  VLTAASDASRFTVGSFIAGNSWIPATNVPFTSGL  513



>emb|CAN78759.1| hypothetical protein VITISV_000562 [Vitis vinifera]
Length=513

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ + L SLI+ AGW+EW G+FALKTLYYGEY N GPGS+TS RV W GY 
Sbjct  420  PWKEYSRTVFLKTYLDSLINSAGWMEWSGDFALKTLYYGEYMNTGPGSSTSGRVDWAGYH  479

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPF  127
            ++ +S EA +FTVGNFI G  W+P+T VPF
Sbjct  480  VITSSTEAAKFTVGNFISGNSWLPSTKVPF  509



>ref|XP_006442946.1| hypothetical protein CICLE_v10023535mg [Citrus clementina]
 ref|XP_006478765.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41-like 
[Citrus sinensis]
 gb|ESR56186.1| hypothetical protein CICLE_v10023535mg [Citrus clementina]
Length=572

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S + SLI+PAGW EW G+FAL TLYY EY N GPGS+T+ RV WPGY+
Sbjct  479  PWKEYSRTVYMQSFMDSLINPAGWHEWSGDFALATLYYAEYNNTGPGSDTTNRVTWPGYQ  538

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N ++A  FTV NF+LG  W+P T VP+
Sbjct  539  VINATDAANFTVSNFLLGDNWLPQTAVPY  567



>gb|KHN47892.1| Pectinesterase 2 [Glycine soja]
Length=507

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM + L SLI+PAGW+EWDG FAL TLYY EY N GPGSNT+ RV W GY 
Sbjct  414  PWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVTWKGYH  473

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            +L + S+A+ FTVGNFI G  WIP++GVPF
Sbjct  474  VLTSASQASPFTVGNFIAGNNWIPSSGVPF  503



>emb|CBI24284.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVF+ + L SLI+ AGWLEW G FAL TLYYGEY N G GS+TS RVKW GY 
Sbjct  166  PWKEYSRTVFLKTYLDSLINSAGWLEWSGNFALNTLYYGEYMNTGDGSSTSGRVKWAGYH  225

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ +S EA +FTVGNFI G  W+P+T VPF   L
Sbjct  226  VITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL  259



>gb|KHN43319.1| Putative pectinesterase/pectinesterase inhibitor 7 [Glycine soja]
Length=346

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGS-LIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGY  217
            PWK+YSRT++M S +   L+DP GW  W G+FAL TLYY E+ N+GPGSNTS RV WPGY
Sbjct  251  PWKQYSRTLYMQSFMDDGLVDPEGWKAWSGDFALDTLYYAEFDNQGPGSNTSNRVTWPGY  310

Query  216  RILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
             ++N ++A  FTV NFI+G  W+PATGVP+Y +L
Sbjct  311  HVINATDAVNFTVANFIIGDAWLPATGVPYYADL  344



>ref|XP_006449081.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
 gb|ESR62321.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
Length=556

 Score =   131 bits (330),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV M S++G  IDPAGW EW G+FALKTLYYGEY NRGPG+ TS RVKWPGY 
Sbjct  463  PWKEYSRTVVMQSHIGGHIDPAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYH  522

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ +  EA +FTV   I G  W+ +TGV +
Sbjct  523  VITDPGEAKKFTVAELIGGGSWLKSTGVAY  552



>ref|XP_010482728.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 
[Camelina sativa]
Length=589

 Score =   131 bits (330),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 55/95 (58%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR V+M+S++G  IDP GWLEW+G FAL TLYYGEY N+G GS    RVKWPGY 
Sbjct  494  PWKLYSRVVYMMSDMGDHIDPRGWLEWNGPFALDTLYYGEYMNKGVGSGMGQRVKWPGYH  553

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNLT  112
            ++ ++ EA++FTV  FI G  W+P+TGV F+  L+
Sbjct  554  VITSAVEASKFTVAQFISGSSWLPSTGVAFFSGLS  588



>emb|CDX74715.1| BnaA05g04610D [Brassica napus]
Length=445

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 77/94 (82%), Gaps = 2/94 (2%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM ++L SLIDP GWLEW+G FAL TL+Y E+QN GPG++TS RVKWPG+R
Sbjct  353  PWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALSTLFYAEFQNTGPGASTSGRVKWPGFR  412

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +L + SEA++FTVG+FI G  WIP++ VPF   L
Sbjct  413  VLQSASEASRFTVGSFIAGSSWIPSS-VPFTSGL  445



>ref|XP_002456465.1| hypothetical protein SORBIDRAFT_03g036790 [Sorghum bicolor]
 gb|EES01585.1| hypothetical protein SORBIDRAFT_03g036790 [Sorghum bicolor]
Length=552

 Score =   131 bits (329),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV MLS L + +D  GWLEWDG+FALKTL+YGEYQN GPG+ T+ RV WPGY 
Sbjct  459  PWKAYSRTVVMLSYLDAHVDARGWLEWDGDFALKTLFYGEYQNEGPGAATAGRVNWPGYH  518

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ + S A QFTVG FI G  W+  TGVP+
Sbjct  519  VITDRSVAVQFTVGQFIQGGNWLNGTGVPY  548



>ref|XP_003517028.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=515

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM + L SLI+PAGW+EWDG FAL TLYY EY N GPGSNT+ RV W GY 
Sbjct  422  PWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVTWKGYH  481

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPF  127
            +L + S+A+ FTVGNFI G  WIP++GVPF
Sbjct  482  VLTSASQASPFTVGNFIAGNNWIPSSGVPF  511



>ref|XP_010257625.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTV++ + L  L+DPAGWLEW G FAL TLYYGEY+N GPGS+T+ RVKW GYR
Sbjct  434  PWQQYSRTVYLQTYLDGLVDPAGWLEWGGSFALNTLYYGEYKNIGPGSSTARRVKWRGYR  493

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPF  127
            ++ N SEA+ FTVGNFI G+ W+P TGVPF
Sbjct  494  VIRNPSEASLFTVGNFISGRSWLPGTGVPF  523



>gb|KGN49865.1| hypothetical protein Csa_5G139430 [Cucumis sativus]
Length=604

 Score =   132 bits (331),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR V+M+S++G  I P GWLEW G FAL TLYYGEY N GPG+    RVKWPGYR
Sbjct  508  PWKLYSRVVYMVSSMGDHIHPRGWLEWQGSFALDTLYYGEYMNSGPGAAVGQRVKWPGYR  567

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++ +T EA++FTVG FI G  W+P+TGV F   L+ +
Sbjct  568  VITSTVEASKFTVGQFIYGSSWLPSTGVSFSAGLSTN  604



>ref|XP_004172937.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61-like 
[Cucumis sativus]
Length=604

 Score =   132 bits (331),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR V+M+S++G  I P GWLEW G FAL TLYYGEY N GPG+    RVKWPGYR
Sbjct  508  PWKLYSRVVYMVSSMGDHIHPRGWLEWQGSFALDTLYYGEYMNSGPGAAVGQRVKWPGYR  567

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++ +T EA++FTVG FI G  W+P+TGV F   L+ +
Sbjct  568  VITSTVEASKFTVGQFIYGSSWLPSTGVSFSAGLSTN  604



>ref|XP_010937248.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=570

 Score =   131 bits (329),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRT+FM + + S I PAG+L WDG+FALKTLYY EY N G GSN  ARVKWPG+ 
Sbjct  475  PWKAYSRTIFMENQISSYIHPAGYLPWDGDFALKTLYYAEYNNNGEGSNVKARVKWPGFH  534

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            +++   A +FTV NFI G++WIP+ G P +++L
Sbjct  535  VIDRKTAEKFTVANFIEGKRWIPSRGAPAHMDL  567



>ref|XP_011017474.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTVFM + L SLI+PAGWL W+G FAL TLYYGEY N GPGS+T+ RV W GYR
Sbjct  421  PWKEYSRTVFMKTYLDSLINPAGWLPWNGNFALDTLYYGEYMNTGPGSSTANRVNWKGYR  480

Query  213  ILNTSE-ANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ +S  A+QFTVG+FI G  W+PAT VPF   L
Sbjct  481  VITSSTVASQFTVGSFISGNNWLPATNVPFTAGL  514



>ref|XP_010515266.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Camelina sativa]
Length=605

 Score =   131 bits (330),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/94 (61%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK +SRTV+M+S +GS +   GWLEW+  FAL TLYYGEY N GPGS    RVKWPGYR
Sbjct  510  PWKLFSRTVYMMSYIGSHVHTRGWLEWNTTFALDTLYYGEYMNSGPGSGLGQRVKWPGYR  569

Query  213  ILN-TSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N T+EAN+FTV  FI G  W+P+TGV F   L
Sbjct  570  VINSTAEANRFTVAEFIYGSSWLPSTGVSFLAGL  603



>ref|XP_009385345.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTVFM ++L SLI+PAGWLEW G F L TLYY EY N G G++TS RV WPGY 
Sbjct  429  PWQKYSRTVFMKTSLDSLINPAGWLEWSGSFGLSTLYYAEYMNTGAGADTSKRVNWPGYH  488

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++SEA++FTVG F+ G  WIPATGVPF   L
Sbjct  489  VIASSSEASKFTVGGFLSGDSWIPATGVPFSFGL  522



>ref|XP_010260073.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=563

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTV+M S + SLIDPAGW+ W G+FAL TLYY EY N GPGS T+ RV WPGY 
Sbjct  470  PWKQYSRTVYMQSFIDSLIDPAGWMAWSGDFALTTLYYAEYNNTGPGSGTTDRVTWPGYH  529

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPF  127
            ++N ++A  FTV NF+LG  WIP T VP+
Sbjct  530  LINATDAANFTVSNFLLGDNWIPTTKVPY  558



>ref|XP_008221458.1| PREDICTED: pectinesterase [Prunus mume]
Length=520

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PW++YSRTV M S+L  LIDPAGW  W+G FAL TLYYGEY N G G+ T  RVKWPGYR
Sbjct  427  PWQKYSRTVIMKSDLDGLIDPAGWFPWNGNFALSTLYYGEYMNSGAGAATGGRVKWPGYR  486

Query  213  ILNTS-EANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++ EA +FTVGN + G+ WIPATGVPF   L
Sbjct  487  VITSAVEAGKFTVGNILAGESWIPATGVPFSAGL  520



>ref|XP_006645812.1| PREDICTED: pectinesterase 2-like [Oryza brachyantha]
Length=406

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVFM S L S+++PAGWLEW+G FAL TLYYGEYQN G G++T+ RVKW GYR
Sbjct  313  PWKQYSRTVFMQSQLDSVVNPAGWLEWNGNFALDTLYYGEYQNTGDGASTANRVKWKGYR  372

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ ++SEA+ FTVG+FI G  W+  T VPF V L
Sbjct  373  VITSSSEASTFTVGSFIDGDVWLAGTSVPFSVGL  406



>gb|EMT05022.1| Pectinesterase 3 [Aegilops tauschii]
Length=472

 Score =   130 bits (327),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK+YSRTVF+ S L S++DPAGWL WDG FAL TLYY EYQN GPG+ TS RV W GYR
Sbjct  379  PWKQYSRTVFIQSELDSVVDPAGWLAWDGTFALDTLYYAEYQNTGPGAGTSGRVSWMGYR  438

Query  213  -ILNTSEANQFTVGNFILGQQWIPATGVPF  127
             +++ SEA+ FTVG+FI G  W+  T +PF
Sbjct  439  GVISASEASTFTVGSFIDGDVWLAGTSIPF  468



>ref|XP_009763675.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Nicotiana sylvestris]
Length=602

 Score =   131 bits (330),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 57/94 (61%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSRTV MLSNLG  I P GWLEW+  FAL+TLYYGEY N GPG+    RV WPGYR
Sbjct  507  PWKLYSRTVVMLSNLGDHIHPRGWLEWNATFALETLYYGEYMNYGPGAAVGQRVTWPGYR  566

Query  213  ILNT-SEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++ +  EA++FTV  FI G  W+P+TGV F   L
Sbjct  567  VITSVEEASKFTVAQFIFGSSWLPSTGVAFLAGL  600



>gb|KHN24739.1| Putative pectinesterase/pectinesterase inhibitor 7, partial [Glycine 
soja]
Length=501

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWKEYSRTV+M S + S I+P+GW EW G+FAL TLYY EY N GPGSNT+ RV WPGY 
Sbjct  408  PWKEYSRTVYMQSFMNSFINPSGWHEWSGDFALSTLYYAEYNNTGPGSNTANRVTWPGYH  467

Query  213  ILNTSEANQFTVGNFILGQQWIPATGVPFYVNL  115
            ++N ++A  FTV NF+ G  W+P TGVP+   L
Sbjct  468  VINATDAANFTVSNFLDGDSWLPQTGVPYVTGL  500



>ref|XP_008437596.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 61 [Cucumis melo]
Length=605

 Score =   131 bits (330),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -2

Query  393  PWKEYSRTVFMLSNLGSLIDPAGWLEWDGEFALKTLYYGEYQNRGPGSNTSARVKWPGYR  214
            PWK YSR V+M+S++G  I P GWLEW G FAL TLYYGEY N GPG+    RVKWPGYR
Sbjct  509  PWKLYSRVVYMVSSMGDHIHPRGWLEWQGSFALDTLYYGEYMNSGPGAAVGQRVKWPGYR  568

Query  213  IL-NTSEANQFTVGNFILGQQWIPATGVPFYVNLTAS  106
            ++ +T EA++FTVG FI G  W+P+TGV F   L+ +
Sbjct  569  VITSTVEASKFTVGQFIYGSSWLPSTGVSFSAGLSTN  605



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559124820270