BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF048J01

Length=345
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004157014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  78.2    4e-14   
ref|XP_004147533.1|  PREDICTED: uncharacterized protein LOC101221479  78.2    4e-14   Cucumis sativus [cucumbers]
ref|XP_006351365.1|  PREDICTED: uncharacterized protein LOC102603072  78.2    4e-14   Solanum tuberosum [potatoes]
ref|XP_004249304.1|  PREDICTED: uncharacterized protein LOC101268442  78.2    4e-14   Solanum lycopersicum
ref|XP_008441978.1|  PREDICTED: uncharacterized protein LOC103485979  78.2    4e-14   Cucumis melo [Oriental melon]
ref|XP_003624626.1|  Casein kinase I isoform alpha                    77.8    6e-14   Medicago truncatula
ref|XP_006443418.1|  hypothetical protein CICLE_v10019090mg           77.8    7e-14   Citrus clementina [clementine]
gb|EYU20664.1|  hypothetical protein MIMGU_mgv1a002165mg              77.4    7e-14   Erythranthe guttata [common monkey flower]
ref|XP_006479104.1|  PREDICTED: uncharacterized protein LOC102619...  77.4    7e-14   Citrus sinensis [apfelsine]
ref|XP_009771625.1|  PREDICTED: uncharacterized protein LOC104222130  77.4    8e-14   Nicotiana sylvestris
gb|KDP39706.1|  hypothetical protein JCGZ_02726                       77.4    8e-14   Jatropha curcas
ref|XP_009621585.1|  PREDICTED: uncharacterized protein LOC104113184  77.4    8e-14   Nicotiana tomentosiformis
ref|XP_011021493.1|  PREDICTED: uncharacterized protein LOC105123555  77.4    8e-14   Populus euphratica
ref|XP_002525432.1|  casein kinase, putative                          77.4    9e-14   Ricinus communis
emb|CDP14324.1|  unnamed protein product                              77.4    9e-14   Coffea canephora [robusta coffee]
ref|XP_011078778.1|  PREDICTED: uncharacterized protein LOC105162459  77.0    1e-13   Sesamum indicum [beniseed]
ref|XP_009615719.1|  PREDICTED: uncharacterized protein LOC104108400  77.0    1e-13   Nicotiana tomentosiformis
ref|XP_011075041.1|  PREDICTED: uncharacterized protein LOC105159627  77.0    1e-13   Sesamum indicum [beniseed]
ref|XP_010036218.1|  PREDICTED: uncharacterized protein LOC104425268  77.0    1e-13   Eucalyptus grandis [rose gum]
gb|KHG17118.1|  Casein kinase I isoform delta                         77.0    1e-13   Gossypium arboreum [tree cotton]
gb|KJB45108.1|  hypothetical protein B456_007G289500                  77.0    1e-13   Gossypium raimondii
ref|XP_004493152.1|  PREDICTED: uncharacterized protein LOC101504...  77.0    1e-13   Cicer arietinum [garbanzo]
ref|XP_010672054.1|  PREDICTED: uncharacterized protein LOC104888...  77.0    1e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009788026.1|  PREDICTED: uncharacterized protein LOC104235895  76.6    1e-13   Nicotiana sylvestris
ref|XP_009366444.1|  PREDICTED: uncharacterized protein LOC103956210  76.6    1e-13   Pyrus x bretschneideri [bai li]
gb|AAM91528.1|  putative casein kinase                                74.3    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548750.1|  PREDICTED: uncharacterized protein LOC100801...  76.6    1e-13   Glycine max [soybeans]
ref|XP_002325416.1|  kinase family protein                            76.6    1e-13   
ref|XP_010088042.1|  Casein kinase I isoform delta                    76.6    2e-13   
gb|KHG27523.1|  hypothetical protein F383_15264                       76.6    2e-13   Gossypium arboreum [tree cotton]
ref|XP_006297091.1|  hypothetical protein CARUB_v10013094mg           76.3    2e-13   Capsella rubella
ref|XP_010463863.1|  PREDICTED: uncharacterized protein LOC104744499  76.3    2e-13   Camelina sativa [gold-of-pleasure]
ref|NP_187044.1|  protein kinase family protein                       76.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007161937.1|  hypothetical protein PHAVU_001G110300g           76.3    2e-13   Phaseolus vulgaris [French bean]
ref|XP_010516062.1|  PREDICTED: uncharacterized protein LOC104791...  76.3    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010485760.1|  PREDICTED: uncharacterized protein LOC104764...  76.3    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002884421.1|  kinase family protein                            76.3    2e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_002281952.1|  PREDICTED: uncharacterized protein LOC100267624  76.3    2e-13   Vitis vinifera
gb|KJB80963.1|  hypothetical protein B456_013G123300                  75.9    2e-13   Gossypium raimondii
gb|KJB80965.1|  hypothetical protein B456_013G123300                  75.9    2e-13   Gossypium raimondii
gb|EPS68531.1|  hypothetical protein M569_06230                       75.9    2e-13   Genlisea aurea
ref|XP_007204249.1|  hypothetical protein PRUPE_ppa002161mg           75.9    3e-13   Prunus persica
emb|CDY42890.1|  BnaC05g47610D                                        75.9    3e-13   Brassica napus [oilseed rape]
gb|ABR25333.1|  protein kinase family protein                         71.6    3e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_006651899.1|  PREDICTED: uncharacterized protein LOC102717146  75.5    3e-13   Oryza brachyantha
ref|XP_004288418.1|  PREDICTED: uncharacterized protein LOC101290807  75.5    4e-13   Fragaria vesca subsp. vesca
ref|XP_009102089.1|  PREDICTED: uncharacterized protein LOC103828226  75.5    4e-13   Brassica rapa
emb|CDY29971.1|  BnaC01g40370D                                        75.5    4e-13   Brassica napus [oilseed rape]
gb|KDO55049.1|  hypothetical protein CISIN_1g005214mg                 75.1    4e-13   Citrus sinensis [apfelsine]
emb|CDY21155.1|  BnaA01g33860D                                        75.1    4e-13   Brassica napus [oilseed rape]
emb|CDX70801.1|  BnaC03g08850D                                        75.1    5e-13   
emb|CDY51243.1|  BnaA03g06950D                                        75.1    5e-13   Brassica napus [oilseed rape]
ref|XP_009121003.1|  PREDICTED: uncharacterized protein LOC103845859  75.1    5e-13   Brassica rapa
emb|CDY25451.1|  BnaC09g39660D                                        75.1    5e-13   Brassica napus [oilseed rape]
emb|CDY38493.1|  BnaA10g16650D                                        75.1    5e-13   Brassica napus [oilseed rape]
ref|XP_010908708.1|  PREDICTED: uncharacterized protein LOC105035016  74.7    6e-13   Elaeis guineensis
gb|KHG04306.1|  Casein kinase I-like protein                          74.7    7e-13   Gossypium arboreum [tree cotton]
ref|XP_009132256.1|  PREDICTED: uncharacterized protein LOC103856881  74.7    7e-13   Brassica rapa
ref|XP_006408240.1|  hypothetical protein EUTSA_v10020173mg           74.7    7e-13   Eutrema salsugineum [saltwater cress]
ref|XP_009130401.1|  PREDICTED: uncharacterized protein LOC103855200  74.7    8e-13   Brassica rapa
ref|XP_009126244.1|  PREDICTED: uncharacterized protein LOC103851164  74.7    8e-13   Brassica rapa
emb|CDY02641.1|  BnaC02g07940D                                        74.7    8e-13   
ref|XP_009413883.1|  PREDICTED: uncharacterized protein LOC103995100  74.3    8e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010424160.1|  PREDICTED: uncharacterized protein LOC104709208  74.3    8e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006287189.1|  hypothetical protein CARUB_v10000361mg           74.3    8e-13   Capsella rubella
ref|XP_007030718.1|  Kinase family protein                            74.3    9e-13   Theobroma cacao [chocolate]
ref|NP_001152463.1|  ATP binding protein                              74.3    9e-13   Zea mays [maize]
ref|XP_008651588.1|  PREDICTED: ATP binding protein isoform X1        74.3    9e-13   Zea mays [maize]
gb|AAO41895.1|  putative casein kinase                                72.0    1e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDY53253.1|  BnaA02g04010D                                        74.3    1e-12   Brassica napus [oilseed rape]
gb|AAF00624.1|AC009540_1  unknown protein, 5' partial                 73.6    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492820.1|  PREDICTED: uncharacterized protein LOC104770147  74.3    1e-12   Camelina sativa [gold-of-pleasure]
emb|CBI29940.3|  unnamed protein product                              73.9    1e-12   Vitis vinifera
ref|XP_008240478.1|  PREDICTED: uncharacterized protein LOC103338977  74.3    1e-12   Prunus mume [ume]
ref|XP_010558719.1|  PREDICTED: uncharacterized protein LOC104827...  74.3    1e-12   Tarenaya hassleriana [spider flower]
ref|XP_010558720.1|  PREDICTED: uncharacterized protein LOC104827...  74.3    1e-12   
gb|EAY92152.1|  hypothetical protein OsI_13865                        73.9    1e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_002873876.1|  kinase family protein                            73.9    1e-12   
ref|NP_001051531.1|  Os03g0793500                                     73.9    1e-12   
ref|XP_004955580.1|  PREDICTED: uncharacterized protein LOC101773...  73.9    1e-12   Setaria italica
dbj|BAN15568.1|  heading date 16                                      73.9    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004955583.1|  PREDICTED: uncharacterized protein LOC101773...  73.9    1e-12   Setaria italica
ref|NP_197320.1|  protein kinase                                      73.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454044.1|  PREDICTED: uncharacterized protein LOC104735873  73.9    1e-12   Camelina sativa [gold-of-pleasure]
gb|KJB82579.1|  hypothetical protein B456_013G203000                  73.9    1e-12   Gossypium raimondii
gb|KJB82583.1|  hypothetical protein B456_013G203000                  73.9    1e-12   Gossypium raimondii
ref|XP_006400366.1|  hypothetical protein EUTSA_v10012841mg           73.9    1e-12   Eutrema salsugineum [saltwater cress]
gb|ADE77861.1|  unknown                                               70.5    2e-12   Picea sitchensis
gb|ABF99312.1|  protein kinase family protein, putative, expressed    73.2    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010276388.1|  PREDICTED: uncharacterized protein LOC104611151  73.6    2e-12   
ref|XP_010257690.1|  PREDICTED: uncharacterized protein LOC104597684  73.6    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_008805378.1|  PREDICTED: uncharacterized protein LOC103718369  73.6    2e-12   Phoenix dactylifera
ref|XP_003557523.1|  PREDICTED: uncharacterized protein LOC100821235  73.2    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_007024286.1|  Casein kinase I protein isoform 3                73.2    2e-12   
gb|ACN36158.1|  unknown                                               73.2    2e-12   Zea mays [maize]
dbj|BAJ93086.1|  predicted protein                                    73.2    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001152101.1|  LOC100285738                                     73.2    2e-12   Zea mays [maize]
gb|ADE75678.1|  unknown                                               70.5    2e-12   Picea sitchensis
ref|NP_001183608.1|  uncharacterized protein LOC100502202             69.7    2e-12   
gb|KGN62809.1|  hypothetical protein Csa_2G373520                     72.8    3e-12   Cucumis sativus [cucumbers]
ref|XP_008445007.1|  PREDICTED: uncharacterized protein LOC103488176  72.8    3e-12   Cucumis melo [Oriental melon]
ref|XP_004148393.1|  PREDICTED: uncharacterized protein LOC101218249  72.8    3e-12   
ref|XP_010228600.1|  PREDICTED: uncharacterized protein LOC100829940  72.8    3e-12   
ref|XP_006842223.1|  hypothetical protein AMTR_s00078p00181940        72.4    4e-12   
ref|XP_003526502.1|  PREDICTED: uncharacterized protein LOC100800...  72.0    5e-12   Glycine max [soybeans]
emb|CDP13154.1|  unnamed protein product                              72.0    6e-12   Coffea canephora [robusta coffee]
ref|XP_002283957.2|  PREDICTED: uncharacterized protein LOC100253221  72.0    6e-12   Vitis vinifera
ref|NP_001058996.1|  Os07g0171300                                     72.0    6e-12   
gb|KHN18151.1|  Casein kinase I like 2                                71.6    6e-12   Glycine soja [wild soybean]
emb|CAN77676.1|  hypothetical protein VITISV_013722                   72.0    6e-12   Vitis vinifera
gb|ADI78885.1|  casein kinase I                                       72.0    6e-12   Sesamum indicum [beniseed]
ref|XP_010062521.1|  PREDICTED: uncharacterized protein LOC104449912  72.0    6e-12   Eucalyptus grandis [rose gum]
ref|XP_011081763.1|  PREDICTED: uncharacterized protein LOC105164726  71.6    6e-12   Sesamum indicum [beniseed]
ref|XP_007225173.1|  hypothetical protein PRUPE_ppa002269mg           71.6    7e-12   Prunus persica
ref|XP_006657490.1|  PREDICTED: uncharacterized protein LOC102719500  72.0    7e-12   Oryza brachyantha
ref|XP_011072424.1|  PREDICTED: serine/threonine-protein kinase S...  72.0    7e-12   Sesamum indicum [beniseed]
ref|XP_011072423.1|  PREDICTED: serine/threonine-protein kinase S...  72.0    7e-12   Sesamum indicum [beniseed]
ref|XP_010472589.1|  PREDICTED: uncharacterized protein LOC104752210  69.3    7e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010102418.1|  Casein kinase I-2-like protein                   71.6    7e-12   
ref|XP_007024284.1|  Casein kinase I protein isoform 1                71.6    7e-12   
gb|KHF98002.1|  hypothetical protein F383_12939                       71.6    7e-12   Gossypium arboreum [tree cotton]
gb|KDP33655.1|  hypothetical protein JCGZ_07226                       71.6    7e-12   Jatropha curcas
gb|KHG03332.1|  hypothetical protein F383_28165                       71.6    7e-12   Gossypium arboreum [tree cotton]
ref|XP_003531651.1|  PREDICTED: uncharacterized protein LOC100799630  71.6    7e-12   Glycine max [soybeans]
gb|KDP40868.1|  hypothetical protein JCGZ_24867                       71.6    8e-12   Jatropha curcas
ref|XP_006583050.1|  PREDICTED: uncharacterized protein LOC100800869  71.6    8e-12   Glycine max [soybeans]
gb|KJB54779.1|  hypothetical protein B456_009G048800                  71.6    8e-12   Gossypium raimondii
gb|KJB54778.1|  hypothetical protein B456_009G048800                  71.2    8e-12   Gossypium raimondii
ref|XP_002272679.2|  PREDICTED: serine/threonine-protein kinase S...  71.6    8e-12   Vitis vinifera
ref|XP_008378069.1|  PREDICTED: uncharacterized protein LOC103441148  71.6    8e-12   
ref|XP_006340257.1|  PREDICTED: uncharacterized protein LOC102583902  71.6    8e-12   Solanum tuberosum [potatoes]
ref|XP_008220112.1|  PREDICTED: uncharacterized protein LOC103320244  71.6    8e-12   Prunus mume [ume]
ref|XP_004291170.1|  PREDICTED: uncharacterized protein LOC101299149  71.6    8e-12   Fragaria vesca subsp. vesca
gb|AAC42254.1|  unknown protein                                       69.3    8e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010668618.1|  PREDICTED: uncharacterized protein LOC104885660  71.6    8e-12   
ref|XP_004155952.1|  PREDICTED: uncharacterized protein LOC101230855  71.6    8e-12   
ref|XP_004141661.1|  PREDICTED: uncharacterized protein LOC101213589  71.6    8e-12   Cucumis sativus [cucumbers]
gb|KGN45587.1|  hypothetical protein Csa_7G452910                     71.6    8e-12   Cucumis sativus [cucumbers]
ref|XP_002515975.1|  casein kinase, putative                          71.6    8e-12   
ref|XP_004251171.2|  PREDICTED: uncharacterized protein LOC101245026  71.6    8e-12   Solanum lycopersicum
gb|KHN39248.1|  Casein kinase I isoform delta-like                    71.2    9e-12   Glycine soja [wild soybean]
ref|XP_007135639.1|  hypothetical protein PHAVU_010G145900g           71.6    9e-12   Phaseolus vulgaris [French bean]
gb|KHG14825.1|  hypothetical protein F383_08945                       71.6    9e-12   Gossypium arboreum [tree cotton]
gb|KJB46016.1|  hypothetical protein B456_007G343500                  71.2    9e-12   Gossypium raimondii
gb|KHG22911.1|  Casein kinase I                                       71.2    9e-12   Gossypium arboreum [tree cotton]
ref|XP_009418950.1|  PREDICTED: uncharacterized protein LOC103999...  71.2    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418951.1|  PREDICTED: uncharacterized protein LOC103999...  71.2    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB56821.1|  hypothetical protein B456_009G137100                  71.2    1e-11   Gossypium raimondii
emb|CBI20566.3|  unnamed protein product                              71.2    1e-11   Vitis vinifera
ref|XP_004981469.1|  PREDICTED: uncharacterized protein LOC101783...  71.2    1e-11   
emb|CBI36074.3|  unnamed protein product                              71.2    1e-11   Vitis vinifera
emb|CDP08183.1|  unnamed protein product                              71.2    1e-11   Coffea canephora [robusta coffee]
gb|KHG18897.1|  Casein kinase I                                       71.2    1e-11   Gossypium arboreum [tree cotton]
ref|XP_010047289.1|  PREDICTED: uncharacterized protein LOC104436263  71.2    1e-11   Eucalyptus grandis [rose gum]
ref|XP_010267169.1|  PREDICTED: uncharacterized protein LOC104604...  71.2    1e-11   Nelumbo nucifera [Indian lotus]
ref|XP_008352012.1|  PREDICTED: uncharacterized protein LOC103415457  71.2    1e-11   
ref|XP_010267167.1|  PREDICTED: uncharacterized protein LOC104604...  71.2    1e-11   
ref|XP_008462429.1|  PREDICTED: uncharacterized protein LOC103500783  71.2    1e-11   Cucumis melo [Oriental melon]
ref|XP_004491691.1|  PREDICTED: serine/threonine-protein kinase V...  71.2    1e-11   Cicer arietinum [garbanzo]
gb|KHN24964.1|  Casein kinase I isoform alpha                         71.2    1e-11   Glycine soja [wild soybean]
ref|XP_002324211.2|  hypothetical protein POPTR_0018s08230g           71.2    1e-11   
gb|KJB07483.1|  hypothetical protein B456_001G026300                  70.9    1e-11   Gossypium raimondii
ref|XP_004253105.1|  PREDICTED: uncharacterized protein LOC101244359  71.2    1e-11   
gb|KJB82881.1|  hypothetical protein B456_013G219500                  70.9    1e-11   Gossypium raimondii
ref|XP_011006418.1|  PREDICTED: uncharacterized protein LOC105112417  71.2    1e-11   Populus euphratica
ref|XP_010915404.1|  PREDICTED: uncharacterized protein LOC105040538  71.2    1e-11   Elaeis guineensis
ref|XP_009367436.1|  PREDICTED: uncharacterized protein LOC103957076  70.9    1e-11   Pyrus x bretschneideri [bai li]
gb|KJB07478.1|  hypothetical protein B456_001G026300                  70.9    1e-11   Gossypium raimondii
ref|XP_007012164.1|  Casein kinase I protein                          70.9    1e-11   
gb|KDO79859.1|  hypothetical protein CISIN_1g005420mg                 70.9    1e-11   Citrus sinensis [apfelsine]
ref|XP_002458472.1|  hypothetical protein SORBIDRAFT_03g034330        66.6    1e-11   
ref|XP_006476018.1|  PREDICTED: uncharacterized protein LOC102627...  70.9    1e-11   Citrus sinensis [apfelsine]
ref|XP_006450715.1|  hypothetical protein CICLE_v10007635mg           70.9    1e-11   
gb|KJB07481.1|  hypothetical protein B456_001G026300                  70.5    1e-11   Gossypium raimondii
ref|XP_004517304.1|  PREDICTED: uncharacterized protein LOC101495334  70.9    1e-11   
ref|XP_003621013.1|  Casein kinase I isoform alpha                    70.9    1e-11   Medicago truncatula
ref|XP_008367866.1|  PREDICTED: casein kinase I                       70.5    1e-11   
ref|XP_006853659.1|  hypothetical protein AMTR_s00056p00104010        70.9    1e-11   Amborella trichopoda
ref|XP_007139114.1|  hypothetical protein PHAVU_008G002500g           70.9    1e-11   Phaseolus vulgaris [French bean]
ref|XP_009776610.1|  PREDICTED: uncharacterized protein LOC104226336  70.9    1e-11   Nicotiana sylvestris
ref|XP_009587685.1|  PREDICTED: uncharacterized protein LOC104085378  70.9    2e-11   
ref|NP_001044393.1|  Os01g0772600                                     70.9    2e-11   
ref|XP_003552750.1|  PREDICTED: serine/threonine-protein kinase V...  70.9    2e-11   Glycine max [soybeans]
ref|XP_003532324.1|  PREDICTED: serine/threonine-protein kinase V...  70.5    2e-11   Glycine max [soybeans]
ref|XP_006342517.1|  PREDICTED: uncharacterized protein LOC102599332  70.9    2e-11   Solanum tuberosum [potatoes]
emb|CDY50866.1|  BnaA05g37270D                                        70.9    2e-11   Brassica napus [oilseed rape]
ref|XP_002516524.1|  casein kinase, putative                          70.5    2e-11   
ref|XP_003523750.1|  PREDICTED: uncharacterized protein LOC100778...  70.5    2e-11   Glycine max [soybeans]
ref|XP_003523751.1|  PREDICTED: uncharacterized protein LOC100779...  70.5    2e-11   Glycine max [soybeans]
gb|EYU21509.1|  hypothetical protein MIMGU_mgv1a002137mg              70.5    2e-11   Erythranthe guttata [common monkey flower]
gb|KJB70401.1|  hypothetical protein B456_011G072100                  70.5    2e-11   Gossypium raimondii
ref|XP_006849555.1|  hypothetical protein AMTR_s00024p00176520        70.5    2e-11   Amborella trichopoda
gb|KDO79864.1|  hypothetical protein CISIN_1g005420mg                 70.1    2e-11   Citrus sinensis [apfelsine]
gb|KDP34168.1|  hypothetical protein JCGZ_07739                       70.5    2e-11   Jatropha curcas
gb|KHN10182.1|  Casein kinase I like 2                                70.1    2e-11   Glycine soja [wild soybean]
ref|XP_010098134.1|  Casein kinase I-2-like protein                   70.5    2e-11   Morus notabilis
ref|XP_010033842.1|  PREDICTED: uncharacterized protein LOC104423081  70.5    2e-11   
ref|XP_009596024.1|  PREDICTED: uncharacterized protein LOC104092197  70.5    2e-11   Nicotiana tomentosiformis
ref|XP_002514324.1|  casein kinase, putative                          70.1    2e-11   Ricinus communis
ref|XP_009787105.1|  PREDICTED: uncharacterized protein LOC104235125  70.1    2e-11   Nicotiana sylvestris
ref|XP_007161527.1|  hypothetical protein PHAVU_001G076900g           70.1    2e-11   Phaseolus vulgaris [French bean]
ref|XP_008794114.1|  PREDICTED: uncharacterized protein LOC103710237  70.1    2e-11   Phoenix dactylifera
gb|EEC71557.1|  hypothetical protein OsI_03913                        70.1    3e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_009801165.1|  PREDICTED: uncharacterized protein LOC104246947  70.1    3e-11   Nicotiana sylvestris
ref|XP_009592153.1|  PREDICTED: uncharacterized protein LOC104089043  70.1    3e-11   Nicotiana tomentosiformis
ref|XP_008791563.1|  PREDICTED: uncharacterized protein LOC103708420  70.1    3e-11   Phoenix dactylifera
gb|EEC78673.1|  hypothetical protein OsI_18806                        69.7    3e-11   Oryza sativa Indica Group [Indian rice]
dbj|BAG92829.1|  unnamed protein product                              69.7    3e-11   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ90552.1|  predicted protein                                    70.1    3e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAT44311.1|  putative casein kinase                                69.7    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006293796.1|  hypothetical protein CARUB_v10022778mg           69.7    3e-11   
emb|CDY21505.1|  BnaC03g26920D                                        69.7    3e-11   Brassica napus [oilseed rape]
ref|XP_008228435.1|  PREDICTED: uncharacterized protein LOC103327845  69.7    3e-11   Prunus mume [ume]
ref|XP_006408871.1|  hypothetical protein EUTSA_v10001925mg           69.7    3e-11   Eutrema salsugineum [saltwater cress]
ref|XP_010249770.1|  PREDICTED: uncharacterized protein LOC104592236  69.7    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010526089.1|  PREDICTED: casein kinase I-like                  69.7    3e-11   Tarenaya hassleriana [spider flower]
ref|XP_010546534.1|  PREDICTED: uncharacterized protein LOC104818596  69.7    3e-11   Tarenaya hassleriana [spider flower]
gb|AAP80674.1|  casein kinase-like protein                            65.9    3e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010656334.1|  PREDICTED: uncharacterized protein LOC100254414  69.7    3e-11   Vitis vinifera
gb|EYU29288.1|  hypothetical protein MIMGU_mgv1a002190mg              69.7    3e-11   Erythranthe guttata [common monkey flower]
ref|XP_003569928.1|  PREDICTED: uncharacterized protein LOC100845295  69.7    3e-11   Brachypodium distachyon [annual false brome]
gb|AES58679.2|  casein kinase I-like protein                          69.7    4e-11   Medicago truncatula
ref|XP_003592802.1|  Casein kinase-like protein                       69.7    4e-11   Medicago truncatula
ref|XP_008380865.1|  PREDICTED: uncharacterized protein LOC103443751  69.7    4e-11   
ref|XP_010925551.1|  PREDICTED: uncharacterized protein LOC105048062  69.7    4e-11   Elaeis guineensis
ref|XP_010516137.1|  PREDICTED: uncharacterized protein LOC104791...  69.7    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010485763.1|  PREDICTED: uncharacterized protein LOC104764...  69.7    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009353558.1|  PREDICTED: uncharacterized protein LOC103944824  69.7    4e-11   
ref|XP_011092199.1|  PREDICTED: uncharacterized protein LOC105172435  69.7    4e-11   Sesamum indicum [beniseed]
ref|XP_008655390.1|  PREDICTED: uncharacterized protein LOC100502...  69.7    4e-11   
ref|XP_010249521.1|  PREDICTED: uncharacterized protein LOC104592...  69.3    4e-11   Nelumbo nucifera [Indian lotus]
ref|XP_006426889.1|  hypothetical protein CICLE_v10025028mg           69.3    4e-11   Citrus clementina [clementine]
ref|XP_009406168.1|  PREDICTED: uncharacterized protein LOC103989128  69.3    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010249522.1|  PREDICTED: uncharacterized protein LOC104592...  69.3    4e-11   Nelumbo nucifera [Indian lotus]
ref|XP_006465683.1|  PREDICTED: uncharacterized protein LOC102607770  69.3    4e-11   Citrus sinensis [apfelsine]
gb|EEC71464.1|  hypothetical protein OsI_03705                        69.3    5e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_006644782.1|  PREDICTED: uncharacterized protein LOC102714869  69.3    5e-11   Oryza brachyantha
ref|XP_011013374.1|  PREDICTED: uncharacterized protein LOC105117...  69.3    5e-11   Populus euphratica
ref|XP_011013373.1|  PREDICTED: uncharacterized protein LOC105117...  69.3    5e-11   Populus euphratica
gb|KFK32550.1|  hypothetical protein AALP_AA6G257400                  69.3    5e-11   Arabis alpina [alpine rockcress]
emb|CBI28086.3|  unnamed protein product                              69.3    5e-11   Vitis vinifera
emb|CDO97984.1|  unnamed protein product                              68.9    5e-11   Coffea canephora [robusta coffee]
ref|XP_002303307.2|  hypothetical protein POPTR_0003s04820g           68.9    5e-11   
ref|NP_001054881.2|  Os05g0200500                                     69.3    5e-11   
gb|KIY93350.1|  hypothetical protein MNEG_14612                       65.1    5e-11   Monoraphidium neglectum
gb|EMT25395.1|  Casein kinase I-2-like protein                        68.9    5e-11   
gb|EMS66552.1|  Casein kinase I-like protein 2                        68.9    5e-11   Triticum urartu
ref|XP_010472590.1|  PREDICTED: uncharacterized protein LOC104752211  68.9    5e-11   
ref|XP_011013372.1|  PREDICTED: uncharacterized protein LOC105117...  68.6    5e-11   Populus euphratica
ref|XP_002309535.1|  kinase family protein                            68.9    6e-11   
dbj|BAD87518.1|  putative serine/threonine protein kinase             68.9    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010417348.1|  PREDICTED: uncharacterized protein LOC104703...  68.9    6e-11   Camelina sativa [gold-of-pleasure]
ref|XP_004969923.1|  PREDICTED: uncharacterized protein LOC101760429  68.9    6e-11   
ref|XP_011013369.1|  PREDICTED: uncharacterized protein LOC105117...  68.6    6e-11   Populus euphratica
gb|ADE76410.1|  unknown                                               68.6    6e-11   Picea sitchensis
ref|XP_010417347.1|  PREDICTED: uncharacterized protein LOC104703...  68.9    6e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010429582.1|  PREDICTED: uncharacterized protein LOC104714043  68.9    6e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009416478.1|  PREDICTED: uncharacterized protein LOC103997068  68.9    6e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009117039.1|  PREDICTED: casein kinase I                       68.9    6e-11   Brassica rapa
ref|XP_006644695.1|  PREDICTED: casein kinase I homolog 1-like        68.9    6e-11   
gb|KHN37292.1|  Casein kinase I                                       68.9    6e-11   Glycine soja [wild soybean]
ref|NP_001044224.1|  Os01g0744300                                     68.9    6e-11   
emb|CDX76739.1|  BnaC08g33250D                                        68.9    6e-11   
ref|XP_011003700.1|  PREDICTED: uncharacterized protein LOC105110375  68.9    6e-11   Populus euphratica
gb|EMT21659.1|  Casein kinase I-RAG8-like protein                     68.9    6e-11   
ref|XP_003536792.1|  PREDICTED: uncharacterized protein LOC100783819  68.9    6e-11   Glycine max [soybeans]
gb|EEE55368.1|  hypothetical protein OsJ_03423                        68.9    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002466312.1|  hypothetical protein SORBIDRAFT_01g005460        68.9    6e-11   Sorghum bicolor [broomcorn]
ref|NP_180147.2|  protein kinase family protein                       68.9    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973532.1|  protein kinase family protein                       68.9    7e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KHN27094.1|  Casein kinase I                                       68.9    7e-11   Glycine soja [wild soybean]
ref|XP_011019579.1|  PREDICTED: casein kinase I homolog 1-like is...  68.9    7e-11   Populus euphratica
dbj|BAJ99167.1|  predicted protein                                    68.9    7e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003556554.1|  PREDICTED: uncharacterized protein LOC100807373  68.9    7e-11   Glycine max [soybeans]
ref|XP_002880706.1|  kinase family protein                            68.9    7e-11   
ref|XP_004970128.1|  PREDICTED: uncharacterized protein LOC101772174  68.9    7e-11   Setaria italica
ref|XP_009349728.1|  PREDICTED: uncharacterized protein LOC103941...  68.9    7e-11   
ref|XP_004302863.1|  PREDICTED: uncharacterized protein LOC101305860  68.6    8e-11   Fragaria vesca subsp. vesca
ref|XP_009349729.1|  PREDICTED: uncharacterized protein LOC103941...  68.6    8e-11   Pyrus x bretschneideri [bai li]
ref|XP_002298239.1|  hypothetical protein POPTR_0001s18990g           68.6    8e-11   
gb|EMS51431.1|  Casein kinase I isoform beta                          68.6    9e-11   
ref|XP_003565003.1|  PREDICTED: uncharacterized protein LOC100839189  68.6    9e-11   
ref|XP_008810650.1|  PREDICTED: uncharacterized protein LOC103722...  68.6    9e-11   
ref|XP_008810649.1|  PREDICTED: uncharacterized protein LOC103722...  68.6    9e-11   
gb|AET01488.2|  casein kinase I-like protein                          68.6    9e-11   
ref|XP_008392669.1|  PREDICTED: uncharacterized protein LOC103454855  68.6    9e-11   
ref|XP_011019588.1|  PREDICTED: uncharacterized protein LOC105122...  68.2    9e-11   
dbj|BAK02283.1|  predicted protein                                    68.2    9e-11   
emb|CDM84047.1|  unnamed protein product                              68.2    1e-10   
ref|XP_010672056.1|  PREDICTED: uncharacterized protein LOC104888...  68.6    1e-10   
ref|XP_008655737.1|  PREDICTED: uncharacterized protein LOC103634938  67.0    1e-10   
ref|XP_007137240.1|  hypothetical protein PHAVU_009G111300g           68.6    1e-10   
ref|XP_010924661.1|  PREDICTED: uncharacterized protein LOC105047...  68.2    1e-10   
ref|XP_010915613.1|  PREDICTED: uncharacterized protein LOC105040...  68.2    1e-10   
ref|XP_010924659.1|  PREDICTED: uncharacterized protein LOC105047...  68.2    1e-10   
ref|XP_010915579.1|  PREDICTED: uncharacterized protein LOC105040...  68.2    1e-10   
emb|CDY11509.1|  BnaA09g40750D                                        67.8    1e-10   
ref|XP_002979683.1|  hypothetical protein SELMODRAFT_177864           67.8    1e-10   
ref|XP_008804603.1|  PREDICTED: negative regulator of sexual conj...  67.8    1e-10   
ref|XP_008804602.1|  PREDICTED: uncharacterized protein LOC103717...  68.2    1e-10   
ref|XP_008804601.1|  PREDICTED: uncharacterized protein LOC103717...  68.2    1e-10   
ref|XP_010552201.1|  PREDICTED: serine/threonine-protein kinase s...  68.2    1e-10   
ref|XP_003568762.1|  PREDICTED: uncharacterized protein LOC100825718  67.8    1e-10   
ref|XP_003627012.1|  Casein kinase-like protein                       68.2    1e-10   
ref|XP_002985391.1|  hypothetical protein SELMODRAFT_269002           67.8    1e-10   
ref|XP_009413490.1|  PREDICTED: uncharacterized protein LOC103994778  67.8    2e-10   
ref|XP_009382978.1|  PREDICTED: uncharacterized protein LOC103970784  67.8    2e-10   
ref|XP_007217013.1|  hypothetical protein PRUPE_ppa002136mg           67.4    2e-10   
gb|EMS54400.1|  Casein kinase I-like protein 2                        67.8    2e-10   
ref|XP_002440770.1|  hypothetical protein SORBIDRAFT_09g006270        67.4    2e-10   
ref|XP_010542444.1|  PREDICTED: serine/threonine-protein kinase S...  67.4    2e-10   
ref|XP_004968538.1|  PREDICTED: casein kinase I-like                  67.4    2e-10   
ref|XP_009388687.1|  PREDICTED: casein kinase I isoform delta-like    67.4    2e-10   
ref|XP_010534909.1|  PREDICTED: serine/threonine-protein kinase S...  67.4    2e-10   
gb|KJB54170.1|  hypothetical protein B456_009G024100                  67.4    2e-10   
ref|XP_009395056.1|  PREDICTED: uncharacterized protein LOC103980...  67.4    2e-10   
gb|KHG22741.1|  Casein kinase I isoform delta                         67.4    2e-10   
ref|XP_009395055.1|  PREDICTED: uncharacterized protein LOC103980...  67.4    2e-10   
ref|XP_010257513.1|  PREDICTED: uncharacterized protein LOC104597586  67.4    2e-10   
ref|XP_004510300.1|  PREDICTED: uncharacterized protein LOC101511720  67.4    2e-10   
ref|XP_002960894.1|  hypothetical protein SELMODRAFT_139482           67.0    3e-10   
ref|XP_001764211.1|  predicted protein                                67.0    3e-10   
ref|XP_002967119.1|  hypothetical protein SELMODRAFT_144765           67.0    3e-10   
ref|XP_002455001.1|  hypothetical protein SORBIDRAFT_03g002790        67.0    3e-10   
ref|XP_004960930.1|  PREDICTED: uncharacterized protein LOC101765228  67.0    3e-10   
ref|XP_011458971.1|  PREDICTED: uncharacterized protein LOC101301711  67.0    3e-10   
ref|XP_001770883.1|  predicted protein                                66.6    3e-10   
ref|XP_003569789.1|  PREDICTED: serine/threonine-protein kinase VRK1  66.6    4e-10   
ref|XP_010243375.1|  PREDICTED: uncharacterized protein LOC104587456  66.6    4e-10   
ref|NP_001169571.1|  hypothetical protein                             66.6    4e-10   
ref|XP_010936996.1|  PREDICTED: casein kinase I isoform gamma-1-l...  66.6    4e-10   
ref|XP_010936995.1|  PREDICTED: casein kinase I isoform gamma-1-l...  66.6    4e-10   
ref|XP_005850218.1|  hypothetical protein CHLNCDRAFT_34546            66.6    4e-10   
ref|XP_002531638.1|  casein kinase, putative                          66.6    4e-10   
gb|EMT27276.1|  Casein kinase I-2-like protein                        66.6    4e-10   
tpg|DAA54811.1|  TPA: hypothetical protein ZEAMMB73_098757            63.5    5e-10   
ref|XP_007014775.1|  Kinase family protein isoform 2                  66.2    6e-10   
ref|XP_010690200.1|  PREDICTED: casein kinase I isoform gamma-2-like  66.2    6e-10   
gb|KDP44321.1|  hypothetical protein JCGZ_19188                       66.2    6e-10   
ref|XP_002283346.1|  PREDICTED: uncharacterized protein LOC100263956  66.2    6e-10   
ref|XP_008390151.1|  PREDICTED: uncharacterized protein LOC103452441  65.9    7e-10   
ref|XP_009364099.1|  PREDICTED: uncharacterized protein LOC103954016  65.9    7e-10   
emb|CAN69523.1|  hypothetical protein VITISV_040873                   65.9    7e-10   
ref|XP_008338505.1|  PREDICTED: uncharacterized protein LOC103401...  65.9    7e-10   
ref|XP_009375296.1|  PREDICTED: uncharacterized protein LOC103964127  65.9    7e-10   
ref|XP_008338507.1|  PREDICTED: uncharacterized protein LOC103401...  65.9    7e-10   
dbj|BAJ94407.1|  predicted protein                                    65.9    7e-10   
emb|CBI16476.3|  unnamed protein product                              65.9    7e-10   
ref|XP_004162011.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.9    7e-10   
ref|XP_004142151.1|  PREDICTED: uncharacterized protein LOC101213194  65.9    7e-10   
ref|XP_007208054.1|  hypothetical protein PRUPE_ppa002206mg           65.9    7e-10   
emb|CDM82151.1|  unnamed protein product                              65.9    7e-10   
gb|EYU39997.1|  hypothetical protein MIMGU_mgv1a002328mg              65.9    7e-10   
ref|XP_008797939.1|  PREDICTED: uncharacterized protein LOC103712...  65.9    8e-10   
ref|XP_008797930.1|  PREDICTED: uncharacterized protein LOC103712...  65.9    8e-10   
ref|XP_008797922.1|  PREDICTED: uncharacterized protein LOC103712...  65.9    8e-10   
ref|XP_009404157.1|  PREDICTED: uncharacterized protein LOC103987553  65.9    8e-10   
ref|XP_008797915.1|  PREDICTED: uncharacterized protein LOC103712...  65.9    8e-10   
ref|XP_002304015.1|  kinase family protein                            65.9    8e-10   
ref|XP_006643875.1|  PREDICTED: casein kinase I homolog 2-like        65.5    8e-10   
ref|XP_007014774.1|  Casein kinase I protein isoform 1                65.9    8e-10   
ref|XP_008351086.1|  PREDICTED: uncharacterized protein LOC103414488  65.1    9e-10   
ref|XP_002297651.2|  hypothetical protein POPTR_0001s04710g           65.5    9e-10   
gb|KJB21850.1|  hypothetical protein B456_004G018100                  65.5    9e-10   
ref|XP_004294964.1|  PREDICTED: uncharacterized protein LOC101294343  65.5    9e-10   
dbj|BAD73224.1|  putative serine/threonine protein kinase             64.3    9e-10   
ref|XP_008338530.1|  PREDICTED: casein kinase I homolog 2-like        65.1    9e-10   
ref|XP_008787870.1|  PREDICTED: uncharacterized protein LOC103705792  65.5    1e-09   
ref|XP_010093160.1|  Casein kinase I                                  65.5    1e-09   
gb|KEH36077.1|  casein kinase I-like protein                          65.5    1e-09   
ref|XP_011025189.1|  PREDICTED: uncharacterized protein LOC105126132  65.5    1e-09   
ref|XP_011037977.1|  PREDICTED: uncharacterized protein LOC105135003  65.5    1e-09   
ref|XP_006445886.1|  hypothetical protein CICLE_v10014444mg           65.5    1e-09   
ref|XP_004497365.1|  PREDICTED: casein kinase I isoform delta-like    65.1    1e-09   
tpg|DAA52911.1|  TPA: hypothetical protein ZEAMMB73_402791            64.7    1e-09   
ref|XP_008673563.1|  PREDICTED: uncharacterized protein LOC103649...  65.1    1e-09   
ref|XP_008673564.1|  PREDICTED: casein kinase I isoform X2            65.1    1e-09   
ref|XP_010939947.1|  PREDICTED: uncharacterized protein LOC105058...  65.1    1e-09   
ref|XP_010939945.1|  PREDICTED: uncharacterized protein LOC105058...  65.1    1e-09   
ref|XP_002884419.1|  hypothetical protein ARALYDRAFT_340552           63.2    1e-09   
gb|EEE54054.1|  hypothetical protein OsJ_00747                        64.7    2e-09   
gb|KJB27133.1|  hypothetical protein B456_004G279600                  64.7    2e-09   
ref|XP_007013209.1|  Kinase family protein isoform 5                  64.3    2e-09   
ref|XP_004252842.1|  PREDICTED: casein kinase I-like                  64.3    2e-09   
ref|XP_001701465.1|  MUT9-related serine/threonine protein kinase     64.3    2e-09   
dbj|BAD73223.1|  putative serine/threonine protein kinase             64.3    2e-09   
ref|NP_001042306.1|  Os01g0198200                                     64.3    2e-09   
gb|KJB54173.1|  hypothetical protein B456_009G024100                  64.7    2e-09   
gb|EMT06030.1|  Casein kinase I-2-like protein                        64.3    2e-09   
gb|EEC70115.1|  hypothetical protein OsI_00774                        64.3    2e-09   
tpg|DAA54810.1|  TPA: hypothetical protein ZEAMMB73_098757            63.2    2e-09   
ref|XP_007013205.1|  Kinase family protein isoform 1                  64.3    2e-09   
ref|XP_002954481.1|  hypothetical protein VOLCADRAFT_76324            64.3    2e-09   
gb|KDO50862.1|  hypothetical protein CISIN_1g005947mg                 64.3    3e-09   
ref|XP_010673525.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  64.3    3e-09   
ref|XP_005649643.1|  MUT9-related serine/threonine protein kinase     63.9    3e-09   
gb|EMS55588.1|  Casein kinase I-like protein 2                        63.9    3e-09   
tpg|DAA54809.1|  TPA: hypothetical protein ZEAMMB73_098757            63.2    3e-09   
ref|XP_006451129.1|  hypothetical protein CICLE_v10007666mg           63.9    3e-09   
gb|KJB21848.1|  hypothetical protein B456_004G018000                  63.9    3e-09   
emb|CEG01140.1|  Serine/threonine-protein kinase, active site         63.9    3e-09   
ref|XP_010500967.1|  PREDICTED: uncharacterized protein LOC104778...  63.2    3e-09   
ref|XP_011396021.1|  Casein kinase I isoform delta-like protein       63.5    4e-09   
gb|ACO87665.1|  protein kinase                                        63.9    4e-09   
ref|XP_006407187.1|  hypothetical protein EUTSA_v10020172mg           63.9    4e-09   
ref|XP_009781261.1|  PREDICTED: casein kinase I isoform gamma-3       63.9    4e-09   
ref|XP_001416335.1|  predicted protein                                63.5    4e-09   
gb|EPS63371.1|  hypothetical protein M569_11412                       62.0    4e-09   
ref|XP_003577056.1|  PREDICTED: uncharacterized protein LOC100836999  63.5    4e-09   
ref|XP_009625624.1|  PREDICTED: casein kinase I isoform gamma-3-like  63.5    4e-09   
ref|XP_006354169.1|  PREDICTED: casein kinase I isoform gamma-3-like  63.5    4e-09   
ref|XP_003075213.1|  protein kinase family protein (ISS)              63.5    4e-09   
ref|XP_004228598.1|  PREDICTED: casein kinase I isoform gamma-3       63.5    4e-09   
ref|XP_009135319.1|  PREDICTED: uncharacterized protein LOC103859531  63.5    4e-09   
emb|CDX75726.1|  BnaC03g38090D                                        63.5    4e-09   
ref|NP_187977.1|  protein kinase family protein                       63.5    4e-09   
emb|CDY23629.1|  BnaC05g39650D                                        63.2    4e-09   
emb|CDY55141.1|  BnaC01g44810D                                        63.5    5e-09   
gb|KFK38714.1|  hypothetical protein AALP_AA3G150500                  63.5    5e-09   
ref|XP_010487127.1|  PREDICTED: serine/threonine-protein kinase S...  63.5    5e-09   
ref|XP_002882838.1|  kinase family protein                            63.5    5e-09   
ref|XP_009117581.1|  PREDICTED: uncharacterized protein LOC103842673  63.2    5e-09   
emb|CDY51730.1|  BnaA01g37130D                                        63.2    5e-09   
ref|XP_009146466.1|  PREDICTED: uncharacterized protein LOC103870106  63.2    5e-09   
emb|CDX97505.1|  BnaA05g25740D                                        63.2    5e-09   
emb|CDX82524.1|  BnaA03g32970D                                        63.2    5e-09   
ref|XP_010465212.1|  PREDICTED: uncharacterized protein LOC104745616  63.2    5e-09   
gb|KHG27580.1|  Casein kinase I                                       63.2    6e-09   
ref|XP_006297084.1|  hypothetical protein CARUB_v10013087mg           63.2    6e-09   
ref|XP_010500960.1|  PREDICTED: uncharacterized protein LOC104778...  63.2    6e-09   
ref|XP_002502422.1|  predicted protein                                63.2    6e-09   
ref|XP_004963353.1|  PREDICTED: probable casein kinase I homolog ...  63.2    6e-09   
ref|XP_003057011.1|  Serine/Threonine protein kinase                  63.2    6e-09   
ref|XP_008655344.1|  PREDICTED: hypothetical protein isoform X2       62.8    8e-09   
ref|XP_008655345.1|  PREDICTED: hypothetical protein isoform X3       62.8    8e-09   
ref|NP_187043.1|  protein kinase-related protein                      61.2    9e-09   
ref|XP_008655343.1|  PREDICTED: hypothetical protein isoform X1       62.4    1e-08   
ref|XP_009347166.1|  PREDICTED: uncharacterized protein LOC103938...  62.4    1e-08   
ref|XP_009336928.1|  PREDICTED: uncharacterized protein LOC103929445  62.4    1e-08   
ref|XP_009347165.1|  PREDICTED: uncharacterized protein LOC103938...  62.4    1e-08   
ref|XP_003588428.1|  Casein kinase I isoform alpha                    62.4    1e-08   
ref|XP_008386593.1|  PREDICTED: uncharacterized protein LOC103449090  62.4    1e-08   
dbj|BAJ99119.1|  predicted protein                                    62.0    1e-08   
ref|XP_010044967.1|  PREDICTED: uncharacterized protein LOC104433...  62.4    1e-08   
ref|XP_010044966.1|  PREDICTED: uncharacterized protein LOC104433...  62.4    1e-08   
ref|XP_008672449.1|  PREDICTED: uncharacterized protein LOC100273...  62.0    1e-08   
ref|NP_001141429.1|  uncharacterized protein LOC100273539             61.6    1e-08   
ref|XP_007024285.1|  Kinase family protein isoform 2                  61.6    1e-08   
gb|KDD76924.1|  hypothetical protein H632_c65p1                       61.6    2e-08   
ref|XP_007514232.1|  predicted protein                                61.6    2e-08   
ref|XP_008242613.1|  PREDICTED: uncharacterized protein LOC103340922  61.2    3e-08   
ref|XP_011400089.1|  Casein kinase I-like protein 2                   60.8    3e-08   
ref|XP_008226475.1|  PREDICTED: protein kinase 3                      60.5    5e-08   
ref|XP_005850945.1|  hypothetical protein CHLNCDRAFT_140695           59.7    6e-08   
ref|XP_007203777.1|  hypothetical protein PRUPE_ppa002378mg           60.1    7e-08   
ref|XP_002443446.1|  hypothetical protein SORBIDRAFT_08g019600        59.7    8e-08   
gb|KDD72198.1|  hypothetical protein H632_c3713p0                     58.2    8e-08   
gb|KFK37829.1|  hypothetical protein AALP_AA3G034600                  58.9    1e-07   
ref|XP_006299519.1|  hypothetical protein CARUB_v10015691mg           57.8    1e-07   
ref|XP_004309533.2|  PREDICTED: casein kinase I isoform delta-A-like  58.9    1e-07   
ref|XP_001695320.1|  serine/threonine protein kinase, transcripti...  58.9    1e-07   
gb|EPS62497.1|  hypothetical protein M569_12290                       58.5    2e-07   
ref|XP_008337442.1|  PREDICTED: uncharacterized protein LOC103400...  58.2    3e-07   
ref|XP_008337441.1|  PREDICTED: uncharacterized protein LOC103400...  58.2    3e-07   
ref|XP_002958584.1|  histone kinase                                   57.8    4e-07   
ref|XP_006574072.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...  54.3    5e-06   
ref|XP_004245392.1|  PREDICTED: uncharacterized protein LOC101249392  53.5    9e-06   
ref|XP_010090282.1|  hypothetical protein L484_001313                 52.0    1e-05   
gb|ACJ13774.1|  protein kinase family protein                         47.8    3e-05   
ref|XP_005648473.1|  kinase-like protein                              51.6    4e-05   
ref|XP_010109262.1|  hypothetical protein L484_014856                 50.1    9e-05   
ref|XP_010103948.1|  hypothetical protein L484_020200                 49.3    1e-04   
gb|ACJ13778.1|  protein kinase family protein                         45.8    1e-04   
gb|AEO89321.1|  serine/threonine protein kinase                       50.1    1e-04   
gb|ACJ13779.1|  protein kinase family protein                         44.3    6e-04   



>ref|XP_004157014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221479 
[Cucumis sativus]
Length=742

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  709  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  742



>ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 gb|KGN53942.1| Casein kinase [Cucumis sativus]
Length=708

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  675  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum]
Length=709

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  676  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709



>ref|XP_004249304.1| PREDICTED: uncharacterized protein LOC101268442 [Solanum lycopersicum]
Length=709

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  676  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709



>ref|XP_008441978.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
 ref|XP_008441979.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
Length=708

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  675  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES80844.1| casein kinase I-like protein [Medicago truncatula]
Length=708

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  675  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus 
sinensis]
 gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 gb|KDO55047.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=704

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  671  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  704



>gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata]
Length=706

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  673  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  706



>ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus 
sinensis]
 gb|KDO55048.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=708

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  675  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_009771625.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771626.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771627.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
Length=714

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  681  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  714



>gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas]
Length=705

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  672  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>ref|XP_009621585.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621586.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621587.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
Length=714

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  681  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  714



>ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica]
Length=707

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  674  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  707



>ref|XP_002525432.1| casein kinase, putative [Ricinus communis]
 gb|EEF36922.1| casein kinase, putative [Ricinus communis]
Length=705

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  672  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>emb|CDP14324.1| unnamed protein product [Coffea canephora]
Length=709

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  676  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709



>ref|XP_011078778.1| PREDICTED: uncharacterized protein LOC105162459 [Sesamum indicum]
Length=705

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  672  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>ref|XP_009615719.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615725.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615727.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615731.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
Length=708

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  675  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_011075041.1| PREDICTED: uncharacterized protein LOC105159627 [Sesamum indicum]
Length=705

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  672  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
Length=702

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  669  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  702



>gb|KHG17118.1| Casein kinase I isoform delta [Gossypium arboreum]
 gb|KHG17119.1| Casein kinase I isoform delta [Gossypium arboreum]
Length=706

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  673  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706



>gb|KJB45108.1| hypothetical protein B456_007G289500 [Gossypium raimondii]
Length=706

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  673  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706



>ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer 
arietinum]
 ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer 
arietinum]
Length=708

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  675  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_010672054.1| PREDICTED: uncharacterized protein LOC104888715 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=713

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  680  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  713



>ref|XP_009788026.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788027.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788028.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788029.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
Length=708

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  675  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri]
Length=707

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  674  QETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  707



>gb|AAM91528.1| putative casein kinase [Arabidopsis thaliana]
Length=303

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  270  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  303



>ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine 
max]
 ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine 
max]
 gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja]
Length=709

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  676  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  709



>ref|XP_002325416.1| kinase family protein [Populus trichocarpa]
 gb|EEE99797.1| kinase family protein [Populus trichocarpa]
Length=720

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  687  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  720



>ref|XP_010088042.1| Casein kinase I isoform delta [Morus notabilis]
 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis]
Length=706

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  673  QETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  706



>gb|KHG27523.1| hypothetical protein F383_15264 [Gossypium arboreum]
Length=706

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  673  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706



>ref|XP_006297091.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
 gb|EOA29989.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
Length=701

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  668  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701



>ref|XP_010463863.1| PREDICTED: uncharacterized protein LOC104744499 [Camelina sativa]
Length=701

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  668  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701



>ref|NP_187044.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAF05853.1|AC011698_4 putative casein kinase [Arabidopsis thaliana]
 gb|AEE74014.1| protein kinase family protein [Arabidopsis thaliana]
Length=701

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  668  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701



>ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
 gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
Length=708

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  675  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  708



>ref|XP_010516062.1| PREDICTED: uncharacterized protein LOC104791759 isoform X1 [Camelina 
sativa]
Length=700

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  667  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  700



>ref|XP_010485760.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485761.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485762.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
Length=701

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  668  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701



>ref|XP_002884421.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60680.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=702

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  669  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  702



>ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera]
 emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera]
Length=708

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIA+ICYGRTVC
Sbjct  675  QETLRTSAFPSTHVKEKWSKNLYIAAICYGRTVC  708



>gb|KJB80963.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80964.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80966.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=706

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  673  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTVC  706



>gb|KJB80965.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=707

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  674  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTVC  707



>gb|EPS68531.1| hypothetical protein M569_06230 [Genlisea aurea]
Length=704

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  671  QETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  704



>ref|XP_007204249.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
 gb|EMJ05448.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
Length=707

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  674  QETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  707



>emb|CDY42890.1| BnaC05g47610D [Brassica napus]
Length=700

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTH+KEKW+KNLYIASICYGRTVC
Sbjct  667  QETLRTSAFPSTHIKEKWAKNLYIASICYGRTVC  700



>gb|ABR25333.1| protein kinase family protein [Oryza sativa Indica Group]
Length=137

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  104  QETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  137



>ref|XP_006651899.1| PREDICTED: uncharacterized protein LOC102717146 [Oryza brachyantha]
Length=726

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS+FPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  693  QETLRTSSFPSTHVKEKWSKNLYIASICYGRTVC  726



>ref|XP_004288418.1| PREDICTED: uncharacterized protein LOC101290807 [Fragaria vesca 
subsp. vesca]
Length=692

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS+HVKEKWSKNLYIASIC+GRTVC
Sbjct  659  QETLRTSAFPSSHVKEKWSKNLYIASICFGRTVC  692



>ref|XP_009102089.1| PREDICTED: uncharacterized protein LOC103828226 [Brassica rapa]
Length=704

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  671  QETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  704



>emb|CDY29971.1| BnaC01g40370D [Brassica napus]
Length=703

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  670  QETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  703



>gb|KDO55049.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=537

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  504  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  537



>emb|CDY21155.1| BnaA01g33860D [Brassica napus]
Length=704

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  671  QETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  704



>emb|CDX70801.1| BnaC03g08850D [Brassica napus]
Length=684

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  651  QETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684



>emb|CDY51243.1| BnaA03g06950D [Brassica napus]
Length=684

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  651  QETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684



>ref|XP_009121003.1| PREDICTED: uncharacterized protein LOC103845859 [Brassica rapa]
Length=691

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  658  QETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  691



>emb|CDY25451.1| BnaC09g39660D [Brassica napus]
Length=690

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  657  QETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  690



>emb|CDY38493.1| BnaA10g16650D [Brassica napus]
Length=690

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  657  QETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  690



>ref|XP_010908708.1| PREDICTED: uncharacterized protein LOC105035016 [Elaeis guineensis]
Length=718

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  685  QETLRTSAFPSNHVKEKWAKNLYIASICYGRTVC  718



>gb|KHG04306.1| Casein kinase I-like protein [Gossypium arboreum]
Length=706

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLY+AS+CYGRTVC
Sbjct  673  QETLRTSAFPSTHVKEKWAKNLYLASVCYGRTVC  706



>ref|XP_009132256.1| PREDICTED: uncharacterized protein LOC103856881 [Brassica rapa]
Length=676

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  643  QETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  676



>ref|XP_006408240.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
 gb|ESQ49693.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
Length=701

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  668  QETLRTSAFPSTHVKDKWAKNLYIASICYGRTVC  701



>ref|XP_009130401.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130402.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130403.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
Length=695

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  662  QETLRTSAFPSTHVKDKWAKNLYIASICYGRTVC  695



>ref|XP_009126244.1| PREDICTED: uncharacterized protein LOC103851164 [Brassica rapa]
Length=684

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  651  QETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684



>emb|CDY02641.1| BnaC02g07940D [Brassica napus]
Length=686

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  653  QETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  686



>ref|XP_009413883.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413884.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  681  QETLRTSAFPSNHVKEKWAKNLYIASICYGRTVC  714



>ref|XP_010424160.1| PREDICTED: uncharacterized protein LOC104709208 [Camelina sativa]
Length=647

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  614  QETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  647



>ref|XP_006287189.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
 gb|EOA20087.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
Length=692

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  659  QETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692



>ref|XP_007030718.1| Kinase family protein [Theobroma cacao]
 gb|EOY11220.1| Kinase family protein [Theobroma cacao]
Length=705

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  672  QETLRTSAFPSAHVKEKWAKNLYIASICYGRTVC  705



>ref|NP_001152463.1| ATP binding protein [Zea mays]
 gb|ACG47741.1| ATP binding protein [Zea mays]
Length=704

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS+HVKEKW+KNLYIASICYGRTVC
Sbjct  671  QETLRTSAFPSSHVKEKWAKNLYIASICYGRTVC  704



>ref|XP_008651588.1| PREDICTED: ATP binding protein isoform X1 [Zea mays]
 gb|ACR36803.1| unknown [Zea mays]
 tpg|DAA59714.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA59715.1| TPA: ATP binding protein isoform 2 [Zea mays]
Length=704

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS+HVKEKW+KNLYIASICYGRTVC
Sbjct  671  QETLRTSAFPSSHVKEKWAKNLYIASICYGRTVC  704



>gb|AAO41895.1| putative casein kinase [Arabidopsis thaliana]
Length=307

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  274  QETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  307



>emb|CDY53253.1| BnaA02g04010D [Brassica napus]
Length=762

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  729  QETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  762



>gb|AAF00624.1|AC009540_1 unknown protein, 5' partial [Arabidopsis thaliana]
Length=494

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  461  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  494



>ref|XP_010492820.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
 ref|XP_010492821.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
Length=692

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  659  QETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692



>emb|CBI29940.3| unnamed protein product [Vitis vinifera]
Length=593

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVKEKWSKNLYIA+ICYGRTVC
Sbjct  560  QETLRTSAFPSTHVKEKWSKNLYIAAICYGRTVC  593



>ref|XP_008240478.1| PREDICTED: uncharacterized protein LOC103338977 [Prunus mume]
Length=707

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS+HVKEKWSKNLYIASIC+GRTVC
Sbjct  674  QETLRTSAFPSSHVKEKWSKNLYIASICHGRTVC  707



>ref|XP_010558719.1| PREDICTED: uncharacterized protein LOC104827271 isoform X1 [Tarenaya 
hassleriana]
Length=703

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  670  QETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  703



>ref|XP_010558720.1| PREDICTED: uncharacterized protein LOC104827271 isoform X2 [Tarenaya 
hassleriana]
Length=704

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  671  QETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  704



>gb|EAY92152.1| hypothetical protein OsI_13865 [Oryza sativa Indica Group]
Length=707

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  674  QETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707



>ref|XP_002873876.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50135.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=691

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  658  QETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  691



>ref|NP_001051531.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|AAO37965.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|ABF99311.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13445.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|EAZ28883.1| hypothetical protein OsJ_12923 [Oryza sativa Japonica Group]
 dbj|BAH00578.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAN15567.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  674  QETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707



>ref|XP_004955580.1| PREDICTED: uncharacterized protein LOC101773166 isoform X1 [Setaria 
italica]
 ref|XP_004955581.1| PREDICTED: uncharacterized protein LOC101773166 isoform X2 [Setaria 
italica]
 ref|XP_004955582.1| PREDICTED: uncharacterized protein LOC101773166 isoform X3 [Setaria 
italica]
Length=732

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  699  QETLRTSAFPSGHVKEKWAKNLYIASICYGRTVC  732



>dbj|BAN15568.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  674  QETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707



>ref|XP_004955583.1| PREDICTED: uncharacterized protein LOC101773166 isoform X4 [Setaria 
italica]
Length=707

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  674  QETLRTSAFPSGHVKEKWAKNLYIASICYGRTVC  707



>ref|NP_197320.1| protein kinase [Arabidopsis thaliana]
 dbj|BAB09477.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AED92517.1| protein kinase [Arabidopsis thaliana]
Length=691

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  658  QETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  691



>ref|XP_010454044.1| PREDICTED: uncharacterized protein LOC104735873 [Camelina sativa]
Length=692

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  659  QETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692



>gb|KJB82579.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=706

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVK+KW+KNLY+ASICYGRTVC
Sbjct  673  QETLRTSAFPSTHVKDKWAKNLYLASICYGRTVC  706



>gb|KJB82583.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=707

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVK+KW+KNLY+ASICYGRTVC
Sbjct  674  QETLRTSAFPSTHVKDKWAKNLYLASICYGRTVC  707



>ref|XP_006400366.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
 gb|ESQ41819.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
Length=695

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  662  QETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  695



>gb|ADE77861.1| unknown [Picea sitchensis]
Length=186

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  153  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  185



>gb|ABF99312.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=522

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  489  QETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  522



>ref|XP_010276388.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276389.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276390.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276391.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
Length=714

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV
Sbjct  681  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  713



>ref|XP_010257690.1| PREDICTED: uncharacterized protein LOC104597684 [Nelumbo nucifera]
Length=708

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV
Sbjct  675  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  707



>ref|XP_008805378.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
 ref|XP_008805379.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
Length=718

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS HVK+KW+KNLYIASICYGRTVC
Sbjct  685  QETLRTSAFPSNHVKDKWAKNLYIASICYGRTVC  718



>ref|XP_003557523.1| PREDICTED: uncharacterized protein LOC100821235 [Brachypodium 
distachyon]
Length=702

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS HVK+KW+KNLYIASICYGRTVC
Sbjct  669  QETLRTSAFPSNHVKDKWAKNLYIASICYGRTVC  702



>ref|XP_007024286.1| Casein kinase I protein isoform 3 [Theobroma cacao]
 gb|EOY26908.1| Casein kinase I protein isoform 3 [Theobroma cacao]
Length=569

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  536  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  568



>gb|ACN36158.1| unknown [Zea mays]
Length=704

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS+HVKEKW+KNLYIASIC+GRTVC
Sbjct  671  QETLRTSAFPSSHVKEKWAKNLYIASICFGRTVC  704



>dbj|BAJ93086.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=707

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS HVKEKW+KNLYIASICYGRT C
Sbjct  674  QETLRTSAFPSNHVKEKWAKNLYIASICYGRTAC  707



>ref|NP_001152101.1| LOC100285738 [Zea mays]
 ref|XP_008668149.1| PREDICTED: LOC100285738 isoform X1 [Zea mays]
 gb|ACG45775.1| ATP binding protein [Zea mays]
 tpg|DAA42572.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA42573.1| TPA: ATP binding protein isoform 2 [Zea mays]
 tpg|DAA42574.1| TPA: ATP binding protein isoform 3 [Zea mays]
Length=704

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS+HVKEKW+KNLYIASIC+GRTVC
Sbjct  671  QETLRTSAFPSSHVKEKWAKNLYIASICFGRTVC  704



>gb|ADE75678.1| unknown [Picea sitchensis]
Length=260

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKWSKNLYIA++CYGRTV
Sbjct  227  QETLRTSAFPSTHVKEKWSKNLYIAAVCYGRTV  259



>ref|NP_001183608.1| uncharacterized protein LOC100502202 [Zea mays]
 gb|ACR37739.1| unknown [Zea mays]
Length=162

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS HVKEKW+KNLYIASICYGRTV 
Sbjct  129  QETLRTSAFPSNHVKEKWAKNLYIASICYGRTVS  162



>gb|KGN62809.1| hypothetical protein Csa_2G373520 [Cucumis sativus]
Length=699

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  666  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  698



>ref|XP_008445007.1| PREDICTED: uncharacterized protein LOC103488176 [Cucumis melo]
Length=699

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  666  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  698



>ref|XP_004148393.1| PREDICTED: uncharacterized protein LOC101218249 [Cucumis sativus]
 ref|XP_004162975.1| PREDICTED: uncharacterized LOC101218249 [Cucumis sativus]
Length=695

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  662  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  694



>ref|XP_010228600.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
 ref|XP_010228605.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
Length=709

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS HVKEKW+KNLYIASICYGRT C
Sbjct  676  QETLRTSAFPSNHVKEKWAKNLYIASICYGRTAC  709



>ref|XP_006842223.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
 gb|ERN03898.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
Length=705

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKWSKNLYIAS+CYGRTV
Sbjct  672  QETLRTSAFPSTHVKEKWSKNLYIASVCYGRTV  704



>ref|XP_003526502.1| PREDICTED: uncharacterized protein LOC100800125 isoform X1 [Glycine 
max]
Length=606

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  573  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  605



>emb|CDP13154.1| unnamed protein product [Coffea canephora]
Length=601

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS FPSTHVKEKW+KNLY+AS+CYGRTVC
Sbjct  568  QETLRTSQFPSTHVKEKWAKNLYLASLCYGRTVC  601



>ref|XP_002283957.2| PREDICTED: uncharacterized protein LOC100253221 [Vitis vinifera]
Length=704

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  671  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  703



>ref|NP_001058996.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAC83610.1| putative casein kinase 1, delta isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20910.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAG89932.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81591.1| hypothetical protein OsI_25061 [Oryza sativa Indica Group]
 gb|EEE66647.1| hypothetical protein OsJ_23261 [Oryza sativa Japonica Group]
Length=699

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS HVK+KW+KNLYIASIC+GRTVC
Sbjct  666  QETLRTSAFPSNHVKDKWAKNLYIASICFGRTVC  699



>gb|KHN18151.1| Casein kinase I like 2 [Glycine soja]
Length=486

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  453  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  485



>emb|CAN77676.1| hypothetical protein VITISV_013722 [Vitis vinifera]
Length=710

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  677  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  709



>gb|ADI78885.1| casein kinase I [Sesamum indicum]
Length=710

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  677  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  709



>ref|XP_010062521.1| PREDICTED: uncharacterized protein LOC104449912 [Eucalyptus grandis]
 gb|KCW69667.1| hypothetical protein EUGRSUZ_F03069 [Eucalyptus grandis]
Length=710

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  677  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  709



>ref|XP_011081763.1| PREDICTED: uncharacterized protein LOC105164726 [Sesamum indicum]
 ref|XP_011081764.1| PREDICTED: uncharacterized protein LOC105164726 [Sesamum indicum]
 ref|XP_011081765.1| PREDICTED: uncharacterized protein LOC105164726 [Sesamum indicum]
 ref|XP_011081766.1| PREDICTED: uncharacterized protein LOC105164726 [Sesamum indicum]
 ref|XP_011081767.1| PREDICTED: uncharacterized protein LOC105164726 [Sesamum indicum]
 ref|XP_011081768.1| PREDICTED: uncharacterized protein LOC105164726 [Sesamum indicum]
Length=605

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  572  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  604



>ref|XP_007225173.1| hypothetical protein PRUPE_ppa002269mg [Prunus persica]
 gb|EMJ26372.1| hypothetical protein PRUPE_ppa002269mg [Prunus persica]
Length=693

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  660  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  692



>ref|XP_006657490.1| PREDICTED: uncharacterized protein LOC102719500 [Oryza brachyantha]
Length=702

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS HVK+KW+KNLYIASIC+GRTVC
Sbjct  669  QETLRTSAFPSNHVKDKWAKNLYIASICFGRTVC  702



>ref|XP_011072424.1| PREDICTED: serine/threonine-protein kinase STE20-like isoform 
X2 [Sesamum indicum]
Length=706

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  673  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  705



>ref|XP_011072423.1| PREDICTED: serine/threonine-protein kinase STE20-like isoform 
X1 [Sesamum indicum]
Length=710

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  677  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  709



>ref|XP_010472589.1| PREDICTED: uncharacterized protein LOC104752210 [Camelina sativa]
Length=257

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  224  QETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  256



>ref|XP_010102418.1| Casein kinase I-2-like protein [Morus notabilis]
 gb|EXB93403.1| Casein kinase I-2-like protein [Morus notabilis]
Length=703

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  670  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  702



>ref|XP_007024284.1| Casein kinase I protein isoform 1 [Theobroma cacao]
 gb|EOY26906.1| Casein kinase I protein isoform 1 [Theobroma cacao]
Length=727

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  694  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  726



>gb|KHF98002.1| hypothetical protein F383_12939 [Gossypium arboreum]
Length=668

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRT+AFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  635  QETLRTTAFPSTHVKEKWAKNLYIASICYGRTV  667



>gb|KDP33655.1| hypothetical protein JCGZ_07226 [Jatropha curcas]
Length=664

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVK+KWSKNLYIASICYGRTV
Sbjct  631  QETLRTSAFPSTHVKDKWSKNLYIASICYGRTV  663



>gb|KHG03332.1| hypothetical protein F383_28165 [Gossypium arboreum]
Length=706

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  673  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  705



>ref|XP_003531651.1| PREDICTED: uncharacterized protein LOC100799630 [Glycine max]
 gb|KHN05338.1| Casein kinase I isoform delta-like [Glycine soja]
Length=711

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  678  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  710



>gb|KDP40868.1| hypothetical protein JCGZ_24867 [Jatropha curcas]
Length=720

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  687  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  719



>ref|XP_006583050.1| PREDICTED: uncharacterized protein LOC100800869 [Glycine max]
Length=723

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  690  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  722



>gb|KJB54779.1| hypothetical protein B456_009G048800 [Gossypium raimondii]
 gb|KJB54780.1| hypothetical protein B456_009G048800 [Gossypium raimondii]
 gb|KJB54781.1| hypothetical protein B456_009G048800 [Gossypium raimondii]
Length=598

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  565  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  597



>gb|KJB54778.1| hypothetical protein B456_009G048800 [Gossypium raimondii]
Length=574

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  541  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  573



>ref|XP_002272679.2| PREDICTED: serine/threonine-protein kinase STE20 [Vitis vinifera]
Length=695

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  662  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  694



>ref|XP_008378069.1| PREDICTED: uncharacterized protein LOC103441148 [Malus domestica]
Length=683

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  650  QETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  682



>ref|XP_006340257.1| PREDICTED: uncharacterized protein LOC102583902 [Solanum tuberosum]
Length=692

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  659  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  691



>ref|XP_008220112.1| PREDICTED: uncharacterized protein LOC103320244 [Prunus mume]
Length=685

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  652  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  684



>ref|XP_004291170.1| PREDICTED: uncharacterized protein LOC101299149 [Fragaria vesca 
subsp. vesca]
Length=649

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  616  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  648



>gb|AAC42254.1| unknown protein [Arabidopsis thaliana]
Length=282

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  249  QETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  281



>ref|XP_010668618.1| PREDICTED: uncharacterized protein LOC104885660 [Beta vulgaris 
subsp. vulgaris]
Length=731

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  698  QETLRTSAFPSTHVKEKWDKNLYIASICYGRTV  730



>ref|XP_004155952.1| PREDICTED: uncharacterized protein LOC101230855 [Cucumis sativus]
Length=716

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  683  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  715



>ref|XP_004141661.1| PREDICTED: uncharacterized protein LOC101213589 [Cucumis sativus]
Length=716

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  683  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  715



>gb|KGN45587.1| hypothetical protein Csa_7G452910 [Cucumis sativus]
Length=720

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  687  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  719



>ref|XP_002515975.1| casein kinase, putative [Ricinus communis]
 gb|EEF46395.1| casein kinase, putative [Ricinus communis]
Length=683

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  650  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  682



>ref|XP_004251171.2| PREDICTED: uncharacterized protein LOC101245026 [Solanum lycopersicum]
Length=692

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  659  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  691



>gb|KHN39248.1| Casein kinase I isoform delta-like, partial [Glycine soja]
Length=661

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  628  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  660



>ref|XP_007135639.1| hypothetical protein PHAVU_010G145900g [Phaseolus vulgaris]
 gb|ESW07633.1| hypothetical protein PHAVU_010G145900g [Phaseolus vulgaris]
Length=711

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  678  QETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  710



>gb|KHG14825.1| hypothetical protein F383_08945 [Gossypium arboreum]
Length=719

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  686  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  718



>gb|KJB46016.1| hypothetical protein B456_007G343500 [Gossypium raimondii]
Length=711

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRT+AFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  678  QETLRTTAFPSTHVKEKWAKNLYIASICYGRTV  710



>gb|KHG22911.1| Casein kinase I [Gossypium arboreum]
Length=598

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  565  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  597



>ref|XP_009418950.1| PREDICTED: uncharacterized protein LOC103999040 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=751

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS FPS HVK+KW+KNLYIASICYGRTVC
Sbjct  718  QETLRTSTFPSNHVKDKWAKNLYIASICYGRTVC  751



>ref|XP_009418951.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418952.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=716

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS FPS HVK+KW+KNLYIASICYGRTVC
Sbjct  683  QETLRTSTFPSNHVKDKWAKNLYIASICYGRTVC  716



>gb|KJB56821.1| hypothetical protein B456_009G137100 [Gossypium raimondii]
Length=719

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  686  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  718



>emb|CBI20566.3| unnamed protein product [Vitis vinifera]
Length=604

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  571  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  603



>ref|XP_004981469.1| PREDICTED: uncharacterized protein LOC101783890 isoform X1 [Setaria 
italica]
 ref|XP_004981470.1| PREDICTED: uncharacterized protein LOC101783890 isoform X2 [Setaria 
italica]
 ref|XP_004981471.1| PREDICTED: uncharacterized protein LOC101783890 isoform X3 [Setaria 
italica]
 ref|XP_004981472.1| PREDICTED: uncharacterized protein LOC101783890 isoform X4 [Setaria 
italica]
 ref|XP_004981473.1| PREDICTED: uncharacterized protein LOC101783890 isoform X5 [Setaria 
italica]
Length=706

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPS HVKEKW KNLYI+SICYGRTVC
Sbjct  673  QETLRTSAFPSNHVKEKWVKNLYISSICYGRTVC  706



>emb|CBI36074.3| unnamed protein product [Vitis vinifera]
Length=606

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  573  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  605



>emb|CDP08183.1| unnamed protein product [Coffea canephora]
Length=724

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  691  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  723



>gb|KHG18897.1| Casein kinase I [Gossypium arboreum]
Length=727

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLY+ASICYGRTV
Sbjct  694  QETLRTSAFPSTHVKEKWAKNLYLASICYGRTV  726



>ref|XP_010047289.1| PREDICTED: uncharacterized protein LOC104436263 [Eucalyptus grandis]
 gb|KCW79164.1| hypothetical protein EUGRSUZ_C00608 [Eucalyptus grandis]
Length=605

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  572  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  604



>ref|XP_010267169.1| PREDICTED: uncharacterized protein LOC104604501 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  660  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  692



>ref|XP_008352012.1| PREDICTED: uncharacterized protein LOC103415457 [Malus domestica]
Length=677

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  644  QETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  676



>ref|XP_010267167.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267168.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  664  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696



>ref|XP_008462429.1| PREDICTED: uncharacterized protein LOC103500783 [Cucumis melo]
 ref|XP_008462430.1| PREDICTED: uncharacterized protein LOC103500783 [Cucumis melo]
 ref|XP_008462431.1| PREDICTED: uncharacterized protein LOC103500783 [Cucumis melo]
 ref|XP_008462432.1| PREDICTED: uncharacterized protein LOC103500783 [Cucumis melo]
Length=720

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW KNLYIAS+CYGRTV
Sbjct  687  QETLRTSAFPSTHVKEKWGKNLYIASVCYGRTV  719



>ref|XP_004491691.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Cicer arietinum]
Length=667

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  634  QETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  667



>gb|KHN24964.1| Casein kinase I isoform alpha [Glycine soja]
Length=708

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  675  QETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  708



>ref|XP_002324211.2| hypothetical protein POPTR_0018s08230g [Populus trichocarpa]
 gb|EEF02776.2| hypothetical protein POPTR_0018s08230g [Populus trichocarpa]
Length=687

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  654  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  686



>gb|KJB07483.1| hypothetical protein B456_001G026300 [Gossypium raimondii]
Length=598

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  565  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  597



>ref|XP_004253105.1| PREDICTED: uncharacterized protein LOC101244359 [Solanum lycopersicum]
Length=708

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLY+ASICYGRTV
Sbjct  675  QETLRTSAFPSTHVKEKWAKNLYLASICYGRTV  707



>gb|KJB82881.1| hypothetical protein B456_013G219500 [Gossypium raimondii]
 gb|KJB82882.1| hypothetical protein B456_013G219500 [Gossypium raimondii]
Length=598

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  565  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  597



>ref|XP_011006418.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006419.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006420.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006421.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
Length=691

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  658  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  690



>ref|XP_010915404.1| PREDICTED: uncharacterized protein LOC105040538 [Elaeis guineensis]
Length=683

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKWSKNLYIASICYGRTV
Sbjct  650  QETLRTSAFPSQHVKEKWSKNLYIASICYGRTV  682



>ref|XP_009367436.1| PREDICTED: uncharacterized protein LOC103957076 [Pyrus x bretschneideri]
Length=677

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  644  QETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  676



>gb|KJB07478.1| hypothetical protein B456_001G026300 [Gossypium raimondii]
 gb|KJB07482.1| hypothetical protein B456_001G026300 [Gossypium raimondii]
Length=646

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  613  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  645



>ref|XP_007012164.1| Casein kinase I protein [Theobroma cacao]
 gb|EOY29783.1| Casein kinase I protein [Theobroma cacao]
Length=712

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  679  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  711



>gb|KDO79859.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79860.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79861.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79862.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79863.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
Length=697

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  664  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696



>ref|XP_002458472.1| hypothetical protein SORBIDRAFT_03g034330 [Sorghum bicolor]
 gb|EES03592.1| hypothetical protein SORBIDRAFT_03g034330 [Sorghum bicolor]
Length=103

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRT+AFPS HVK+KWSKNLY+AS+CYGRTV
Sbjct  70   QETLRTTAFPSQHVKDKWSKNLYLASVCYGRTV  102



>ref|XP_006476018.1| PREDICTED: uncharacterized protein LOC102627154 isoform X1 [Citrus 
sinensis]
Length=697

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  664  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696



>ref|XP_006450715.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 ref|XP_006450716.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 gb|ESR63955.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 gb|ESR63956.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
Length=697

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  664  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696



>gb|KJB07481.1| hypothetical protein B456_001G026300 [Gossypium raimondii]
Length=485

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  452  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  484



>ref|XP_004517304.1| PREDICTED: uncharacterized protein LOC101495334 [Cicer arietinum]
Length=599

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTS FPSTHVKEKWSKNLYIASICYGRTV
Sbjct  566  QETLRTSDFPSTHVKEKWSKNLYIASICYGRTV  598



>ref|XP_003621013.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES77231.1| casein kinase I-like protein [Medicago truncatula]
Length=599

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  566  QETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  599



>ref|XP_008367866.1| PREDICTED: casein kinase I [Malus domestica]
Length=540

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  507  QETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  539



>ref|XP_006853659.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
 gb|ERN15126.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
Length=703

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  670  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  702



>ref|XP_007139114.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
 gb|ESW11108.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
Length=675

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  642  QETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  675



>ref|XP_009776610.1| PREDICTED: uncharacterized protein LOC104226336 [Nicotiana sylvestris]
Length=724

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  691  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  723



>ref|XP_009587685.1| PREDICTED: uncharacterized protein LOC104085378 [Nicotiana tomentosiformis]
Length=722

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  689  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  721



>ref|NP_001044393.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAB89852.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF06307.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAH00219.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55461.1| hypothetical protein OsJ_03624 [Oryza sativa Japonica Group]
Length=698

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  665  QETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  697



>ref|XP_003552750.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
 gb|KHN12581.1| Casein kinase I isoform alpha [Glycine soja]
Length=672

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  639  QETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  672



>ref|XP_003532324.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
Length=672

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  639  QETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  672



>ref|XP_006342517.1| PREDICTED: uncharacterized protein LOC102599332 [Solanum tuberosum]
Length=708

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLY+AS+CYGRTV
Sbjct  675  QETLRTSAFPSTHVKEKWAKNLYLASVCYGRTV  707



>emb|CDY50866.1| BnaA05g37270D [Brassica napus]
Length=798

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVK+KW+KNLYIASICYGRTV
Sbjct  666  QETLRTSAFPSTHVKDKWAKNLYIASICYGRTV  698



>ref|XP_002516524.1| casein kinase, putative [Ricinus communis]
 gb|EEF45865.1| casein kinase, putative [Ricinus communis]
Length=671

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  638  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  670



>ref|XP_003523750.1| PREDICTED: uncharacterized protein LOC100778855 isoform X1 [Glycine 
max]
Length=663

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFP THVKEKW+KNLYIASICYGRTV
Sbjct  630  QETLRTSAFPGTHVKEKWAKNLYIASICYGRTV  662



>ref|XP_003523751.1| PREDICTED: uncharacterized protein LOC100779382 isoform X1 [Glycine 
max]
 ref|XP_006578236.1| PREDICTED: uncharacterized protein LOC100779382 isoform X2 [Glycine 
max]
 ref|XP_006578237.1| PREDICTED: uncharacterized protein LOC100779382 isoform X3 [Glycine 
max]
 ref|XP_006578238.1| PREDICTED: uncharacterized protein LOC100779382 isoform X4 [Glycine 
max]
Length=710

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFP THVKEKW+KNLYIASICYGRTV
Sbjct  677  QETLRTSAFPGTHVKEKWAKNLYIASICYGRTV  709



>gb|EYU21509.1| hypothetical protein MIMGU_mgv1a002137mg [Erythranthe guttata]
Length=709

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLY+AS+CYGRTV
Sbjct  676  QETLRTSAFPSTHVKEKWAKNLYLASVCYGRTV  708



>gb|KJB70401.1| hypothetical protein B456_011G072100 [Gossypium raimondii]
Length=727

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW KNLY+ASICYGRTV
Sbjct  694  QETLRTSAFPSTHVKEKWEKNLYLASICYGRTV  726



>ref|XP_006849555.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
 gb|ERN11136.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
Length=707

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS+HVKEKWSKNLY+ASICYGRTV
Sbjct  674  QETLRTSAFPSSHVKEKWSKNLYLASICYGRTV  706



>gb|KDO79864.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
Length=512

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  479  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  511



>gb|KDP34168.1| hypothetical protein JCGZ_07739 [Jatropha curcas]
Length=681

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  648  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  680



>gb|KHN10182.1| Casein kinase I like 2 [Glycine soja]
Length=606

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFP THVKEKW+KNLYIASICYGRTV
Sbjct  573  QETLRTSAFPGTHVKEKWAKNLYIASICYGRTV  605



>ref|XP_010098134.1| Casein kinase I-2-like protein [Morus notabilis]
 gb|EXB74571.1| Casein kinase I-2-like protein [Morus notabilis]
Length=723

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  690  QETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  722



>ref|XP_010033842.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 ref|XP_010033843.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 gb|KCW53681.1| hypothetical protein EUGRSUZ_J02945 [Eucalyptus grandis]
Length=709

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLY+ASICYGRTV
Sbjct  676  QETLRTSAFPSTHVKEKWAKNLYLASICYGRTV  708



>ref|XP_009596024.1| PREDICTED: uncharacterized protein LOC104092197 [Nicotiana tomentosiformis]
Length=703

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLY+AS+CYGRTV
Sbjct  670  QETLRTSAFPSTHVKEKWAKNLYLASVCYGRTV  702



>ref|XP_002514324.1| casein kinase, putative [Ricinus communis]
 gb|EEF48278.1| casein kinase, putative [Ricinus communis]
Length=664

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVK+KWSKNLYI+SICYGRTV
Sbjct  631  QETLRTSAFPSTHVKDKWSKNLYISSICYGRTV  663



>ref|XP_009787105.1| PREDICTED: uncharacterized protein LOC104235125 [Nicotiana sylvestris]
 ref|XP_009787106.1| PREDICTED: uncharacterized protein LOC104235125 [Nicotiana sylvestris]
Length=710

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLY+AS+CYGRTV
Sbjct  677  QETLRTSAFPSTHVKEKWAKNLYLASVCYGRTV  709



>ref|XP_007161527.1| hypothetical protein PHAVU_001G076900g [Phaseolus vulgaris]
 ref|XP_007161528.1| hypothetical protein PHAVU_001G076900g [Phaseolus vulgaris]
 gb|ESW33521.1| hypothetical protein PHAVU_001G076900g [Phaseolus vulgaris]
 gb|ESW33522.1| hypothetical protein PHAVU_001G076900g [Phaseolus vulgaris]
Length=685

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS+HVKEKWSKNLYIAS+CYGRTV
Sbjct  652  QETLRTSAFPSSHVKEKWSKNLYIASMCYGRTV  684



>ref|XP_008794114.1| PREDICTED: uncharacterized protein LOC103710237 [Phoenix dactylifera]
Length=676

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  643  QETLRTSAFPSQHVKEKWAKNLYIASICYGRTV  675



>gb|EEC71557.1| hypothetical protein OsI_03913 [Oryza sativa Indica Group]
Length=647

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  614  QETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  646



>ref|XP_009801165.1| PREDICTED: uncharacterized protein LOC104246947 [Nicotiana sylvestris]
Length=710

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLY+AS+CYGRTV
Sbjct  677  QETLRTSAFPSTHVKEKWAKNLYLASVCYGRTV  709



>ref|XP_009592153.1| PREDICTED: uncharacterized protein LOC104089043 [Nicotiana tomentosiformis]
Length=713

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLY+AS+CYGRTV
Sbjct  680  QETLRTSAFPSTHVKEKWAKNLYLASVCYGRTV  712



>ref|XP_008791563.1| PREDICTED: uncharacterized protein LOC103708420 [Phoenix dactylifera]
Length=683

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  650  QETLRTSAFPSQHVKEKWAKNLYIASICYGRTV  682



>gb|EEC78673.1| hypothetical protein OsI_18806 [Oryza sativa Indica Group]
Length=607

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  574  QETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  606



>dbj|BAG92829.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62667.1| hypothetical protein OsJ_17470 [Oryza sativa Japonica Group]
Length=607

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  574  QETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  606



>dbj|BAJ90552.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96313.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  661  QETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  693



>gb|AAT44311.1| putative casein kinase [Oryza sativa Japonica Group]
 gb|AAV59374.1| putative casein kinase [Oryza sativa Japonica Group]
Length=608

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  575  QETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  607



>ref|XP_006293796.1| hypothetical protein CARUB_v10022778mg [Capsella rubella]
 gb|EOA26694.1| hypothetical protein CARUB_v10022778mg [Capsella rubella]
Length=675

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS+HVKEKW+KNLYIASICYGRTV
Sbjct  642  QETLRTSAFPSSHVKEKWAKNLYIASICYGRTV  674



>emb|CDY21505.1| BnaC03g26920D [Brassica napus]
Length=615

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKWSKNLYI+SICYGRTV
Sbjct  582  QETLRTSAFPSNHVKEKWSKNLYISSICYGRTV  614



>ref|XP_008228435.1| PREDICTED: uncharacterized protein LOC103327845 [Prunus mume]
Length=706

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  673  QETLRTSAFPSTHVKEKWAKNLYIASMCYGRTV  705



>ref|XP_006408871.1| hypothetical protein EUTSA_v10001925mg [Eutrema salsugineum]
 gb|ESQ50324.1| hypothetical protein EUTSA_v10001925mg [Eutrema salsugineum]
Length=676

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKWSKNLYI+SICYGRTV
Sbjct  643  QETLRTSAFPSNHVKEKWSKNLYISSICYGRTV  675



>ref|XP_010249770.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
 ref|XP_010249771.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
 ref|XP_010249772.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
 ref|XP_010249773.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
Length=706

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVK+KWSKNLYIASICYGRTV
Sbjct  673  QETLRTSAFPSNHVKDKWSKNLYIASICYGRTV  705



>ref|XP_010526089.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526090.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526091.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526092.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526093.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526094.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526095.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
Length=601

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW KNLYIA ICYGRTV
Sbjct  568  QETLRTSAFPSTHVKEKWGKNLYIACICYGRTV  600



>ref|XP_010546534.1| PREDICTED: uncharacterized protein LOC104818596 [Tarenaya hassleriana]
Length=701

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW KNLYIA ICYGRTV
Sbjct  668  QETLRTSAFPSTHVKEKWGKNLYIAYICYGRTV  700



>gb|AAP80674.1| casein kinase-like protein [Triticum aestivum]
Length=114

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGR  253
            QETLRTSAFPS HVKEKWSKNLY+ASICYGR
Sbjct  81   QETLRTSAFPSQHVKEKWSKNLYLASICYGR  111



>ref|XP_010656334.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656335.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656336.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
Length=700

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  667  QETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  699



>gb|EYU29288.1| hypothetical protein MIMGU_mgv1a002190mg [Erythranthe guttata]
Length=703

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  670  QETLRTSAFPSAHVKEKWAKNLYIASMCYGRTV  702



>ref|XP_003569928.1| PREDICTED: uncharacterized protein LOC100845295 [Brachypodium 
distachyon]
Length=698

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  665  QETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  697



>gb|AES58679.2| casein kinase I-like protein [Medicago truncatula]
Length=684

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTS FPSTHVKEKW+KNLYIASICYGRTV
Sbjct  651  QETLRTSDFPSTHVKEKWAKNLYIASICYGRTV  683



>ref|XP_003592802.1| Casein kinase-like protein [Medicago truncatula]
 gb|AES63053.1| casein kinase I-like protein [Medicago truncatula]
Length=676

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTS FPS HVKEKWSKNLY+A +CYGRTVC
Sbjct  643  QETLRTSQFPSAHVKEKWSKNLYLAHLCYGRTVC  676



>ref|XP_008380865.1| PREDICTED: uncharacterized protein LOC103443751 [Malus domestica]
Length=708

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTS FPSTHVKEKWSKNLY+ASICYGRTV
Sbjct  675  QETLRTSVFPSTHVKEKWSKNLYLASICYGRTV  707



>ref|XP_010925551.1| PREDICTED: uncharacterized protein LOC105048062 [Elaeis guineensis]
Length=676

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  643  QETLRTSAFPSQHVKEKWAKNLYIASVCYGRTV  675



>ref|XP_010516137.1| PREDICTED: uncharacterized protein LOC104791759 isoform X2 [Camelina 
sativa]
 ref|XP_010516215.1| PREDICTED: uncharacterized protein LOC104791759 isoform X3 [Camelina 
sativa]
Length=699

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 1/34 (3%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVK KW+KNLYIASICYGRTVC
Sbjct  667  QETLRTSAFPSTHVK-KWAKNLYIASICYGRTVC  699



>ref|XP_010485763.1| PREDICTED: uncharacterized protein LOC104764028 isoform X2 [Camelina 
sativa]
Length=700

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 1/34 (3%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            QETLRTSAFPSTHVK KW+KNLYIASICYGRTVC
Sbjct  668  QETLRTSAFPSTHVK-KWAKNLYIASICYGRTVC  700



>ref|XP_009353558.1| PREDICTED: uncharacterized protein LOC103944824 [Pyrus x bretschneideri]
Length=708

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTS FPSTHVKEKWSKNLY+ASICYGRTV
Sbjct  675  QETLRTSVFPSTHVKEKWSKNLYLASICYGRTV  707



>ref|XP_011092199.1| PREDICTED: uncharacterized protein LOC105172435 [Sesamum indicum]
Length=702

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  669  QETLRTSAFPSVHVKEKWAKNLYIASVCYGRTV  701



>ref|XP_008655390.1| PREDICTED: uncharacterized protein LOC100502202 isoform X1 [Zea 
mays]
 gb|AFW84937.1| hypothetical protein ZEAMMB73_351651 [Zea mays]
Length=812

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  779  QETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  811



>ref|XP_010249521.1| PREDICTED: uncharacterized protein LOC104592067 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVK+KW+KNLYIAS+CYGRTV
Sbjct  664  QETLRTSAFPSTHVKDKWAKNLYIASVCYGRTV  696



>ref|XP_006426889.1| hypothetical protein CICLE_v10025028mg [Citrus clementina]
 gb|ESR40129.1| hypothetical protein CICLE_v10025028mg [Citrus clementina]
 gb|KDO51768.1| hypothetical protein CISIN_1g005221mg [Citrus sinensis]
Length=708

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  675  QETLRTSAFPSAHVKEKWAKNLYIASVCYGRTV  707



>ref|XP_009406168.1| PREDICTED: uncharacterized protein LOC103989128 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  652  QETLRTSAFPSQHVKEKWAKNLYIASVCYGRTV  684



>ref|XP_010249522.1| PREDICTED: uncharacterized protein LOC104592067 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVK+KW+KNLYIAS+CYGRTV
Sbjct  660  QETLRTSAFPSTHVKDKWAKNLYIASVCYGRTV  692



>ref|XP_006465683.1| PREDICTED: uncharacterized protein LOC102607770 [Citrus sinensis]
Length=708

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  675  QETLRTSAFPSAHVKEKWAKNLYIASVCYGRTV  707



>gb|EEC71464.1| hypothetical protein OsI_03705 [Oryza sativa Indica Group]
Length=671

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKWSKNLY+AS+CYGRTV
Sbjct  638  QETLRTSAFPSQHVKEKWSKNLYLASVCYGRTV  670



>ref|XP_006644782.1| PREDICTED: uncharacterized protein LOC102714869 [Oryza brachyantha]
Length=701

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  668  QETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  700



>ref|XP_011013374.1| PREDICTED: uncharacterized protein LOC105117411 isoform X4 [Populus 
euphratica]
Length=714

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            QETLRTSAFPSTHVKEKW+KNLY+ASICYGRT
Sbjct  681  QETLRTSAFPSTHVKEKWAKNLYVASICYGRT  712



>ref|XP_011013373.1| PREDICTED: uncharacterized protein LOC105117411 isoform X3 [Populus 
euphratica]
Length=718

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            QETLRTSAFPSTHVKEKW+KNLY+ASICYGRT
Sbjct  685  QETLRTSAFPSTHVKEKWAKNLYVASICYGRT  716



>gb|KFK32550.1| hypothetical protein AALP_AA6G257400 [Arabis alpina]
Length=673

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+KNLYI+S+CYGRTV
Sbjct  640  QETLRTSAFPSTHVKEKWAKNLYISSMCYGRTV  672



>emb|CBI28086.3| unnamed protein product [Vitis vinifera]
Length=629

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  596  QETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  628



>emb|CDO97984.1| unnamed protein product [Coffea canephora]
Length=605

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  572  QETLRTSAFPSVHVKEKWAKNLYIASVCYGRTV  604



>ref|XP_002303307.2| hypothetical protein POPTR_0003s04820g [Populus trichocarpa]
 gb|EEE78286.2| hypothetical protein POPTR_0003s04820g [Populus trichocarpa]
Length=482

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            QETLRTSAFPSTHVKEKW+KNLY+ASICYGRT
Sbjct  449  QETLRTSAFPSTHVKEKWAKNLYVASICYGRT  480



>ref|NP_001054881.2| Os05g0200500 [Oryza sativa Japonica Group]
 dbj|BAF16795.2| Os05g0200500, partial [Oryza sativa Japonica Group]
Length=649

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  616  QETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  648



>gb|KIY93350.1| hypothetical protein MNEG_14612 [Monoraphidium neglectum]
Length=103

 Score = 65.1 bits (157),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS+HVKEKW+KNLYIA I YGRTV
Sbjct  70   QETLRTSAFPSSHVKEKWAKNLYIAGIAYGRTV  102



>gb|EMT25395.1| Casein kinase I-2-like protein [Aegilops tauschii]
Length=591

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKWSKNLY+AS+CYGRTV
Sbjct  558  QETLRTSAFPSQHVKEKWSKNLYLASVCYGRTV  590



>gb|EMS66552.1| Casein kinase I-like protein 2 [Triticum urartu]
Length=591

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKWSKNLY+AS+CYGRTV
Sbjct  558  QETLRTSAFPSQHVKEKWSKNLYLASVCYGRTV  590



>ref|XP_010472590.1| PREDICTED: uncharacterized protein LOC104752211 [Camelina sativa]
Length=676

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  643  QETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  675



>ref|XP_011013372.1| PREDICTED: uncharacterized protein LOC105117411 isoform X2 [Populus 
euphratica]
Length=484

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRT  250
            QETLRTSAFPSTHVKEKW+KNLY+ASICYGRT
Sbjct  451  QETLRTSAFPSTHVKEKWAKNLYVASICYGRT  482



>ref|XP_002309535.1| kinase family protein [Populus trichocarpa]
 gb|EEE93058.1| kinase family protein [Populus trichocarpa]
Length=609

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  345  QETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            QETLRTSAFPSTHVKEKW+ NLYIAS+CYGRTV
Sbjct  576  QETLRTSAFPSTHVKEKWATNLYIASVCYGRTV  608



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554595229600