BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF048F22

Length=355
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAD56223.1|  polyubiquitin                                          162   7e-49   Cicer arietinum [garbanzo]
emb|CAC84144.1|  polyubiquitin-like protein                             162   1e-48   Nicotiana tabacum [American tobacco]
ref|XP_007154497.1|  hypothetical protein PHAVU_003G1236000g            162   2e-48   Phaseolus vulgaris [French bean]
ref|NP_001190681.1|  ubiquitin 11                                       162   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004173717.1|  PREDICTED: polyubiquitin-like                      162   4e-48   
gb|ABC66105.1|  putative pentameric polyubiquitin                       161   4e-48   Zinnia elegans [garden zinnia]
gb|AAQ08999.1|  polyubiquitin 2                                         162   4e-48   Phaseolus vulgaris [French bean]
gb|ADB85771.1|  polyubiquitin-like protein                              161   4e-48   Wolffia arrhiza
gb|AEI29169.1|  ubiquitin-like protein                                  160   4e-48   Vanilla planifolia [cultivated vanilla]
emb|CAI51312.2|  polyubiquitin                                          162   4e-48   Capsicum chinense [bonnet pepper]
gb|KGU30435.1|  polyubiquitin                                           160   6e-48   Candida albicans P57055
gb|AHI85710.1|  stress-induced protein 5                                162   6e-48   Capsicum annuum
gb|AGZ90161.1|  ubiquitin                                               160   6e-48   Litsea cubeba [may chang]
gb|KHC63620.1|  polyubiquitin                                           160   7e-48   Candida albicans P75010
gb|ABC68439.1|  putative polyubiquitin                                  160   7e-48   Tragopogon dubius [yellow salsify]
dbj|BAK19068.1|  ubiquitin                                              161   7e-48   Ipomoea nil [qian niu]
gb|AAC39466.1|  polyubiquitin                                           161   7e-48   Arabidopsis thaliana [mouse-ear cress]
gb|ABR25913.1|  polyubiquitin containing 7 ubiquitin monomers           159   8e-48   Oryza sativa Indica Group [Indian rice]
gb|ABD61727.1|  polyubiquitin                                           160   1e-47   Lupinus albus
gb|AEX13272.1|  hypothetical protein CL958Contig1_06                    159   1e-47   Pinus taeda
gb|AAL33551.1|AF436850_1  polyubiquitin                                 160   1e-47   Cucumis melo [Oriental melon]
gb|KHC36296.1|  polyubiquitin                                           160   1e-47   Candida albicans P76067
gb|KDN47865.1|  Polyubiquitin                                           159   2e-47   Rhizoctonia solani AG-8 WAC10335
gb|ABH06365.1|  ubiquitin                                               160   2e-47   Sorbus aucuparia [European mountain ash]
gb|AGA61762.1|  polyubiquitin 14                                        160   2e-47   Cornus kousa [kousa dogwood]
dbj|BAA85750.1|  polyubiquitin                                          160   2e-47   Cucumis melo [Oriental melon]
gb|AGZ80457.1|  ubiquitin-like protein                                  160   2e-47   Phaseolus vulgaris [French bean]
gb|ACZ69386.1|  polyubiquitin UBQ14                                     162   2e-47   Cucumis sativus [cucumbers]
ref|XP_004976899.1|  PREDICTED: polyubiquitin 3-like                    160   2e-47   Setaria italica
ref|XP_009609090.1|  PREDICTED: polyubiquitin 11                        161   2e-47   Nicotiana tomentosiformis
gb|AAM78180.1|  putative polyubiquitin                                  162   3e-47   Gossypium herbaceum [Arabian cotton]
gb|ADE06486.1|  putative poly-ubiquitin                                 158   3e-47   Tragopogon porrifolius [oyster plant]
gb|ABH08753.1|  ubiquitin                                               162   3e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AFU90137.2|  polyubiquitin                                           161   3e-47   Paeonia lactiflora [common garden peony]
gb|ABH08755.1|  ubiquitin                                               162   3e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KJB69254.1|  hypothetical protein B456_011G016600                    160   3e-47   Gossypium raimondii
gb|KDO51108.1|  hypothetical protein CISIN_1g048350mg                   159   3e-47   Citrus sinensis [apfelsine]
emb|CCK72367.1|  hypothetical protein KNAG_0J02880                      160   3e-47   Kazachstania naganishii CBS 8797
gb|KIJ21593.1|  hypothetical protein PAXINDRAFT_5754                    159   3e-47   Paxillus involutus ATCC 200175
gb|EGA61425.1|  Ubi4p                                                   159   3e-47   Saccharomyces cerevisiae FostersO
ref|XP_008809849.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    160   3e-47   Phoenix dactylifera
gb|KEH31007.1|  pentameric polyubiquitin                                162   3e-47   Medicago truncatula
gb|AAM64530.1|  ubiquitin homolog                                       162   3e-47   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85643.1|  unknown                                                 162   3e-47   Medicago truncatula
gb|ABF06579.2|  polyubiquitin                                           160   3e-47   Gladiolus grandiflorus
ref|XP_008246113.1|  PREDICTED: polyubiquitin                           160   3e-47   Prunus mume [ume]
ref|XP_004497490.1|  PREDICTED: polyubiquitin 4-like                    160   3e-47   Cicer arietinum [garbanzo]
ref|NP_567286.1|  ubiquitin 11                                          162   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006495477.1|  PREDICTED: polyubiquitin 3-like                    160   3e-47   Citrus sinensis [apfelsine]
ref|XP_010931828.1|  PREDICTED: polyubiquitin                           160   3e-47   
ref|XP_010497209.1|  PREDICTED: polyubiquitin                           160   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009758989.1|  PREDICTED: polyubiquitin                           160   4e-47   Nicotiana sylvestris
gb|AAM63271.1|  unknown                                                 160   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004501591.1|  PREDICTED: polyubiquitin 4-like                    160   4e-47   Cicer arietinum [garbanzo]
ref|XP_009419640.1|  PREDICTED: polyubiquitin-like                      159   4e-47   
gb|KDO51107.1|  hypothetical protein CISIN_1g038333mg                   159   4e-47   Citrus sinensis [apfelsine]
ref|XP_007693173.1|  hypothetical protein COCMIDRAFT_109160             160   4e-47   Bipolaris oryzae ATCC 44560
tpg|DAA44273.1|  TPA: Ubiquitin fusion protein                          161   4e-47   
ref|XP_006481837.1|  PREDICTED: polyubiquitin-like                      159   4e-47   
gb|AEG78310.1|  ubiquitin                                               159   5e-47   Cucurbita pepo
sp|P0CG83.1|UBIQP_HORVU  RecName: Full=Polyubiquitin; Contains: R...    160   5e-47   Hordeum vulgare [barley]
gb|AFK46460.1|  unknown                                                 160   5e-47   Medicago truncatula
gb|ACB87918.1|  polyubiquitin 3                                         160   5e-47   Malus domestica [apple tree]
gb|ACA58351.1|  ubiquitin-like protein                                  160   5e-47   Sandersonia aurantiaca [Chinese-lantern lily]
gb|ABI84246.1|  polyubiquitin 10                                        161   5e-47   Arachis hypogaea [goober]
gb|AFJ04519.1|  ubiquitin                                               160   5e-47   Vernicia fordii [tung oil tree]
emb|CCF36198.1|  polyubiquitin                                          158   6e-47   Colletotrichum higginsianum
gb|AIZ74336.1|  polyubiquitin 4                                         158   6e-47   Pinus massoniana [Chinese red pine]
gb|AFP44113.1|  ubiquitin                                               160   6e-47   Lycoris longituba
gb|ABC68440.1|  putative polyubiquitin                                  157   6e-47   Tragopogon pratensis [Jack-go-to-bed-at-noon]
gb|AIY85428.1|  ubiquitin                                               159   6e-47   Elaeagnus umbellata [aki-gumi]
gb|AFJ93197.1|  ubiquitin                                               159   6e-47   Eremosparton songoricum
gb|AAP40646.1|  putative polyubiquitin                                  159   7e-47   Gossypium barbadense [Egyptian cotton]
ref|XP_007154494.1|  hypothetical protein PHAVU_003G1236001g            160   7e-47   Phaseolus vulgaris [French bean]
ref|XP_009420214.1|  PREDICTED: polyubiquitin                           159   7e-47   
gb|AAZ32851.1|  pentameric polyubiquitin                                160   7e-47   Medicago sativa [alfalfa]
gb|ABR25718.1|  polyubiquitin containing 7 ubiquitin monomers           160   7e-47   Oryza sativa Indica Group [Indian rice]
gb|ACT82769.1|  polyubiquitin                                           160   9e-47   Nicotiana tabacum [American tobacco]
gb|AAZ82816.1|  ubiquitin monomer protein                               159   9e-47   Morus mongolica [Mongolian mulberry]
pir||PS0380  ubiquitin precursor - rice (fragment)                      160   9e-47
ref|XP_001731772.1|  hypothetical protein MGL_1040                      159   9e-47   Malassezia globosa CBS 7966
gb|ACJ85618.1|  unknown                                                 161   9e-47   Medicago truncatula
gb|AFY06654.1|  polyubiquitin                                           162   9e-47   Carica papaya [mamon]
ref|XP_009783162.1|  PREDICTED: ubiquitin-like                          158   1e-46   Nicotiana sylvestris
emb|CAD27944.1|  polyubiquitin-like                                     161   1e-46   Oryza sativa [red rice]
gb|AFC36452.1|  ubiquitin                                               161   1e-46   Anoectochilus roxburghii
ref|XP_002389222.1|  hypothetical protein MPER_11681                    159   1e-46   
ref|XP_002957068.1|  polyubiquitin                                      159   1e-46   Volvox carteri f. nagariensis
ref|XP_002447145.1|  hypothetical protein SORBIDRAFT_06g029360          159   1e-46   Sorghum bicolor [broomcorn]
gb|AAL25813.1|  polyubiquitin                                           159   1e-46   Prunus avium [gean]
emb|CAA72800.1|  polyubiquitin precursor                                159   1e-46   Suberites domuncula
ref|XP_003626479.1|  Ubiquitin-like protein                             162   1e-46   
ref|XP_008439961.1|  PREDICTED: polyubiquitin-like                      159   1e-46   
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             161   1e-46   Brachypodium distachyon [annual false brome]
emb|CBI23934.3|  unnamed protein product                                160   1e-46   Vitis vinifera
gb|EYU19679.1|  hypothetical protein MIMGU_mgv1a015002mg                159   1e-46   Erythranthe guttata [common monkey flower]
gb|AFW66442.1|  putative ubiquitin family protein                       160   1e-46   
ref|XP_001701379.1|  bi-ubiquitin, major isoform                        159   1e-46   Chlamydomonas reinhardtii
gb|AAB36546.1|  polyubiquitin                                           160   1e-46   Phaseolus vulgaris [French bean]
gb|ABD96088.1|  polyubiquitin                                           162   1e-46   Malus domestica [apple tree]
ref|XP_003619702.1|  Ubiquitin-like protein                             161   1e-46   
gb|AGV54749.1|  ubiquitin 11                                            162   1e-46   Phaseolus vulgaris [French bean]
ref|XP_009412006.1|  PREDICTED: polyubiquitin 11-like                   161   2e-46   
gb|EPS72031.1|  polyubiquitin                                           162   2e-46   Genlisea aurea
gb|AAF31707.1|AF221858_1  polyubiquitin                                 160   2e-46   Euphorbia esula [wolf's milk]
gb|AEW46688.1|  polyubiquitin                                           160   2e-46   Ulva linza
ref|NP_001235900.1|  polyubiquitin                                      155   2e-46   
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           163   2e-46   Nicotiana tomentosiformis
gb|ABV58641.1|  ubiquitin                                               157   2e-46   Catharanthus roseus [chatas]
gb|AAZ08412.1|  polyubiquitin                                           158   2e-46   Populus alba [abele]
gb|ABH08754.1|  ubiquitin                                               160   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      163   2e-46   Brassica rapa
ref|XP_003619701.1|  Ubiquitin-like protein                             162   2e-46   
dbj|GAC77607.1|  ubiquitin and ubiquitin-like proteins                  160   2e-46   Moesziomyces antarcticus T-34
ref|XP_010938173.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    160   2e-46   
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             160   2e-46   
emb|CAG28691.1|  polyubiquitin                                          157   2e-46   Fusarium fujikuroi
ref|XP_010228848.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    160   2e-46   
emb|CAA48140.1|  ubiquitin                                              162   2e-46   Antirrhinum majus [garden snapdragon]
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      162   2e-46   Camelina sativa [gold-of-pleasure]
gb|EEC81189.1|  hypothetical protein OsI_24195                          160   2e-46   Oryza sativa Indica Group [Indian rice]
gb|ABK94002.1|  unknown                                                 162   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      162   2e-46   Camelina sativa [gold-of-pleasure]
ref|NP_849292.1|  polyubiquitin 14                                      162   2e-46   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC57955.1|  polyubiquitin                                          160   2e-46   Tripolium pannonicum [sea starwort]
gb|KJB81823.1|  hypothetical protein B456_013G163500                    162   2e-46   Gossypium raimondii
gb|KJB62484.1|  hypothetical protein B456_009G418900                    160   2e-46   Gossypium raimondii
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      162   2e-46   Camelina sativa [gold-of-pleasure]
gb|ABR25697.1|  polyubiquitin containing 7 ubiquitin monomers           159   2e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_010069740.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    160   2e-46   Eucalyptus grandis [rose gum]
gb|AET06143.1|  ubiquitin                                               160   2e-46   Papaver somniferum
gb|AIZ74335.1|  polyubiquitin 3                                         161   2e-46   Pinus massoniana [Chinese red pine]
dbj|GAC94856.1|  ubiquitin                                              160   2e-46   Pseudozyma hubeiensis SY62
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    160   2e-46   
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      160   2e-46   Setaria italica
gb|AGA61761.1|  polyubuquitin 10                                        159   2e-46   Cornus kousa [kousa dogwood]
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    160   3e-46   Candida albicans
ref|XP_007873662.1|  hypothetical protein PNEG_01699                    158   3e-46   Pneumocystis murina B123
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             160   3e-46   Elaeis guineensis
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   160   3e-46   Camelina sativa [gold-of-pleasure]
gb|AAP31578.1|  ubiquitin                                               160   3e-46   Hevea brasiliensis [jebe]
gb|KJB36627.1|  hypothetical protein B456_006G167800                    160   3e-46   Gossypium raimondii
ref|XP_719867.1|  hypothetical protein CaO19.6771                       160   3e-46   Candida albicans SC5314
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          160   3e-46   Sorghum bicolor [broomcorn]
ref|XP_002317213.1|  polyubiquitin family protein                       160   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_003648495.1|  hypothetical protein Ecym_8408                     158   3e-46   Eremothecium cymbalariae DBVPG#7215
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    161   3e-46   
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             160   3e-46   
gb|AIS71924.1|  polyubiquitin                                           160   3e-46   Mangifera indica
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                160   3e-46   Erythranthe guttata [common monkey flower]
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             161   3e-46   Brachypodium distachyon [annual false brome]
ref|XP_011390959.1|  putative polyubiquitin                             160   3e-46   Ustilago maydis 521
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   160   3e-46   Brassica rapa
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             160   3e-46   Citrus clementina [clementine]
ref|XP_007442551.1|  PREDICTED: polyubiquitin-C-like                    157   3e-46   Python bivittatus
emb|CBY46745.1|  polyubiquitin 10 protein                               162   3e-46   Lepidium appelianum [hairy whitetop]
emb|CAI83759.1|  Polyubiqutin 6                                         155   3e-46   Polyplastron multivesiculatum
emb|CCF48657.1|  probable polyubiquitin                                 160   3e-46   Ustilago hordei
gb|EHN01342.1|  Ubi4p                                                   157   3e-46   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|AAQ84316.1|  fiber polyubiquitin                                     160   3e-46   Gossypium barbadense [Egyptian cotton]
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             160   3e-46   
emb|CAH59739.1|  polyubiquitin                                          160   3e-46   Plantago major [cart-track plant]
gb|ERG83124.1|  polyubiquitin-a                                         157   3e-46   
gb|KIY97324.1|  ubiquitin C                                             159   3e-46   Monoraphidium neglectum
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   160   3e-46   Citrus sinensis [apfelsine]
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             160   3e-46   Citrus clementina [clementine]
gb|EWZ87538.1|  ubiquitin C                                             157   3e-46   Fusarium oxysporum f. sp. lycopersici MN25
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   160   3e-46   Citrus sinensis [apfelsine]
gb|AAR32784.1|  polyubiquitin                                           160   3e-46   Clusia minor [cupey de monte]
emb|CAI83756.1|  Polyubiqutin 3                                         155   3e-46   Polyplastron multivesiculatum
gb|AAK68824.1|  Unknown protein                                         160   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003687789.1|  hypothetical protein TPHA_0K02250                  157   3e-46   Tetrapisispora phaffii CBS 4417
gb|AFK41706.1|  unknown                                                 160   3e-46   Medicago truncatula
gb|AAO43308.1|  putative polyubiquitin                                  160   3e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AFK73707.1|  ubiquitin                                               157   4e-46   Ostrea edulis [Colchester native oyster]
gb|EIE85715.1|  polyubiquitin                                           160   4e-46   Rhizopus delemar RA 99-880
gb|KDQ31335.1|  hypothetical protein PLEOSDRAFT_1082432                 159   4e-46   Pleurotus ostreatus PC15
ref|XP_005056765.1|  PREDICTED: polyubiquitin-C-like isoform X3         157   4e-46   
gb|AGZ15412.1|  fiber polyubiquitin                                     160   4e-46   Phaseolus vulgaris [French bean]
gb|AFK43392.1|  unknown                                                 160   4e-46   Medicago truncatula
emb|CAL30085.1|  polyubiquitin                                          157   4e-46   Globodera pallida
gb|KDP23292.1|  hypothetical protein JCGZ_23125                         157   4e-46   Jatropha curcas
gb|ADC29516.1|  polyubiquitin                                           156   4e-46   Citrus sinensis [apfelsine]
ref|XP_005067919.1|  PREDICTED: polyubiquitin-B                         156   4e-46   
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             162   4e-46   
gb|AAO43307.1|  putative polyubiquitin                                  160   4e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             160   4e-46   
gb|EIE88012.1|  polyubiquitin                                           160   4e-46   Rhizopus delemar RA 99-880
ref|XP_007039159.1|  Ubiquitin supergroup,Ribosomal protein L40e        157   5e-46   
emb|CCA26421.1|  ubiquitinribosomal fusion protein putative             156   5e-46   Albugo laibachii Nc14
gb|AAC35858.1|  polyubiquitin                                           160   5e-46   Capsicum chinense [bonnet pepper]
gb|KIR83632.1|  polyubiquitin                                           159   5e-46   Cryptococcus gattii VGIV IND107
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            160   5e-46   Phaseolus vulgaris [French bean]
gb|EJW05300.1|  polyubiquitin                                           157   5e-46   Edhazardia aedis USNM 41457
ref|XP_007339454.1|  ubiquitin                                          162   5e-46   
dbj|BAA76889.1|  ubiquitin                                              157   5e-46   Trichophyton mentagrophytes
gb|AEZ49160.1|  polyubiquitin                                           161   6e-46   Wolffia australiana
ref|XP_001830230.1|  ubiquitin                                          161   6e-46   Coprinopsis cinerea okayama7#130
ref|XP_003494613.1|  PREDICTED: polyubiquitin-A-like                    156   6e-46   
ref|XP_006373839.1|  UBIQUITIN EXTENSION protein 1                      155   6e-46   
ref|XP_002465593.1|  hypothetical protein SORBIDRAFT_01g041800          156   6e-46   Sorghum bicolor [broomcorn]
gb|KFP83235.1|  Polyubiquitin-C                                         155   6e-46   Acanthisitta chloris
gb|AES89866.2|  polyubiquitin 3                                         161   6e-46   Medicago truncatula
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  159   6e-46   Hypholoma sublateritium FD-334 SS-4
gb|EWZ40370.1|  ubiquitin C                                             159   6e-46   Fusarium oxysporum Fo47
pir||S42643  ubiquitin / ribosomal protein S27a - potato (fragment)     156   6e-46
gb|AEL23099.1|  ubiquitin                                               155   6e-46   Cherax quadricarinatus [Australian red claw crayfish]
emb|CAC94926.1|  putative ubiquitin                                     159   6e-46   Pleurotus sp. 'Florida' [Florida oyster mushroom]
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  159   7e-46   Piloderma croceum F 1598
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 159   7e-46   Dacryopinax primogenitus
ref|XP_006685644.1|  ubiquitin                                          159   7e-46   Yamadazyma tenuis ATCC 10573
dbj|BAE48510.1|  polyubiquitin                                          157   7e-46   Raphidiophrys contractilis
ref|XP_010480024.1|  PREDICTED: polyubiquitin-like                      161   7e-46   
gb|AAZ66786.1|  polyubiquitin                                           154   7e-46   Ictalurus punctatus
ref|XP_011110054.1|  hypothetical protein H072_4094                     159   7e-46   
dbj|BAH70616.1|  ACYPI007765                                            157   7e-46   Acyrthosiphon pisum
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   159   7e-46   Piloderma croceum F 1598
sp|P51423.2|RL40_BRARP  RecName: Full=Ubiquitin-60S ribosomal pro...    156   7e-46   Brassica rapa subsp. pekinensis [bai cai]
gb|ABK93609.1|  unknown                                                 155   7e-46   Populus trichocarpa [western balsam poplar]
gb|AAI57792.1|  LOC100135402 protein                                    154   7e-46   Xenopus tropicalis [western clawed frog]
ref|XP_766242.1|  ubiquitin                                             157   7e-46   Theileria parva strain Muguga
ref|XP_003558419.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    156   7e-46   Brachypodium distachyon [annual false brome]
gb|KEH35478.1|  ubiquitin-60S ribosomal L40 fusion protein              156   7e-46   Medicago truncatula
ref|XP_006430159.1|  hypothetical protein CICLE_v10013083mg             156   7e-46   
emb|CBY16339.1|  unnamed protein product                                158   8e-46   Oikopleura dioica
emb|CDP08563.1|  unnamed protein product                                157   8e-46   Coffea canephora [robusta coffee]
ref|XP_008354260.1|  PREDICTED: ubiquitin                               155   8e-46   
ref|XP_010271616.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    156   8e-46   
dbj|GAM41773.1|  Ubi4 homolog                                           158   8e-46   Talaromyces cellulolyticus
ref|XP_002318470.1|  UBIQUITIN EXTENSION protein 1                      155   8e-46   Populus trichocarpa [western balsam poplar]
emb|CAA60629.1|  unnamed protein product                                157   8e-46   Acanthamoeba sp. 4b3
ref|XP_004934049.1|  PREDICTED: polyubiquitin-A-like                    157   8e-46   
ref|XP_007202754.1|  hypothetical protein PRUPE_ppa013349mg             155   8e-46   Prunus persica
ref|XP_003627152.1|  Ubiquitin                                          160   8e-46   
gb|KJB46428.1|  hypothetical protein B456_007G368200                    155   8e-46   Gossypium raimondii
gb|EFN76024.1|  Ubiquitin                                               159   8e-46   Harpegnathos saltator
ref|XP_008060805.1|  PREDICTED: polyubiquitin-B                         156   8e-46   
ref|XP_005824088.1|  ubiquitin                                          158   8e-46   Guillardia theta CCMP2712
prf||1101405A  ubiquitin precursor                                      158   8e-46
ref|XP_008924888.1|  PREDICTED: ubiquitin isoform X14                   155   8e-46   
ref|XP_002530306.1|  ubiquitin, putative                                155   8e-46   Ricinus communis
gb|ABK93568.1|  unknown                                                 155   8e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010683693.1|  PREDICTED: ubiquitin-60S ribosomal protein L40     155   9e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  159   9e-46   Paxillus rubicundulus Ve08.2h10
gb|KFK38522.1|  hypothetical protein AALP_AA3G124500                    155   9e-46   Arabis alpina [alpine rockcress]
emb|CDY70361.1|  BnaAnng33460D                                          155   9e-46   Brassica napus [oilseed rape]
dbj|BAH71116.1|  ACYPI006410                                            156   9e-46   Acyrthosiphon pisum
gb|AFK47149.1|  unknown                                                 155   9e-46   Lotus japonicus
ref|XP_003602319.1|  Ubiquitin                                          155   9e-46   Medicago truncatula
dbj|BAB32735.1|  ubiquitin                                              155   9e-46   Eustoma exaltatum subsp. russellianum [bluebells]
gb|AAA96951.1|  polyubiquitin                                           155   9e-46   Solanum tuberosum [potatoes]
dbj|BAK61738.1|  ubiquitin                                              157   9e-46   Larcopyle butschlii
emb|CDP05795.1|  unnamed protein product                                163   9e-46   Coffea canephora [robusta coffee]
gb|AAF78520.1|AF195224_1  ubiquitin fusion protein                      155   9e-46   Pyrus pyrifolia [sha li]
sp|P49636.2|RL40_NICSY  RecName: Full=Ubiquitin-60S ribosomal pro...    155   9e-46   Nicotiana sylvestris
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                163   9e-46   
ref|NP_564675.1|  ubiquitin-like                                        159   9e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002955196.1|  polyubiquitin                                      159   9e-46   Volvox carteri f. nagariensis
gb|KJB81825.1|  hypothetical protein B456_013G163500                    163   9e-46   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      163   9e-46   Nicotiana sylvestris
gb|EFN65063.1|  Ubiquitin                                               156   9e-46   Camponotus floridanus
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    162   1e-45   Nicotiana sylvestris
ref|NP_565836.1|  60S ribosomal protein L40-1                           155   1e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CAA25706.1|  unnamed protein product                                157   1e-45   Saccharomyces cerevisiae [brewer's yeast]
ref|XP_011175038.1|  PREDICTED: polyubiquitin                           156   1e-45   
ref|NP_001049479.1|  Os03g0234200                                       155   1e-45   
gb|AAL09741.1|  AT4g05320/C17L7_240                                     163   1e-45   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA76429.1|  polyubiquitin                                          155   1e-45   Cicer arietinum [garbanzo]
gb|ABY60454.1|  putative polyubiquitin                                  160   1e-45   Adonis aestivalis var. palaestina
ref|XP_011504237.1|  PREDICTED: polyubiquitin                           156   1e-45   Ceratosolen solmsi marchali
gb|AES89856.2|  polyubiquitin 3                                         159   1e-45   Medicago truncatula
gb|EMS24129.1|  ubiquitin C                                             159   1e-45   Rhodotorula toruloides NP11
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      162   1e-45   Nelumbo nucifera [Indian lotus]
emb|CBY46746.1|  polyubiquitin 10 protein                               162   1e-45   Lepidium campestre [bastard cress]
ref|XP_004929680.1|  PREDICTED: polyubiquitin-C-like isoform X1         156   1e-45   
gb|EMD85945.1|  hypothetical protein COCHEDRAFT_43242                   154   1e-45   Bipolaris maydis C5
ref|XP_004335788.1|  polyubiquitin, putative                            156   1e-45   Acanthamoeba castellanii str. Neff
ref|XP_002273568.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    155   1e-45   Vitis vinifera
ref|XP_003697063.1|  PREDICTED: polyubiquitin-A-like                    155   1e-45   Apis florea [dwarf honeybee]
gb|KEH31155.1|  polyubiquitin 3                                         162   1e-45   
ref|NP_849300.4|  polyubiquitin 10                                      162   1e-45   
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      161   1e-45   
gb|AAF04147.1|  ubiquitin precursor                                     162   1e-45   
emb|CBI22349.3|  unnamed protein product                                160   1e-45   
gb|ADO60140.1|  ubiquitin                                               158   1e-45   
ref|XP_009803293.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    155   1e-45   
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             160   1e-45   
gb|AAB68045.1|  polyubiquitin                                           162   1e-45   
gb|AAO73559.1|  polyubiquitin                                           155   1e-45   
prf||1604470A  poly-ubiquitin                                           160   1e-45
gb|ACJ85658.1|  unknown                                                 159   1e-45   
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  159   1e-45   
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     159   1e-45   
ref|XP_002979703.1|  hypothetical protein SELMODRAFT_19615              154   1e-45   
gb|AAX22106.1|  polyubiquitin                                           154   1e-45   
ref|XP_008555690.1|  PREDICTED: polyubiquitin                           156   1e-45   
gb|KCW48292.1|  hypothetical protein EUGRSUZ_K020232                    154   1e-45   
ref|XP_009171122.1|  hypothetical protein T265_07359                    156   1e-45   
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                163   1e-45   
emb|CDY71775.1|  BnaUnng04590D                                          154   1e-45   
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      162   1e-45   
emb|CCX04742.1|  Similar to Polyubiquitin; acc. no. P0CG74              159   1e-45   
ref|XP_007027812.1|  Ubiquitin extension protein 1 isoform 2            154   1e-45   
gb|AAB36545.1|  ubiquitin-like protein                                  163   1e-45   
ref|XP_006372519.1|  polyubiquitin family protein                       160   1e-45   
tpg|DAA44271.1|  TPA: polyubiquitin-like protein                        154   1e-45   
gb|AES89865.2|  polyubiquitin 3                                         160   1e-45   
emb|CDY71299.1|  BnaA08g30590D                                          154   1e-45   
gb|KJB13592.1|  hypothetical protein B456_002G083000                    162   1e-45   
ref|XP_003058683.1|  predicted protein                                  154   1e-45   
ref|XP_005850582.1|  hypothetical protein CHLNCDRAFT_48528              158   1e-45   
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             158   1e-45   
ref|XP_003590494.1|  Ubiquitin                                          160   1e-45   
gb|AAO43309.1|  putative polyubiquitin                                  159   1e-45   
ref|XP_009803295.1|  PREDICTED: ubiquitin isoform X3                    155   1e-45   
gb|EXX74853.1|  ubiquitin                                               157   1e-45   
dbj|BAJ85978.1|  predicted protein                                      160   1e-45   
gb|AAO42469.1|  putative polyubiquitin                                  160   1e-45   
ref|XP_008026131.1|  hypothetical protein SETTUDRAFT_56731              155   1e-45   
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             160   1e-45   
dbj|BAL61087.1|  polyubiquitin                                          158   1e-45   
gb|ACT66230.1|  polyubiquitin protein                                   157   1e-45   
gb|KJB62487.1|  hypothetical protein B456_009G418900                    160   1e-45   
gb|KDB11907.1|  ubiquitin                                               160   1e-45   
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            160   1e-45   
gb|ACD31680.1|  ubiquitin                                               160   1e-45   
emb|CCI48433.1|  unnamed protein product                                156   1e-45   
ref|XP_001755431.1|  predicted protein                                  158   1e-45   
ref|XP_001783045.1|  predicted protein                                  158   1e-45   
gb|AAA49129.1|  ubiquitin polyprotein (heat shock related)              156   1e-45   
ref|XP_006430157.1|  hypothetical protein CICLE_v10013083mg             155   1e-45   
gb|KDQ32297.1|  hypothetical protein PLEOSDRAFT_1081506                 158   1e-45   
ref|XP_010830642.1|  PREDICTED: ubiquitin                               155   1e-45   
ref|XP_003607659.1|  Ubiquitin                                          159   1e-45   
gb|EAZ03906.1|  hypothetical protein OsI_26040                          155   1e-45   
gb|ABH08968.1|  ubiquitin                                               153   1e-45   
ref|XP_009803294.1|  PREDICTED: ubiquitin isoform X2                    155   1e-45   
gb|AAB01783.1|  ubiquitin                                               155   1e-45   
ref|NP_001059668.2|  Os07g0489500                                       155   2e-45   
gb|AAB95250.1|  ubiquitin                                               160   2e-45   
emb|CCW69248.1|  unnamed protein product                                156   2e-45   
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   160   2e-45   
gb|ADP05114.1|  polyubiquitin 10                                        158   2e-45   
ref|XP_005779770.1|  hypothetical protein EMIHUDRAFT_114700             156   2e-45   
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             160   2e-45   
ref|XP_005820110.1|  ubiquitin                                          156   2e-45   
ref|XP_002503063.1|  predicted protein                                  154   2e-45   
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    160   2e-45   
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      160   2e-45   
emb|CDX95544.1|  BnaC01g34360D                                          153   2e-45   
gb|ACB87917.1|  polyubiquitin 2                                         157   2e-45   
ref|XP_007014924.1|  Polyubiquitin 3                                    160   2e-45   
sp|P69310.1|UBIQ_AVESA  RecName: Full=Ubiquitin                         153   2e-45   
ref|XP_009419594.1|  PREDICTED: ubiquitin                               153   2e-45   
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    160   2e-45   
emb|CAH59740.1|  polyubiquitin                                          160   2e-45   
gb|KJB46429.1|  hypothetical protein B456_007G368200                    154   2e-45   
sp|P69326.2|UBIQ_WHEAT  RecName: Full=Ubiquitin; Flags: Precursor       153   2e-45   
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          160   2e-45   
ref|XP_002419618.1|  ubiquitin, putative                                160   2e-45   
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      162   2e-45   
gb|EKV18932.1|  hypothetical protein PDIP_25190                         158   2e-45   
gb|KFK24775.1|  hypothetical protein AALP_AA8G023100                    153   2e-45   
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        162   2e-45   
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           160   2e-45   
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                160   2e-45   
gb|AGH68503.1|  ubiquitin extension protein                             155   2e-45   
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           160   2e-45   
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             160   2e-45   
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           160   2e-45   
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             160   2e-45   
gb|AFW66439.1|  putative ubiquitin family protein                       160   2e-45   
gb|AAZ42330.1|  ubiquitin protein 1                                     156   2e-45   
ref|NP_851029.1|  polyubiquitin 3                                       160   2e-45   
ref|NP_001063337.1|  Os09g0452700                                       155   2e-45   
ref|XP_006576160.1|  PREDICTED: uncharacterized protein LOC100306...    155   2e-45   
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      160   2e-45   
gb|AEA86332.1|  ubiquitin extension protein                             155   2e-45   
gb|KJB22478.1|  hypothetical protein B456_004G049300                    155   2e-45   
gb|AAA72503.1|  beta-galactosidase/ubiquitin fusion protein             154   2e-45   
gb|KDN44728.1|  polyubiquitin                                           158   2e-45   
gb|KDO70481.1|  hypothetical protein CISIN_1g032678mg                   154   2e-45   
gb|ACU45305.1|  polyubiquitin 6                                         155   2e-45   
emb|CAA40323.1|  polyubiquitin protein                                  161   2e-45   
emb|CDP08569.1|  unnamed protein product                                160   2e-45   
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             160   2e-45   
gb|ACU45000.1|  unknown                                                 155   2e-45   
emb|CDY39163.1|  BnaC09g21810D                                          154   2e-45   
ref|XP_001931824.1|  ubiquitin                                          158   2e-45   
gb|KFX48439.1|  Polyubiquitin                                           157   2e-45   
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      160   2e-45   
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             160   2e-45   
gb|EJW80596.1|  polyubiquitin                                           157   2e-45   
gb|KJB62485.1|  hypothetical protein B456_009G418900                    160   2e-45   
emb|CCT70325.1|  UBI4-Ubiquitin                                         159   2e-45   
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             160   2e-45   
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      160   2e-45   
emb|CAI83757.1|  Polyubiqutin 4                                         156   2e-45   
emb|CEP60563.1|  LALA0S01e13784g1_1                                     158   2e-45   
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           160   2e-45   
emb|CDS32180.1|  polyubiquitin                                          157   2e-45   
gb|AAC49970.1|  ubiquitin                                               153   2e-45   
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         160   2e-45   
emb|CAA70324.1|  ubiquitin                                              153   2e-45   
ref|XP_003082269.1|  polyubiquitin (ISS)                                160   2e-45   
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           163   2e-45   
ref|XP_009540734.1|  hypothetical protein HETIRDRAFT_377330             155   2e-45   
gb|AAA70104.1|  ubiquitin fusion protein                                155   2e-45   
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              158   2e-45   
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  158   2e-45   
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             160   2e-45   
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             160   2e-45   
ref|XP_005763036.1|  hypothetical protein EMIHUDRAFT_358059             155   2e-45   
ref|NP_985832.1|  ubiquitin-60S ribosomal protein L40 fusion protein    155   2e-45   
gb|EPX74297.1|  ubiquitin                                               158   2e-45   
ref|XP_005644220.1|  polyubiquitin                                      160   2e-45   
gb|EGA57707.1|  Ubi4p                                                   158   2e-45   
ref|XP_006488031.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    156   2e-45   
ref|XP_006381473.1|  polyubiquitin family protein                       160   2e-45   
ref|XP_008653168.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    155   2e-45   
emb|CAE00783.1|  polyubiquitin homolog                                  157   2e-45   
gb|EDM13556.1|  rCG21222, isoform CRA_b                                 156   2e-45   
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      161   2e-45   
gb|AGO97083.1|  ubiquitin                                               155   2e-45   
gb|AHW57997.1|  ubiquitin                                               155   2e-45   
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         160   2e-45   
gb|KJB36337.1|  hypothetical protein B456_006G153300                    154   2e-45   
ref|XP_007512209.1|  polyubiquitin                                      161   2e-45   
ref|XP_003645919.1|  hypothetical protein Ecym_4019                     154   2e-45   
gb|ACG31121.1|  40S ribosomal protein S27a                              155   2e-45   
ref|XP_006275267.1|  PREDICTED: polyubiquitin-B                         154   2e-45   
ref|XP_006604643.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    155   2e-45   
gb|AIY27743.1|  polyubiquitin Ubi10                                     160   2e-45   
ref|XP_004957594.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    155   2e-45   
gb|ABB55360.1|  polyubiquitin-like                                      153   2e-45   
gb|KIR50412.1|  ubiquitin                                               154   2e-45   
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    160   2e-45   
gb|ABR16172.1|  unknown                                                 155   2e-45   
ref|XP_001418619.1|  Ribosomal protein S27a, component of cytosol...    155   2e-45   
ref|XP_001744167.1|  hypothetical protein                               155   2e-45   
dbj|BAC40360.1|  unnamed protein product                                155   2e-45   
ref|XP_008506369.1|  PREDICTED: polyubiquitin                           154   2e-45   
gb|KFH71638.1|  ubiquitin-60S ribosomal protein L40                     154   2e-45   
ref|XP_001597677.1|  ubiquitin-60S ribosomal protein L40 fusion p...    154   2e-45   
gb|AAC67551.1|  tetra-ubiquitin                                         160   2e-45   
gb|KDO86852.1|  hypothetical protein CISIN_1g031604mg                   155   2e-45   
ref|XP_010519353.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    155   2e-45   
ref|XP_009689464.1|  ubiquitin                                          155   2e-45   
ref|XP_009503545.1|  PREDICTED: polyubiquitin                           155   2e-45   
ref|XP_007877546.1|  hypothetical protein PFL1_06936                    154   2e-45   
emb|CAX79673.1|  ubiquitin C                                            155   3e-45   
ref|XP_001829580.1|  ubiquitin-60S ribosomal protein L40 fusion p...    154   3e-45   
ref|XP_007334275.1|  hypothetical protein AGABI1DRAFT_26321             154   3e-45   
gb|AAO43305.1|  putative polyubiquitin                                  160   3e-45   
ref|XP_010731693.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    154   3e-45   
gb|KHN22999.1|  Ubiquitin-40S ribosomal protein S27a                    155   3e-45   
gb|AIH15195.1|  ubiquitin-40S ribosomal protein S27a-like protein       155   3e-45   
ref|XP_004504241.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    155   3e-45   
ref|XP_007864655.1|  ubiquitin                                          162   3e-45   
ref|XP_010046733.1|  PREDICTED: ubiquitin                               153   3e-45   
gb|AEE98366.1|  ubiquitin                                               155   3e-45   
emb|CEF98605.1|  Ubiquitin supergroup                                   155   3e-45   
gb|ADF36485.1|  ubiquitin extension protein                             155   3e-45   
gb|EMS20171.1|  large subunit ribosomal protein L40e                    154   3e-45   
ref|NP_001150700.1|  40S ribosomal protein S27a                         155   3e-45   
emb|CDO73416.1|  hypothetical protein BN946_scf185013.g50               154   3e-45   
ref|XP_003568865.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    155   3e-45   
gb|ABI84265.1|  ubiquitin/ribosomal protein S27a                        155   3e-45   
ref|XP_009907852.1|  PREDICTED: polyubiquitin                           155   3e-45   
gb|AAL66206.1|AF386524_1  ubiquitin extension protein                   155   3e-45   
ref|XP_004385061.1|  PREDICTED: polyubiquitin-C                         155   3e-45   
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    158   3e-45   
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             162   3e-45   
gb|ACJ83917.1|  unknown                                                 155   3e-45   
ref|XP_004968668.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    155   3e-45   
gb|AGO97081.1|  ubiquitin                                               155   3e-45   
ref|XP_009383724.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    155   3e-45   
emb|CDX79186.1|  BnaC06g21170D                                          155   3e-45   
ref|NP_001042915.1|  Os01g0328400                                       155   3e-45   
ref|XP_003535084.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    155   3e-45   
emb|CAA54603.1|  pentameric polyubiquitin                               160   3e-45   
gb|AFW66438.1|  putative ubiquitin family protein                       161   3e-45   
ref|XP_005056764.1|  PREDICTED: polyubiquitin-C-like isoform X2         157   3e-45   
ref|NP_001148453.1|  LOC100282068                                       161   3e-45   
ref|XP_006495490.1|  PREDICTED: polyubiquitin 4-like                    154   3e-45   
ref|XP_007855933.1|  ubiquitin                                          154   3e-45   
gb|AFK47245.1|  unknown                                                 157   3e-45   
dbj|BAN21697.1|  ubiquitin                                              156   3e-45   
ref|NP_001131602.1|  ubiquitin                                          155   3e-45   
emb|CAA80334.1|  ubiquitin extension protein                            155   3e-45   
ref|XP_002457768.1|  hypothetical protein SORBIDRAFT_03g013260          155   3e-45   
dbj|BAF00213.1|  polyubiquitin 4 UBQ4                                   161   3e-45   
ref|XP_009104378.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    155   3e-45   
ref|XP_004635917.1|  PREDICTED: polyubiquitin-B-like                    155   3e-45   
dbj|BAN64759.1|  polyubiquitin, putative                                155   3e-45   
ref|NP_566095.1|  ubiquitin-40S ribosomal protein S27a-2                155   3e-45   
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         160   3e-45   
ref|XP_006292019.1|  hypothetical protein CARUB_v10018208mg             155   3e-45   
ref|XP_003567648.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    155   3e-45   
gb|EMP26515.1|  Polyubiquitin-C                                         155   3e-45   



>emb|CAD56223.1| polyubiquitin [Cicer arietinum]
Length=89

 Score =   162 bits (410),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  10   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  69

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  70   DYNIQKESTLHLVLRLRGGF  89



>emb|CAC84144.1| polyubiquitin-like protein [Nicotiana tabacum]
Length=109

 Score =   162 bits (410),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  30   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  89

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  90   DYNIQKESTLHLVLRLRGGF  109


 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/27 (96%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -1

Query  196  EDGRTLADYNIQKESTLHLVLRLRGGF  116
            EDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  7    EDGRTLADYNIQKESTLHLVLRLRGGM  33



>ref|XP_007154497.1| hypothetical protein PHAVU_003G1236000g, partial [Phaseolus vulgaris]
 ref|XP_007154498.1| hypothetical protein PHAVU_003G1236000g, partial [Phaseolus vulgaris]
 gb|AAC08400.1| ubiquitin, partial [Mesembryanthemum crystallinum]
 gb|ESW26491.1| hypothetical protein PHAVU_003G1236000g, partial [Phaseolus vulgaris]
 gb|ESW26492.1| hypothetical protein PHAVU_003G1236000g, partial [Phaseolus vulgaris]
Length=111

 Score =   162 bits (410),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  91

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  92   DYNIQKESTLHLVLRLRGGF  111


 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -1

Query  220  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  35



>ref|NP_001190681.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_003626480.1| Ubiquitin-like protein [Medicago truncatula]
 ref|XP_008345057.1| PREDICTED: polyubiquitin [Malus domestica]
 ref|XP_009358112.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358113.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009345196.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009345209.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 gb|AAR83856.1| hexameric polyubiquitin 6PU11 [Capsicum annuum]
 emb|CAN77120.1| hypothetical protein VITISV_031666 [Vitis vinifera]
 gb|ACJ85770.1| unknown [Medicago truncatula]
 gb|AEE82471.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFK33927.1| unknown [Medicago truncatula]
 gb|AFK34391.1| unknown [Lotus japonicus]
 gb|AFP43342.1| polyubiquitin [Arabidopsis thaliana]
 gb|EPS65462.1| hypothetical protein M569_09314 [Genlisea aurea]
 gb|AHW29561.1| polyubiquitin [Picrorhiza kurrooa]
 emb|CDY46367.1| BnaA09g19810D [Brassica napus]
Length=153

 Score =   162 bits (411),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  134  DYNIQKESTLHLVLRLRGGF  153


 Score =   153 bits (387),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_004173717.1| PREDICTED: polyubiquitin-like, partial [Cucumis sativus]
Length=126

 Score =   162 bits (409),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  47   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  106

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  107  DYNIQKESTLHLVLRLRGGF  126


 Score = 96.3 bits (238),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -1

Query  256  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            +DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  4    EDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  50



>gb|ABC66105.1| putative pentameric polyubiquitin [Zinnia violacea]
Length=122

 Score =   161 bits (408),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  43   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  102

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  103  DYNIQKESTLHLVLRLRGGF  122


 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/46 (98%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  253  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  46



>gb|AAQ08999.1| polyubiquitin 2 [Phaseolus vulgaris]
Length=134

 Score =   162 bits (409),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  55   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  114

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  115  DYNIQKESTLHLVLRLRGGF  134


 Score =   118 bits (295),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = -1

Query  289  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  58



>gb|ADB85771.1| polyubiquitin-like protein [Wolffia arrhiza]
Length=114

 Score =   161 bits (407),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  35   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  94

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG+
Sbjct  95   DYNIQKESTLHLVLRLRGGY  114


 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -1

Query  229  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  38



>gb|AEI29169.1| ubiquitin-like protein [Vanilla planifolia]
Length=95

 Score =   160 bits (406),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  16   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  75

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  76   DYNIQKESTLHLVLRLRGGL  95



>emb|CAI51312.2| polyubiquitin [Capsicum chinense]
Length=153

 Score =   162 bits (411),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  134  DYNIQKESTLHLVLRLRGGF  153


 Score =   152 bits (383),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLR RGG 
Sbjct  61   IQKESTLHLVLRFRGGM  77



>gb|KGU30435.1| polyubiquitin, partial [Candida albicans P57055]
Length=97

 Score =   160 bits (405),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  18   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  77

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  78   DYNIQKESTLHLVLRLRGGF  97



>gb|AHI85710.1| stress-induced protein 5, partial [Capsicum annuum]
Length=169

 Score =   162 bits (411),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  90   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  149

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  150  DYNIQKESTLHLVLRLRGGF  169


 Score =   160 bits (404),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  14   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  73

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  74   DYNIQKESTLHLVLRLRGGM  93



>gb|AGZ90161.1| ubiquitin, partial [Litsea cubeba]
Length=103

 Score =   160 bits (405),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  17   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  76

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  77   DYNIQKESTLHLVLRLRGGM  96



>gb|KHC63620.1| polyubiquitin, partial [Candida albicans P75010]
Length=100

 Score =   160 bits (405),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  21   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  80

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  81   DYNIQKESTLHLVLRLRGGF  100


 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -1

Query  187  RTLADYNIQKESTLHLVLRLRGGF  116
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  1    RTLSDYNIQKESTLHLVLRLRGGM  24



>gb|ABC68439.1| putative polyubiquitin [Tragopogon dubius]
Length=90

 Score =   160 bits (404),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  10   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  69

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  70   DYNIQKESTLHLVLRLRGG  88



>dbj|BAK19068.1| ubiquitin [Ipomoea nil]
Length=121

 Score =   161 bits (407),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  8    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  67

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  68   DYNIQKESTLHLVLRLRGGM  87


 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  242
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
Sbjct  84   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  121



>gb|AAC39466.1| polyubiquitin [Arabidopsis thaliana]
Length=137

 Score =   161 bits (408),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  26   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  85

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  86   DYNIQKESTLHLVLRLRGGM  105


 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/36 (97%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  248
            RGGMQIFVKTLTGKTI+LEVESSDTIDNVKAKIQDK
Sbjct  102  RGGMQIFVKTLTGKTISLEVESSDTIDNVKAKIQDK  137


 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -1

Query  202  QLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    QLEDGRTLADYNIQKESTLHLVLRLRGGM  29



>gb|ABR25913.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=81

 Score =   159 bits (403),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  2    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  61

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  62   DYNIQKESTLHLVLRLRGG  80



>gb|ABD61727.1| polyubiquitin [Lupinus albus]
Length=132

 Score =   160 bits (406),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  91

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  92   DYNIQKESTLHLVLRLRGGM  111


 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -1

Query  220  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  35


 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/25 (100%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDT  281
            RGGMQIFVKTLTGKTITLEVESSDT
Sbjct  108  RGGMQIFVKTLTGKTITLEVESSDT  132



>gb|AEX13272.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13273.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13274.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13275.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13276.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13277.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13278.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13279.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13280.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13281.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13282.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13283.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13284.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13285.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13286.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13287.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13288.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13289.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13290.1| hypothetical protein CL958Contig1_06, partial [Pinus radiata]
Length=90

 Score =   159 bits (402),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  10   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  69

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  70   DYNIQKESTLHLVLRLRGGM  89



>gb|AAL33551.1|AF436850_1 polyubiquitin [Cucumis melo]
Length=143

 Score =   160 bits (406),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  37   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  96

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  97   DYNIQKESTLHLVLRLRGGM  116


 Score = 84.0 bits (206),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  235  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  40


 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKA  263
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  113  RGGMQIFVKTLTGKTITLEVESSDTIDNVKA  143



>gb|KHC36296.1| polyubiquitin, partial [Candida albicans P76067]
Length=114

 Score =   160 bits (404),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  35   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  94

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  95   DYNIQKESTLHLVLRLRGGF  114


 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -1

Query  229  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            QQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  1    QQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  38



>gb|KDN47865.1| Polyubiquitin, partial [Rhizoctonia solani AG-8 WAC10335]
Length=99

 Score =   159 bits (402),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  10   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  69

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  70   DYNIQKESTLHLVLRLRGGM  89



>gb|ABH06365.1| ubiquitin [Sorbus aucuparia]
Length=141

 Score =   160 bits (405),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  16   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  75

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  76   DYNIQKESTLHLVLRLRGGM  95


 Score =   102 bits (255),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  206
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  92   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  141



>gb|AGA61762.1| polyubiquitin 14, partial [Cornus kousa]
Length=139

 Score =   160 bits (405),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  60   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  119

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  120  DYNIQKESTLHLVLRLRGGL  139


 Score =   127 bits (319),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -1

Query  304  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  125
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  124  GGF  116
            GG 
Sbjct  61   GGM  63



>dbj|BAA85750.1| polyubiquitin [Cucumis melo]
Length=127

 Score =   160 bits (404),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  37   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  96

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  97   DYNIQKESTLHLVLRLRGGM  116


 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  235  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  40



>gb|AGZ80457.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80458.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80459.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80460.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80461.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80462.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80463.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80464.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80465.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80466.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80467.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80468.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80469.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80470.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80471.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80472.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80473.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80474.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80475.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80476.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80477.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
Length=132

 Score =   160 bits (404),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  7    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  66

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  67   DYNIQKESTLHLVLRLRGGM  86


 Score =   102 bits (254),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  206
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  83   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  132



>gb|ACZ69386.1| polyubiquitin UBQ14 [Cucumis sativus]
Length=197

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  118  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  177

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  178  DYNIQKESTLHLVLRLRGGF  197


 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  42   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  101

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  102  DYNIQKESTLHLVLRLRGGM  121


 Score = 94.0 bits (232),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -1

Query  250  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  45



>ref|XP_004976899.1| PREDICTED: polyubiquitin 3-like [Setaria italica]
Length=153

 Score =   160 bits (406),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGL  153


 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_009609090.1| PREDICTED: polyubiquitin 11, partial [Nicotiana tomentosiformis]
Length=174

 Score =   161 bits (407),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  66   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  125

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  126  DYNIQKESTLHLVLRLRGGM  145


 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/69 (99%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  322  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  143
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  1    TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  60

Query  142  LVLRLRGGF  116
            LVLRLRGG 
Sbjct  61   LVLRLRGGM  69


 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  257
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  142  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  174



>gb|AAM78180.1| putative polyubiquitin [Gossypium herbaceum]
 gb|AAM78181.1| putative polyubiquitin [Gossypium raimondii]
 gb|AAM78182.1| putative polyubiquitin [Gossypium barbadense]
 gb|AAM78183.1| putative polyubiquitin, partial [Gossypium barbadense]
 gb|AAM78184.1| putative polyubiquitin [Gossypioides kirkii]
Length=204

 Score =   162 bits (410),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  125  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  184

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  185  DYNIQKESTLHLVLRLRGGF  204


 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  49   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  108

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  109  DYNIQKESTLHLVLRLRGGM  128


 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/52 (98%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -1

Query  271  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  52



>gb|ADE06486.1| putative poly-ubiquitin [Tragopogon porrifolius]
Length=89

 Score =   158 bits (400),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  9    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  68

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKE+TLHLVLRLRGG
Sbjct  69   DYNIQKEATLHLVLRLRGG  87



>gb|ABH08753.1| ubiquitin [Arabidopsis thaliana]
Length=219

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  140  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  199

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  200  DYNIQKESTLHLVLRLRGGF  219


 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  64   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  123

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  124  DYNIQKESTLHLVLRLRGGM  143


 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/67 (99%), Positives = 66/67 (99%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  137
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  136  LRLRGGF  116
            LRLRGG 
Sbjct  61   LRLRGGM  67



>gb|AFU90137.2| polyubiquitin, partial [Paeonia lactiflora]
Length=166

 Score =   161 bits (407),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  55   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  114

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  115  DYNIQKESTLHLVLRLRGGM  134


 Score =   119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = -1

Query  289  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  58


 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/36 (100%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  248
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  131  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  166



>gb|ABH08755.1| ubiquitin [Arabidopsis thaliana]
Length=221

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  142  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  201

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  202  DYNIQKESTLHLVLRLRGGF  221


 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  66   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  125

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  126  DYNIQKESTLHLVLRLRGGM  145


 Score =   138 bits (347),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/69 (99%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  322  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  143
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  1    TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  60

Query  142  LVLRLRGGF  116
            LVLRLRGG 
Sbjct  61   LVLRLRGGM  69



>gb|KJB69254.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=162

 Score =   160 bits (406),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (389),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KDO51108.1| hypothetical protein CISIN_1g048350mg, partial [Citrus sinensis]
Length=119

 Score =   159 bits (402),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  39   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  98

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  99   DYNIQKESTLHLVLRLRGG  117


 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -1

Query  241  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  42



>emb|CCK72367.1| hypothetical protein KNAG_0J02880 [Kazachstania naganishii CBS 
8797]
 gb|KGR16822.1| polyubiquitin [Candida albicans P37037]
Length=153

 Score =   160 bits (405),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  134  DYNIQKESTLHLVLRLRGGF  153


 Score =   151 bits (381),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KIJ21593.1| hypothetical protein PAXINDRAFT_5754 [Paxillus involutus ATCC 
200175]
Length=109

 Score =   159 bits (401),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  30   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  89

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  90   DYNIQKESTLHLVLRLRGG  108


 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -1

Query  199  LEDGRTLADYNIQKESTLHLVLRLRGGF  116
            LEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  6    LEDGRTLSDYNIQKESTLHLVLRLRGGM  33



>gb|EGA61425.1| Ubi4p [Saccharomyces cerevisiae FostersO]
Length=131

 Score =   159 bits (403),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  21   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  80

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  81   DYNIQKESTLHLVLRLRGGM  100


 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  260
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+K
Sbjct  97   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSK  128


 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -1

Query  187  RTLADYNIQKESTLHLVLRLRGGF  116
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  1    RTLSDYNIQKESTLHLVLRLRGGM  24



>ref|XP_008809849.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=153

 Score =   160 bits (405),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   151 bits (382),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG PPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGXPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KEH31007.1| pentameric polyubiquitin [Medicago truncatula]
Length=214

 Score =   162 bits (410),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  135  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  194

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  195  DYNIQKESTLHLVLRLRGGF  214


 Score =   153 bits (386),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 64/80 (80%), Gaps = 15/80 (19%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLE               DKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLE---------------DKEGIPPDQQRLIFAGKQLEDGRTLA  118

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  119  DYNIQKESTLHLVLRLRGGM  138



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  210  DYNIQKESTLHLVLRLRGGF  229


 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVL LRGG 
Sbjct  61   IQKESTLHLVLXLRGGM  77



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  210  DYNIQKESTLHLVLRLRGGF  229


 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (383),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ABF06579.2| polyubiquitin, partial [Gladiolus grandiflorus]
Length=162

 Score =   160 bits (406),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_008246113.1| PREDICTED: polyubiquitin [Prunus mume]
Length=153

 Score =   160 bits (405),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGI  153


 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_004497490.1| PREDICTED: polyubiquitin 4-like [Cicer arietinum]
Length=154

 Score =   160 bits (405),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  210  DYNIQKESTLHLVLRLRGGF  229


 Score =   160 bits (404),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006495477.1| PREDICTED: polyubiquitin 3-like, partial [Citrus sinensis]
Length=164

 Score =   160 bits (406),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010931828.1| PREDICTED: polyubiquitin [Elaeis guineensis]
 gb|AFW66446.1| ubiquitin2 [Zea mays]
 gb|AFW70220.1| polyubiquitin-like protein [Zea mays]
Length=153

 Score =   160 bits (405),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010497209.1| PREDICTED: polyubiquitin, partial [Camelina sativa]
Length=147

 Score =   160 bits (404),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  67   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  126

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  127  DYNIQKESTLHLVLRLRGG  145


 Score =   139 bits (351),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = -1

Query  325  LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  146
            LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL
Sbjct  1    LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  60

Query  145  HLVLRLRGGF  116
            HLVLRLRGG 
Sbjct  61   HLVLRLRGGM  70



>ref|XP_009758989.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
Length=154

 Score =   160 bits (404),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAM63271.1| unknown [Arabidopsis thaliana]
Length=154

 Score =   160 bits (404),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (381),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_004501591.1| PREDICTED: polyubiquitin 4-like [Cicer arietinum]
Length=152

 Score =   160 bits (404),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_009419640.1| PREDICTED: polyubiquitin-like, partial [Musa acuminata subsp. 
malaccensis]
Length=145

 Score =   159 bits (403),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  66   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  125

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  126  DYNIQKESTLHLVLRLRGG  144


 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/69 (99%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  322  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  143
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  1    TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  60

Query  142  LVLRLRGGF  116
            LVLRLRGG 
Sbjct  61   LVLRLRGGM  69



>gb|KDO51107.1| hypothetical protein CISIN_1g038333mg, partial [Citrus sinensis]
Length=120

 Score =   159 bits (401),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  40   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  99

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  100  DYNIQKESTLHLVLRLRGG  118


 Score = 89.7 bits (221),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -1

Query  244  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  43



>ref|XP_007693173.1| hypothetical protein COCMIDRAFT_109160, partial [Bipolaris oryzae 
ATCC 44560]
 gb|EUC40302.1| hypothetical protein COCMIDRAFT_109160, partial [Bipolaris oryzae 
ATCC 44560]
Length=175

 Score =   160 bits (406),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  20   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  79

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  80   DYNIQKESTLHLVLRLRGGM  99


 Score =   160 bits (405),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  96   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  155

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  156  DYNIQKESTLHLVLRLRGG  174


 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  184  TLADYNIQKESTLHLVLRLRGGF  116
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  1    TLADYNIQKESTLHLVLRLRGGM  23



>tpg|DAA44273.1| TPA: Ubiquitin fusion protein [Zea mays]
Length=205

 Score =   161 bits (408),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF*IP  107
            DYNIQKESTLHLVLRLRGG   P
Sbjct  134  DYNIQKESTLHLVLRLRGGIIEP  156


 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006481837.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=130

 Score =   159 bits (402),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  50   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  109

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  110  DYNIQKESTLHLVLRLRGG  128


 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  262  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  5    KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  53



>gb|AEG78310.1| ubiquitin, partial [Cucurbita pepo]
Length=141

 Score =   159 bits (403),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  17   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  76

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKE+TLHLVLRLRGG 
Sbjct  77   DYNIQKETTLHLVLRLRGGM  96


 Score =   100 bits (249),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  209
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA
Sbjct  93   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  141



>sp|P0CG83.1|UBIQP_HORVU RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Hordeum vulgare]
 emb|CAA27751.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=171

 Score =   160 bits (405),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  16   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  75

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  76   DYNIQKESTLHLVLRLRGGM  95


 Score =   160 bits (404),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  92   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  151

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  152  DYNIQKESTLHLVLRLRGG  170



>gb|AFK46460.1| unknown [Medicago truncatula]
Length=153

 Score =   160 bits (404),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKE TLHLVLRLRGGF
Sbjct  134  DYNIQKEFTLHLVLRLRGGF  153


 Score =   153 bits (386),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ACB87918.1| polyubiquitin 3 [Malus domestica]
Length=188

 Score =   160 bits (406),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  70   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  129

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  130  DYNIQKESTLHLVLRLRGGM  149


 Score =   145 bits (366),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/73 (99%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = -1

Query  334  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  155
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  154  STLHLVLRLRGGF  116
            STLHLVLRLRGG 
Sbjct  61   STLHLVLRLRGGM  73


 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  227
            RGGMQ+FVKTLTG TITLEVE+SDTIDNVK KIQDKEGIPPDQ
Sbjct  146  RGGMQMFVKTLTGNTITLEVETSDTIDNVKDKIQDKEGIPPDQ  188



>gb|ACA58351.1| ubiquitin-like protein [Sandersonia aurantiaca]
Length=189

 Score =   160 bits (406),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (389),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  236
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189



>gb|ABI84246.1| polyubiquitin 10 [Arachis hypogaea]
Length=192

 Score =   161 bits (407),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (389),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/43 (100%), Positives = 43/43 (100%), Gaps = 0/43 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  227
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  192



>gb|AFJ04519.1| ubiquitin, partial [Vernicia fordii]
Length=176

 Score =   160 bits (405),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  21   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  80

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  81   DYNIQKESTLHLVLRLRGGM  100


 Score =   160 bits (404),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  97   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  156

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  157  DYNIQKESTLHLVLRLRGG  175


 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -1

Query  187  RTLADYNIQKESTLHLVLRLRGGF  116
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    RTLADYNIQKESTLHLVLRLRGGM  24



>emb|CCF36198.1| polyubiquitin, partial [Colletotrichum higginsianum]
Length=101

 Score =   158 bits (399),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  22   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  81

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  82   DYNIQKESTLHLVLRLRGG  100


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -1

Query  187  RTLADYNIQKESTLHLVLRLRGGF  116
            RTL+DYNIQKESTLHLVLRLRGG 
Sbjct  2    RTLSDYNIQKESTLHLVLRLRGGM  25



>gb|AIZ74336.1| polyubiquitin 4, partial [Pinus massoniana]
Length=107

 Score =   158 bits (399),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  30   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  89

Query  175  DYNIQKESTLHLVLRLRG  122
            DYNIQKESTLHLVLRLRG
Sbjct  90   DYNIQKESTLHLVLRLRG  107


 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  214  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  33



>gb|AFP44113.1| ubiquitin, partial [Lycoris longituba]
Length=187

 Score =   160 bits (406),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  61   DYNIQKESTLHLVLRLRGGM  80


 Score =   160 bits (406),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  77   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  136

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  137  DYNIQKESTLHLVLRLRGGM  156


 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  251
            RGGMQIFVKTLTGKTITLEVE SDTIDNVKAKIQD
Sbjct  153  RGGMQIFVKTLTGKTITLEVEGSDTIDNVKAKIQD  187



>gb|ABC68440.1| putative polyubiquitin [Tragopogon pratensis]
Length=90

 Score =   157 bits (398),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  10   RGGMQIFVKTLTGKTITLEVESSDTIDNVKXKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  69

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  70   DYNIQKESTLHLVLRLRGG  88



>gb|AIY85428.1| ubiquitin, partial [Elaeagnus umbellata]
Length=148

 Score =   159 bits (402),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG+QLEDGRTLA
Sbjct  29   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGRQLEDGRTLA  88

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  89   DYNIQKESTLHLVLRLRGGM  108


 Score = 90.1 bits (222),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  224
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  105  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  148


 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  211  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            AGKQ EDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    AGKQFEDGRTLADYNIQKESTLHLVLRLRGGM  32



>gb|AFJ93197.1| ubiquitin, partial [Eremosparton songoricum]
Length=142

 Score =   159 bits (402),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  18   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  77

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  78   DYNIQKESTLHLVLRLRGGM  97


 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  209
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFA
Sbjct  94   RGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFA  142



>gb|AAP40646.1| putative polyubiquitin [Gossypium barbadense]
Length=134

 Score =   159 bits (401),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLIFAGK+LEDGRTLA
Sbjct  55   RGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKELEDGRTLA  114

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  115  DYNIQKESTLHLVLRLRGGF  134


 Score =   117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = -1

Query  289  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            +DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    ADTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  58



>ref|XP_007154494.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26488.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=193

 Score =   160 bits (406),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (389),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  224
            RGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQ
Sbjct  150  RGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQ  193



>ref|XP_009420214.1| PREDICTED: polyubiquitin [Musa acuminata subsp. malaccensis]
Length=153

 Score =   159 bits (403),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAZ32851.1| pentameric polyubiquitin [Medicago sativa]
Length=189

 Score =   160 bits (406),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  20   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  79

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  80   DYNIQKESTLHLVLRLRGGM  99


 Score =   160 bits (406),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  96   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  155

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  156  DYNIQKESTLHLVLRLRGGM  175


 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  184  TLADYNIQKESTLHLVLRLRGGF  116
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  1    TLADYNIQKESTLHLVLRLRGGM  23



>gb|ABR25718.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=178

 Score =   160 bits (405),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  23   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  82

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  83   DYNIQKESTLHLVLRLRGGM  102


 Score =   160 bits (404),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  99   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  158

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  159  DYNIQKESTLHLVLRLRGG  177


 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/26 (96%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -1

Query  193  DGRTLADYNIQKESTLHLVLRLRGGF  116
            DGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    DGRTLADYNIQKESTLHLVLRLRGGM  26



>gb|ACT82769.1| polyubiquitin [Nicotiana tabacum]
Length=188

 Score =   160 bits (405),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  96   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  155

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  156  DYNIQKESTLHLVLRLRGGM  175


 Score =   159 bits (401),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  20   RGGLQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  79

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  80   DYNIQKESTLHLVLRLRGGM  99


 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  184  TLADYNIQKESTLHLVLRLRGGF  116
            TL DYNIQKESTLHLVLRLRGG 
Sbjct  1    TLPDYNIQKESTLHLVLRLRGGL  23



>gb|AAZ82816.1| ubiquitin monomer protein [Morus mongolica]
Length=152

 Score =   159 bits (402),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLV+RLRGG
Sbjct  134  DYNIQKESTLHLVIRLRGG  152


 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>pir||PS0380 ubiquitin precursor - rice (fragment)
 dbj|BAA02241.1| poly-ubiquitin [Oryza sativa Japonica Group]
Length=189

 Score =   160 bits (405),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  110  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  169

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  170  DYNIQKESTLHLVLRLRGGL  189


 Score =   160 bits (404),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  34   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  93

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  94   DYNIQKESTLHLVLRLRGGM  113


 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -1

Query  226  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  37



>ref|XP_001731772.1| hypothetical protein MGL_1040 [Malassezia globosa CBS 7966]
 gb|EDP44558.1| hypothetical protein MGL_1040 [Malassezia globosa CBS 7966]
Length=154

 Score =   159 bits (402),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   152 bits (385),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   161 bits (408),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG+
Sbjct  210  DYNIQKESTLHLVLRLRGGY  229


 Score =   160 bits (404),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   162 bits (411),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  185  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  244

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  245  DYNIQKESTLHLVLRLRGGF  264


 Score =   160 bits (404),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  33   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  92

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  93   DYNIQKESTLHLVLRLRGGM  112


 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  109  RGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  168

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  169  DYNIQKESTLHLVLRLRGGM  188



>ref|XP_009783162.1| PREDICTED: ubiquitin-like, partial [Nicotiana sylvestris]
Length=119

 Score =   158 bits (399),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+PPDQQRLIFAGKQLEDGRTLA
Sbjct  39   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGMPPDQQRLIFAGKQLEDGRTLA  98

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  99   DYNIQKESTLHLVLRLRGG  117


 Score = 86.7 bits (213),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -1

Query  241  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            IPPDQQRLIFAGKQLEDGRT+ADYNIQKESTLHLVLRLRGG 
Sbjct  1    IPPDQQRLIFAGKQLEDGRTIADYNIQKESTLHLVLRLRGGM  42



>emb|CAD27944.1| polyubiquitin-like [Oryza sativa]
Length=219

 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (383),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/76 (99%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = -1

Query  343  QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  164
            QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  2    QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  61

Query  163  QKESTLHLVLRLRGGF  116
            QKESTLHLVLRLRGG 
Sbjct  62   QKESTLHLVLRLRGGM  77


 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI    +RLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIHQTSKRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTL  146
            DYNIQKESTL
Sbjct  210  DYNIQKESTL  219



>gb|AFC36452.1| ubiquitin, partial [Anoectochilus roxburghii]
Length=214

 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  29   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  88

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  89   DYNIQKESTLHLVLRLRGGM  108


 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  105  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  164

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  165  DYNIQKESTLHLVLRLRGGM  184


 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  211  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    AGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  32


 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  254
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI+
Sbjct  181  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIR  214



>ref|XP_002389222.1| hypothetical protein MPER_11681 [Moniliophthora perniciosa FA553]
 gb|EEB90152.1| hypothetical protein MPER_11681 [Moniliophthora perniciosa FA553]
Length=153

 Score =   159 bits (401),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   152 bits (385),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_002957068.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ41870.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=153

 Score =   159 bits (401),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGL  153


 Score =   152 bits (384),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_002447145.1| hypothetical protein SORBIDRAFT_06g029360 [Sorghum bicolor]
 gb|EES11473.1| hypothetical protein SORBIDRAFT_06g029360 [Sorghum bicolor]
Length=153

 Score =   159 bits (401),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGK+ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKSITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   152 bits (384),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL+DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAL25813.1| polyubiquitin, partial [Prunus avium]
Length=154

 Score =   159 bits (401),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG PPDQQRLIFAGKQLEDGRTLA
Sbjct  75   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTPPDQQRLIFAGKQLEDGRTLA  134

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQ+ESTLHLVLRLRGGF
Sbjct  135  DYNIQEESTLHLVLRLRGGF  154


 Score =   155 bits (393),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 77/78 (99%), Gaps = 0/78 (0%)
 Frame = -1

Query  349  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  170
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  1    GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  60

Query  169  NIQKESTLHLVLRLRGGF  116
            NIQKESTLHLVLRLRGG 
Sbjct  61   NIQKESTLHLVLRLRGGM  78



>emb|CAA72800.1| polyubiquitin precursor, partial [Suberites domuncula]
Length=147

 Score =   159 bits (401),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  68   RGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  127

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  128  DYNIQKESTLHLVLRLRGGF  147


 Score =   137 bits (346),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/71 (94%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -1

Query  328  TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEST  149
            TLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKEST
Sbjct  1    TLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST  60

Query  148  LHLVLRLRGGF  116
            LHLVLRLRGG 
Sbjct  61   LHLVLRLRGGM  71



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  198  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  257

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  258  DYNIQKESTLHLVLRLRGGF  277


 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  122  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  181

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  182  DYNIQKESTLHLVLRLRGGM  201


 Score =   153 bits (387),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  46   RIKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  105

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  106  DYNIQKESTLHLVLRLRGGM  125



>ref|XP_008439961.1| PREDICTED: polyubiquitin-like [Cucumis melo]
Length=157

 Score =   159 bits (402),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  81   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  140

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGGF
Sbjct  141  IQKESTLHLVLRLRGGF  157



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF*IP*CPN  95
            DYNIQKESTLHLVLRLRGG  +  C N
Sbjct  210  DYNIQKESTLHLVLRLRGGALMQWCLN  236


 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CBI23934.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   160 bits (405),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  97   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  156

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  157  DYNIQKESTLHLVLRLRGGM  176


 Score =   140 bits (354),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 76/100 (76%), Gaps = 23/100 (23%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI-----------------------P  236
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI                       P
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQSSDTIDNVKAKIQDKEGIP  60

Query  235  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  100



>gb|EYU19679.1| hypothetical protein MIMGU_mgv1a015002mg [Erythranthe guttata]
Length=171

 Score =   159 bits (402),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            +G MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  41   KGKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  100

Query  175  DYNIQKESTLHLVLRLRGGF*IP  107
            DYNIQKESTLHLVLRLRGG   P
Sbjct  101  DYNIQKESTLHLVLRLRGGIIEP  123



>gb|AFW66442.1| putative ubiquitin family protein, partial [Zea mays]
Length=216

 Score =   160 bits (406),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (388),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   136 bits (343),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/67 (100%), Positives = 67/67 (100%), Gaps = 0/67 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKE  155
            DYNIQKE
Sbjct  210  DYNIQKE  216



>ref|XP_001701379.1| bi-ubiquitin, major isoform [Chlamydomonas reinhardtii]
 gb|EDO97495.1| bi-ubiquitin, major isoform [Chlamydomonas reinhardtii]
Length=153

 Score =   159 bits (401),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   152 bits (384),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAB36546.1| polyubiquitin [Phaseolus vulgaris]
Length=215

 Score =   160 bits (406),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  136  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  195

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  196  DYNIQKESTLHLVLRLRGGL  215


 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  60   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  119

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  120  DYNIQKESTLHLVLRLRGGM  139


 Score =   127 bits (320),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -1

Query  304  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  125
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  124  GGF  116
            GG 
Sbjct  61   GGM  63



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  191  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  250

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  251  DYNIQKESTLHLVLRLRGGF  270


 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  39   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  98

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  99   DYNIQKESTLHLVLRLRGGM  118


 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  115  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  174

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  175  DYNIQKESTLHLVLRLRGGM  194


 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -1

Query  241  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  42



>ref|XP_003619702.1| Ubiquitin-like protein [Medicago truncatula]
Length=245

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  125  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  184

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  185  DYNIQKESTLHLVLRLRGGM  204


 Score =   154 bits (390),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  52   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  111

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  112  IQKESTLHLVLRLRGGM  128


 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  236
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  201  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  190  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  249

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  250  DYNIQKESTLHLVLRLRGGF  269


 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  114  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  173

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  174  DYNIQKESTLHLVLRLRGGM  193


 Score =   153 bits (386),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  41   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  100

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  101  IQKESTLHLVLRLRGGM  117



>ref|XP_009412006.1| PREDICTED: polyubiquitin 11-like [Musa acuminata subsp. malaccensis]
Length=231

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  76   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  135

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  136  DYNIQKESTLHLVLRLRGGM  155


 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  62

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  63   IQKESTLHLVLRLRGGM  79


 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNV             QQRLIFAGKQLEDGRTLA
Sbjct  152  RGGMQIFVKTLTGKTITLEVESSDTIDNVXXXXXXXXXXXXXQQRLIFAGKQLEDGRTLA  211

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  212  DYNIQKESTLHLVLRLRGG  230



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  195  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  254

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  255  DYNIQKESTLHLVLRLRGGF  274


 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  43   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  102

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  103  DYNIQKESTLHLVLRLRGGM  122


 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  119  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  178

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  179  DYNIQKESTLHLVLRLRGGM  198


 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/46 (98%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  253  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  46



>gb|AAF31707.1|AF221858_1 polyubiquitin [Euphorbia esula]
Length=215

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  60   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  119

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  120  DYNIQKESTLHLVLRLRGGM  139


 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  136  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  195

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  196  DYNIQKESTLHLVLRLRGG  214


 Score =   127 bits (320),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -1

Query  304  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  125
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  124  GGF  116
            GG 
Sbjct  61   GGM  63



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLR  125
            DYNIQKESTLHLVLRLR
Sbjct  210  DYNIQKESTLHLVLRLR  226


 Score =   154 bits (389),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|NP_001235900.1| polyubiquitin [Glycine max]
 ref|XP_004173651.1| PREDICTED: ubiquitin-like [Cucumis sativus]
 ref|XP_006377836.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 sp|P69313.2|UBIQ_HELAN RecName: Full=Ubiquitin; Flags: Precursor [Helianthus annuus]
 sp|P69317.2|UBIQ_LUPPO RecName: Full=Ubiquitin; Flags: Precursor [Lupinus polyphyllus]
 emb|CAA31627.1| unnamed protein product [Glycine max]
 emb|CAA32511.1| unnamed protein product [Helianthus annuus]
 emb|CAA38256.1| ubiquitin [Lupinus polyphyllus]
 gb|AAR83892.1| polyubiquitin 4.4 [Capsicum annuum]
 gb|ERP55633.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|KDP42861.1| hypothetical protein JCGZ_23803 [Jatropha curcas]
Length=77

 Score =   155 bits (393),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGGF
Sbjct  61   IQKESTLHLVLRLRGGF  77



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  285

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  286  DYNIQKESTLHLVLRLRGGF  305


 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDERTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (388),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ABV58641.1| ubiquitin, partial [Catharanthus roseus]
Length=137

 Score =   157 bits (398),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  51   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  110

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNI KESTLHLVLRLRGG 
Sbjct  111  DYNIXKESTLHLVLRLRGGM  130


 Score =   111 bits (277),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/54 (98%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -1

Query  277  DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  54



>gb|AAZ08412.1| polyubiquitin [Populus alba]
Length=139

 Score =   158 bits (399),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  31   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  90

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKEST HLVLRLRGG 
Sbjct  91   DYNIQKESTPHLVLRLRGGM  110


 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  257
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  107  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  139


 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  217  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
               GKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    FLLGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  34



>gb|ABH08754.1| ubiquitin [Arabidopsis thaliana]
Length=220

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  64   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  123

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  124  DYNIQKESTLHLVLRLRGGM  143


 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  140  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  199

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  200  DYNIQKESTLHLVLRLRGG  218


 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/67 (99%), Positives = 66/67 (99%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  137
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  136  LRLRGGF  116
            LRLRGG 
Sbjct  61   LRLRGGM  67



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  285

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  286  DYNIQKESTLHLVLRLRGGF  305


 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003619701.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES75919.1| pentameric polyubiquitin [Medicago truncatula]
Length=290

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  211  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  270

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  271  DYNIQKESTLHLVLRLRGGF  290


 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (387),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 62/80 (78%), Gaps = 15/80 (19%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE                G PPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVE---------------RGYPPDQQRLIFAGKQLEDGRTLA  194

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  195  DYNIQKESTLHLVLRLRGGM  214



>dbj|GAC77607.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAK66521.1| ubiquitin domain containing protein [Pseudozyma antarctica]
Length=228

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (389),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF*I  110
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>ref|XP_010938173.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis 
guineensis]
Length=232

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*I  110
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/76 (99%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRL  128
            DYNIQKESTLHLVLR 
Sbjct  210  DYNIQKESTLHLVLRF  225



>emb|CAG28691.1| polyubiquitin [Fusarium fujikuroi]
Length=116

 Score =   157 bits (396),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  37   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  96

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  97   DYNIQKESTLHLVLRLRGG  115


 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  235  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            PDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  1    PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  40



>ref|XP_010228848.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Brachypodium 
distachyon]
Length=209

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL+DGRTLA
Sbjct  75   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGRTLA  134

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  135  DYNIQKESTLHLVLRLRGG  153


 Score =   133 bits (334),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVE+SDT+ NVKAKIQDKEGIPP+QQRLIF GKQLE+G TLADY 
Sbjct  1    MQIFVKTLTGKTITLEVETSDTVANVKAKIQDKEGIPPEQQRLIFTGKQLEEGDTLADYG  60

Query  166  -IQKESTLHLVLRLRGGF  116
             I KESTLHLVLRLRGG 
Sbjct  61   IIHKESTLHLVLRLRGGM  78



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  217  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  276

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  277  DYNIQKESTLHLVLRLRGGF  296


 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  65   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  124

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  125  DYNIQKESTLHLVLRLRGGM  144


 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  141  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  200

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  201  DYNIQKESTLHLVLRLRGGM  220


 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/68 (99%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = -1

Query  319  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  140
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  139  VLRLRGGF  116
            VLRLRGG 
Sbjct  61   VLRLRGGM  68



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  285

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  286  DYNIQKESTLHLVLRLRGGF  305


 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR IFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (387),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|EEC81189.1| hypothetical protein OsI_24195 [Oryza sativa Indica Group]
Length=223

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  68   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  127

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  128  DYNIQKESTLHLVLRLRGGM  147


 Score =   160 bits (404),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  144  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  203

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  204  DYNIQKESTLHLVLRLRGG  222


 Score =   127 bits (320),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -1

Query  307  TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  128
            T EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL
Sbjct  8    TCEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  67

Query  127  RGGF  116
            RGG 
Sbjct  68   RGGM  71



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  285

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  286  DYNIQKESTLHLVLRLRGGF  305


 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  285

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  286  DYNIQKESTLHLVLRLRGGF  305


 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG QLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (387),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  285

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  286  DYNIQKESTLHLVLRLRGGF  305


 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   153 bits (387),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGL  229


 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   154 bits (388),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  285

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  286  DYNIQKESTLHLVLRLRGGF  305


 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  285

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  286  DYNIQKESTLHLVLRLRGGF  305


 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   159 bits (401),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (387),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ABR25697.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=201

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  46   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  105

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  106  DYNIQKESTLHLVLRLRGGM  125


 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  122  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  181

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  182  DYNIQKESTLHLVLRLRGG  200


 Score = 99.4 bits (246),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  262  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG 
Sbjct  1    KIQDKEGIPPDQQRLIFAGKQLEDGRTLXDYNIQKESTLHLVLRLRGGM  49



>ref|XP_010069740.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus 
grandis]
Length=232

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (389),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*I  110
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  63   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  122

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  123  DYNIQKESTLHLVLRLRGGM  142


 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  139  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  198

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  199  DYNIQKESTLHLVLRLRGGM  218


 Score =   132 bits (331),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  313  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  134
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  133  RLRGGF  116
            RLRGG 
Sbjct  61   RLRGGM  66


 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVK  266
            RGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  215  RGGMQIFVKTLTGKTITLEVENSDTIDNVK  244



>dbj|GAC94856.1| ubiquitin [Pseudozyma hubeiensis SY62]
Length=228

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (389),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF*I  110
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   152 bits (383),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLV RLRGG 
Sbjct  61   IQKESTLHLVXRLRGGM  77



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AGA61761.1| polyubuquitin 10, partial [Cornus kousa]
Length=172

 Score =   159 bits (401),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  45   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  104

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  105  DYNIQKESTLHLVLRLRGGM  124


 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -1

Query  259  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  48


 Score = 98.2 bits (243),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  209
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG PPDQQRLIFA
Sbjct  121  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTPPDQQRLIFA  169



>sp|P0CG73.1|UBI1P_CANAX RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Candida albicans]
 gb|AAA84868.1| ubiquitin precursor [Candida albicans]
Length=229

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  210  DYNIQKESTLHLVLRLRGGF  229


 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   149 bits (375),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLR RGG 
Sbjct  61   IQKESTLHLVLRSRGGM  77



>ref|XP_007873662.1| hypothetical protein PNEG_01699 [Pneumocystis murina B123]
 gb|EMR09940.1| hypothetical protein PNEG_01699 [Pneumocystis murina B123]
Length=153

 Score =   158 bits (399),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (382),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (404),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (404),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (404),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  210  DYNIQKESTLHLVLRLRGGF  229


 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQK+STLHLVLRLRGG
Sbjct  210  DYNIQKDSTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGI  229


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003648495.1| hypothetical protein Ecym_8408 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET41678.1| Hypothetical protein Ecym_8408 [Eremothecium cymbalariae DBVPG#7215]
Length=153

 Score =   158 bits (399),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (382),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  260
            RGGMQIFVKT TGKTITLE ESSDTIDNVKAK
Sbjct  226  RGGMQIFVKTXTGKTITLEXESSDTIDNVKAK  257



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  210  DYNIQKESTLHLVLRLRGGF  229


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AIS71924.1| polyubiquitin [Mangifera indica]
Length=229

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLH VLRLRGG 
Sbjct  61   IQKESTLHRVLRLRGGM  77


 Score =   117 bits (294),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  182
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  207



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  174  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  233

Query  175  DYNIQKESTLHLVLRLRGGF*IP*CPN  95
            DYNIQKESTLHLVLRLRGG  +  C N
Sbjct  234  DYNIQKESTLHLVLRLRGGALMQWCLN  260


 Score =   160 bits (404),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  98   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  157

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  158  DYNIQKESTLHLVLRLRGGM  177


 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  22   RKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  81

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  82   DYNIQKESTLHLVLRLRGGM  101



>ref|XP_011390959.1| putative polyubiquitin [Ustilago maydis 521]
 gb|KIS67457.1| putative polyubiquitin [Ustilago maydis 521]
Length=228

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   154 bits (388),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF*I  110
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  210  DYNIQKESTLHLVLRLRGGF  229


 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKE+ LHLVLRLRGG 
Sbjct  61   IQKETNLHLVLRLRGGM  77



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_007442551.1| PREDICTED: polyubiquitin-C-like, partial [Python bivittatus]
Length=150

 Score =   157 bits (398),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  71   RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  130

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  131  DYNIQKESTLHLVLRLRGGF  150


 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  337  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  158
            FVKTLTGKT TL VE SDTI+N KAKIQDKEGIPPDQQRLIFAGKQLEDG TL+D  IQK
Sbjct  1    FVKTLTGKTTTLAVEPSDTIENAKAKIQDKEGIPPDQQRLIFAGKQLEDGSTLSDEGIQK  60

Query  157  ESTLHLVLRLRGGF  116
            ESTLHLVLRLRGG 
Sbjct  61   ESTLHLVLRLRGGM  74



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  229  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  288

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  289  DYNIQKESTLHLVLRLRGGF  308


 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  61   DYNIQKESTLHLVLRLRGGM  80


 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  77   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  136

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  137  DYNIQKESTLHLVLRLRGGM  156


 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  153  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  212

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  213  DYNIQKESTLHLVLRLRGGM  232



>emb|CAI83759.1| Polyubiqutin 6 [Polyplastron multivesiculatum]
Length=81

 Score =   155 bits (392),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLA
Sbjct  2    RGGMQIFVKTLTGKTITLEVEPSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDNRTLA  61

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  62   DYNIQKESTLHLVLRLRGG  80



>emb|CCF48657.1| probable polyubiquitin [Ustilago hordei]
Length=228

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/79 (95%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEPSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF*I  110
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>gb|EHN01342.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EIW08781.1| Ubi4p [Saccharomyces cerevisiae CEN.PK113-7D]
Length=153

 Score =   157 bits (398),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (382),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTL LVLRLRGGF
Sbjct  210  DYNIQKESTLPLVLRLRGGF  229


 Score =   152 bits (383),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGL  229


 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ERG83124.1| polyubiquitin-a [Ascaris suum]
Length=153

 Score =   157 bits (398),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG+
Sbjct  134  DYNIQKESTLHLVLRLRGGY  153


 Score =   150 bits (378),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KIY97324.1| ubiquitin C, partial [Monoraphidium neglectum]
Length=186

 Score =   159 bits (401),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (383),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  245
            RGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKE
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKE  186



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|EWZ87538.1| ubiquitin C [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXM08999.1| ubiquitin C [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
Length=153

 Score =   157 bits (398),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (382),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAR32784.1| polyubiquitin [Clusia minor]
Length=223

 Score =   160 bits (404),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  26   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  85

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  86   DYNIQKESTLHLVLRLRGGM  105


 Score =   160 bits (404),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  102  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  161

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  162  DYNIQKESTLHLVLRLRGGM  181


 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -1

Query  202  QLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    QLEDGRTLADYNIQKESTLHLVLRLRGGM  29


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITL-EVESSDTIDNVKAKIQDKEGIP  236
            RGGMQIFVKTLTGK      V +   +  VKAKIQDKEGIP
Sbjct  178  RGGMQIFVKTLTGKDHHFWXVRTPIPLIMVKAKIQDKEGIP  218



>emb|CAI83756.1| Polyubiqutin 3 [Polyplastron multivesiculatum]
Length=84

 Score =   155 bits (392),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLA
Sbjct  5    RGGMQIFVKTLTGKTITLEVEPSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDNRTLA  64

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  65   DYNIQKESTLHLVLRLRGG  83



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   160 bits (404),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVK L GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  210  DYNIQKESTLHLVLRLRGGF  229


 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003687789.1| hypothetical protein TPHA_0K02250 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE65355.1| hypothetical protein TPHA_0K02250 [Tetrapisispora phaffii CBS 
4417]
Length=153

 Score =   157 bits (398),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (382),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  18   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  77

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  78   DYNIQKESTLHLVLRLRGGM  97


 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLA
Sbjct  94   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLA  153

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  154  DYNIQKESTLHLVLRLRGGM  173


 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  170  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  229

Query  175  DYNIQKESTLHLVLRLRGG  119
             YNIQKESTLHLVLRLRGG
Sbjct  230  VYNIQKESTLHLVLRLRGG  248



>gb|AFK73707.1| ubiquitin [Ostrea edulis]
Length=153

 Score =   157 bits (398),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  134  DYNIQKESTLHLVLRLRGGF  153


 Score =   147 bits (370),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPD+QRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDRQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|EIE85715.1| polyubiquitin [Rhizopus delemar RA 99-880]
Length=230

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (382),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSD+IDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDSIDNVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF*I  110
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>gb|KDQ31335.1| hypothetical protein PLEOSDRAFT_1082432 [Pleurotus ostreatus 
PC15]
Length=214

 Score =   159 bits (403),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  135  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  194

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  195  DYNIQKESTLHLVLRLRGGL  214


 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTL++YN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNDKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSEYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   115 bits (288),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 63/80 (79%), Gaps = 15/80 (19%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDN               QRLIFAGKQLEDG TL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDN---------------QRLIFAGKQLEDGCTLS  118

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  119  DYNIQKESTLHLVLRLRGGM  138



>ref|XP_005056765.1| PREDICTED: polyubiquitin-C-like isoform X3 [Ficedula albicollis]
 ref|XP_010217878.1| PREDICTED: polyubiquitin-B isoform X2 [Tinamus guttatus]
 ref|XP_010217879.1| PREDICTED: polyubiquitin-B isoform X3 [Tinamus guttatus]
Length=153

 Score =   157 bits (398),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  134  DYNIQKESTLHLVLRLRGGF  153


 Score =   148 bits (374),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AGZ15412.1| fiber polyubiquitin [Phaseolus vulgaris]
Length=229

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   146 bits (368),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESFDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKE TL LVL  RGGF
Sbjct  210  DYNIQKEFTLPLVLCFRGGF  229



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (403),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   152 bits (383),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>emb|CAL30085.1| polyubiquitin [Globodera pallida]
Length=154

 Score =   157 bits (398),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (381),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KDP23292.1| hypothetical protein JCGZ_23125 [Jatropha curcas]
Length=153

 Score =   157 bits (398),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT A
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTHA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGI  153


 Score =   153 bits (387),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|ADC29516.1| polyubiquitin [Citrus sinensis]
 gb|AFB18313.1| ubiquitin, partial [Citrus maxima]
Length=106

 Score =   156 bits (394),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  30   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  89

Query  175  DYNIQKESTLHLVLRLR  125
            DYNIQKESTLHLVLRLR
Sbjct  90   DYNIQKESTLHLVLRLR  106


 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  214  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  33



>ref|XP_005067919.1| PREDICTED: polyubiquitin-B [Mesocricetus auratus]
Length=125

 Score =   156 bits (395),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  46   RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  105

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG+
Sbjct  106  DYNIQKESTLHLVLRLRGGY  125



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   162 bits (410),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   162 bits (410),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  245
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK+
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   160 bits (405),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  18   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  77

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  78   DYNIQKESTLHLVLRLRGGM  97


 Score =   160 bits (405),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  94   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  153

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  154  DYNIQKESTLHLVLRLRGGM  173


 Score =   160 bits (405),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  170  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  229

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  230  DYNIQKESTLHLVLRLRGG  248



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   160 bits (406),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (406),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/28 (100%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDN  272
            RGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDN  253



>gb|EIE88012.1| polyubiquitin [Rhizopus delemar RA 99-880]
Length=231

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSD+IDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDSIDNVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF*I  110
            IQKESTLHLVLRLRGG  I
Sbjct  61   IQKESTLHLVLRLRGGMQI  79



>ref|XP_007039159.1| Ubiquitin supergroup,Ribosomal protein L40e [Theobroma cacao]
 gb|EOY23660.1| Ubiquitin supergroup,Ribosomal protein L40e [Theobroma cacao]
Length=151

 Score =   157 bits (397),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  24   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  83

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  84   IQKESTLHLVLRLRGGIIEP  103



>emb|CCA26421.1| ubiquitinribosomal fusion protein putative [Albugo laibachii 
Nc14]
Length=128

 Score =   156 bits (395),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGG  119
            IQKESTLHLVLRLRGG
Sbjct  61   IQKESTLHLVLRLRGG  76



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  186  RGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  245

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  246  DYNIQKESTLHLVLRLRGGF  265


 Score =   160 bits (404),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  34   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  93

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  94   DYNIQKESTLHLVLRLRGGM  113


 Score =   160 bits (404),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  110  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  169

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  170  DYNIQKESTLHLVLRLRGGM  189


 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -1

Query  226  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  37



>gb|KIR83632.1| polyubiquitin, partial [Cryptococcus gattii IND107]
Length=218

 Score =   159 bits (402),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  63   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  122

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  123  DYNIQKESTLHLVLRLRGGM  142


 Score =   159 bits (401),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  139  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  198

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  199  DYNIQKESTLHLVLRLRGG  217


 Score =   131 bits (330),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  313  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  134
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVL
Sbjct  1    TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  60

Query  133  RLRGGF  116
            RLRGG 
Sbjct  61   RLRGGM  66



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  224
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  269



>gb|EJW05300.1| polyubiquitin [Edhazardia aedis USNM 41457]
Length=153

 Score =   157 bits (397),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITL+VESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLDVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG+
Sbjct  134  DYNIQKESTLHLVLRLRGGY  153


 Score =   149 bits (376),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITL+VESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLDVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  285

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  286  DYNIQKESTLHLVLRLRGGF  305


 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>dbj|BAA76889.1| ubiquitin [Trichophyton mentagrophytes]
 dbj|BAA88168.1| ubiquitin [Arthroderma otae]
Length=153

 Score =   157 bits (397),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   150 bits (380),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   161 bits (407),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  94   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  153

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  154  DYNIQKESTLHLVLRLRGGM  173


 Score =   161 bits (407),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  170  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  229

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  230  DYNIQKESTLHLVLRLRGGM  249


 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  81   IQKESTLHLVLRLRGGM  97


 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/36 (97%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  248
            RGGMQIFVKTLTGKTITLEV SSDTIDNVKAKIQDK
Sbjct  246  RGGMQIFVKTLTGKTITLEVASSDTIDNVKAKIQDK  281



>ref|XP_001830230.1| ubiquitin [Coprinopsis cinerea okayama7#130]
 gb|EAU91601.1| ubiquitin [Coprinopsis cinerea okayama7#130]
Length=305

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  285

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  286  DYNIQKESTLHLVLRLRGGF  305


 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003494613.1| PREDICTED: polyubiquitin-A-like, partial [Bombus impatiens]
Length=136

 Score =   156 bits (395),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQR+IFAGKQLEDGRTL+
Sbjct  29   RGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRVIFAGKQLEDGRTLS  88

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  89   DYNIQKESTLHLVLRLRGGM  108


 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  211  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            AGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  1    AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  32


 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  260
            RGGMQIFVKTLTGKTITLEVE+SDTI+NVKAK
Sbjct  105  RGGMQIFVKTLTGKTITLEVEASDTIENVKAK  136



>ref|XP_006373839.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
 gb|ERP51636.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
Length=101

 Score =   155 bits (392),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGI  77



>ref|XP_002465593.1| hypothetical protein SORBIDRAFT_01g041800 [Sorghum bicolor]
 ref|XP_002459842.1| hypothetical protein SORBIDRAFT_02g012040 [Sorghum bicolor]
 ref|XP_004956212.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2-like [Setaria 
italica]
 ref|XP_004985089.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2-like [Setaria 
italica]
 ref|XP_008653176.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 isoform X2 [Zea 
mays]
 ref|XP_008653188.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 [Zea mays]
 ref|XP_008670036.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 [Zea mays]
 gb|ACG24452.1| ubiquitin fusion protein [Zea mays]
 gb|ACG24619.1| ubiquitin fusion protein [Zea mays]
 gb|ACG25216.1| ubiquitin fusion protein [Zea mays]
 gb|ACG27388.1| ubiquitin fusion protein [Zea mays]
 gb|ACG30617.1| ubiquitin fusion protein [Zea mays]
 gb|ACG38853.1| ubiquitin fusion protein [Zea mays]
 gb|ACG39323.1| ubiquitin fusion protein [Zea mays]
 gb|ACN25894.1| unknown [Zea mays]
 gb|EER92591.1| hypothetical protein SORBIDRAFT_01g041800 [Sorghum bicolor]
 gb|EER96363.1| hypothetical protein SORBIDRAFT_02g012040 [Sorghum bicolor]
 tpg|DAA39608.1| TPA: Ubiquitin fusion protein [Zea mays]
 tpg|DAA44269.1| TPA: Ubiquitin fusion protein [Zea mays]
 tpg|DAA44272.1| TPA: Ubiquitin fusion protein [Zea mays]
Length=129

 Score =   156 bits (394),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>gb|KFP83235.1| Polyubiquitin-C, partial [Acanthisitta chloris]
Length=93

 Score =   155 bits (391),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  15   RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  74

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  75   DYNIQKESTLHLVLRLRGG  93



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  226  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  285

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG+
Sbjct  286  DYNIQKESTLHLVLRLRGGY  305


 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   153 bits (387),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   159 bits (402),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (402),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   159 bits (402),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   157 bits (398),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   151 bits (382),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>pir||S42643 ubiquitin / ribosomal protein S27a - potato (fragment)
Length=126

 Score =   156 bits (394),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            +  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  43   QAKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  102

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  103  DYNIQKESTLHLVLRLRGG  121



>gb|AEL23099.1| ubiquitin [Cherax quadricarinatus]
Length=99

 Score =   155 bits (392),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  20   RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  79

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  80   DYNIQKESTLHLVLRLRGG  98


 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  184  TLADYNIQKESTLHLVLRLRGGF  116
            TL+DYNIQKESTLHLVLRLRGG 
Sbjct  1    TLSDYNIQKESTLHLVLRLRGGM  23



>emb|CAC94926.1| putative ubiquitin [Pleurotus sp. 'Florida']
Length=243

 Score =   159 bits (403),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  55   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  114

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  115  DYNIQKESTLHLVLRLRGGM  134


 Score =   159 bits (403),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  131  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  190

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  191  DYNIQKESTLHLVLRLRGGM  210


 Score =   118 bits (296),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = -1

Query  289  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  58


 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  260
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKA+
Sbjct  207  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAR  238



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   159 bits (402),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (402),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   159 bits (402),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (402),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   159 bits (402),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (402),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>dbj|BAE48510.1| polyubiquitin [Raphidiophrys contractilis]
Length=173

 Score =   157 bits (398),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSD+I+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  67   RGGMQIFVKTLTGKTITLEVESSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  126

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  127  DYNIQKESTLHLVLRLRGGM  146


 Score =   137 bits (344),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = -1

Query  325  LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  146
            LTGKTITLEVESSD+I+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTL
Sbjct  1    LTGKTITLEVESSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL  60

Query  145  HLVLRLRGGF  116
            HLVLRLRGG 
Sbjct  61   HLVLRLRGGM  70


 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKA  263
            RGGMQIFVKTLTGKTITLEVESSD+I+NVKA
Sbjct  143  RGGMQIFVKTLTGKTITLEVESSDSIENVKA  173



>ref|XP_010480024.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=308

 Score =   161 bits (408),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  76   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  135

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  136  DYNIQKESTLHLVLRLRGGM  155


 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGI PDQQRLIFAGKQLEDGRTLA
Sbjct  152  RGGMQIFVKTLTGKTITLEVESSDTIDSVKAKIQDKEGITPDQQRLIFAGKQLEDGRTLA  211

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  212  DYNIQKESTLHLVLRLRGGM  231


 Score =   135 bits (340),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 72/81 (89%), Gaps = 1/81 (1%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVK+L GKTITLEVESSDTI NVKAK QDKEGIPP  Q+L+FA KQLEDGRTLA
Sbjct  228  RGGMQIFVKSLAGKTITLEVESSDTIYNVKAKFQDKEGIPPVLQKLLFARKQLEDGRTLA  287

Query  175  DYNIQKESTLHLVLRL-RGGF  116
            DYNIQKESTLHLVLRL  G F
Sbjct  288  DYNIQKESTLHLVLRLGHGSF  308


 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -1

Query  349  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  170
             M I+ KTLT KTI L+VESSDTI NVKAKIQDKEGIP DQQRLIF+GK LEDGRTLADY
Sbjct  2    SMIIYAKTLTEKTIALDVESSDTISNVKAKIQDKEGIPLDQQRLIFSGKLLEDGRTLADY  61

Query  169  NIQKESTLHLVLRLRGGF  116
            +IQK STLHL LRLRGG 
Sbjct  62   SIQKHSTLHLTLRLRGGM  79



>gb|AAZ66786.1| polyubiquitin [Ictalurus punctatus]
Length=85

 Score =   154 bits (390),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  6    RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  65

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  66   DYNIQKESTLHLVLRLRGG  84



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   159 bits (402),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (401),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>dbj|BAH70616.1| ACYPI007765 [Acyrthosiphon pisum]
Length=153

 Score =   157 bits (396),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSD+I+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   150 bits (379),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSD+I+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   159 bits (402),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (401),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>sp|P51423.2|RL40_BRARP RecName: Full=Ubiquitin-60S ribosomal protein L40; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=60S ribosomal 
protein L40; AltName: Full=CEP52; Flags: Precursor [Brassica 
rapa subsp. pekinensis]
 gb|AAA33014.1| ubiquitin/ribosomal protein [Brassica rapa]
 emb|CAA80863.1| ubiquitin/ribosomal protein [Brassica rapa]
Length=128

 Score =   156 bits (394),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>gb|ABK93609.1| unknown [Populus trichocarpa]
Length=120

 Score =   155 bits (393),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>gb|AAI57792.1| LOC100135402 protein [Xenopus (Silurana) tropicalis]
Length=85

 Score =   154 bits (390),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  6    RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  65

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  66   DYNIQKESTLHLVLRLRGG  84



>ref|XP_766242.1| ubiquitin [Theileria parva strain Muguga]
 gb|EAN33959.1| ubiquitin, putative [Theileria parva]
Length=155

 Score =   157 bits (396),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG+
Sbjct  134  DYNIQKESTLHLVLRLRGGY  153


 Score =   149 bits (375),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_003558419.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 [Brachypodium 
distachyon]
 ref|XP_003578682.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 [Brachypodium 
distachyon]
 gb|EMS48574.1| Ubiquitin-60S ribosomal protein L40-2 [Triticum urartu]
Length=129

 Score =   156 bits (394),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>gb|KEH35478.1| ubiquitin-60S ribosomal L40 fusion protein [Medicago truncatula]
Length=140

 Score =   156 bits (395),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>ref|XP_006430159.1| hypothetical protein CICLE_v10013083mg [Citrus clementina]
 gb|ESR43399.1| hypothetical protein CICLE_v10013083mg [Citrus clementina]
 gb|KDO70482.1| hypothetical protein CISIN_1g032678mg [Citrus sinensis]
 gb|KDO70483.1| hypothetical protein CISIN_1g032678mg [Citrus sinensis]
Length=136

 Score =   156 bits (394),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGG  119
            IQKESTLHLVLRLRGG
Sbjct  61   IQKESTLHLVLRLRGG  76



>emb|CBY16339.1| unnamed protein product [Oikopleura dioica]
Length=188

 Score =   158 bits (399),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   151 bits (381),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  242
            RGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKE 
Sbjct  150  RGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEA  187



>emb|CDP08563.1| unnamed protein product [Coffea canephora]
Length=153

 Score =   157 bits (396),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGMTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLH VLRLRGG 
Sbjct  134  DYNIQKESTLHFVLRLRGGL  153


 Score =   147 bits (370),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTI +EVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT ADYN
Sbjct  1    MQIFVKTLTGKTIAVEVESFDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTFADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_008354260.1| PREDICTED: ubiquitin [Malus domestica]
Length=126

 Score =   155 bits (393),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>ref|XP_010271616.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Nelumbo 
nucifera]
Length=151

 Score =   156 bits (395),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  24   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  83

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  84   IQKESTLHLVLRLRGGIIEP  103



>dbj|GAM41773.1| Ubi4 homolog [Talaromyces cellulolyticus]
Length=212

 Score =   158 bits (400),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  133  RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  192

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  193  DYNIQKESTLHLVLRLRGG  211


 Score =   152 bits (384),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 62/80 (78%), Gaps = 17/80 (21%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDK                 EDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK-----------------EDGRTLS  116

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  117  DYNIQKESTLHLVLRLRGGM  136



>ref|XP_002318470.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
 ref|XP_002321972.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
 ref|XP_004230014.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Solanum lycopersicum]
 ref|XP_004235004.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Solanum lycopersicum]
 ref|XP_004244655.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Solanum lycopersicum]
 ref|XP_004245458.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Solanum lycopersicum]
 ref|XP_004303537.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Fragaria vesca 
subsp. vesca]
 ref|XP_004307922.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Fragaria vesca 
subsp. vesca]
 ref|XP_006339755.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum 
tuberosum]
 ref|XP_006343783.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum 
tuberosum]
 ref|XP_006350492.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum 
tuberosum]
 ref|XP_006352212.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum 
tuberosum]
 ref|XP_006367353.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum 
tuberosum]
 ref|XP_002322818.2| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
 ref|XP_008381409.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Malus domestica]
 ref|XP_008376789.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Malus domestica]
 ref|XP_008387026.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Malus domestica]
 ref|XP_008343804.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Malus domestica]
 ref|XP_008367323.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Malus domestica]
 ref|XP_009351937.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Pyrus x bretschneideri]
 ref|XP_009361304.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Pyrus x bretschneideri]
 ref|XP_009366733.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Pyrus x bretschneideri]
 ref|XP_009372513.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Pyrus x bretschneideri]
 ref|XP_009350153.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Pyrus x bretschneideri]
 ref|XP_009399192.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411947.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414579.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009625575.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana tomentosiformis]
 ref|XP_009631115.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana tomentosiformis]
 ref|XP_011043720.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Populus euphratica]
 ref|XP_011044710.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Populus euphratica]
 ref|XP_011004705.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Populus euphratica]
 gb|ABK93924.1| unknown [Populus trichocarpa]
 gb|ABK94570.1| unknown [Populus trichocarpa]
 gb|ABK95887.1| unknown [Populus trichocarpa]
 gb|EEE96690.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
 gb|EEF06099.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
 gb|ADW66126.1| ubiquitin extension protein [Solanum nigrum]
 gb|AFP55586.1| ubiquitin [Rosa rugosa]
 gb|EEF04579.2| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
Length=128

 Score =   155 bits (393),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>emb|CAA60629.1| unnamed protein product [Acanthamoeba sp. 4b3]
Length=172

 Score =   157 bits (397),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIENVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   150 bits (380),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESS  287
            RGGMQIFVKTLTGKTITLEVESS
Sbjct  150  RGGMQIFVKTLTGKTITLEVESS  172



>ref|XP_004934049.1| PREDICTED: polyubiquitin-A-like, partial [Bombyx mori]
Length=155

 Score =   157 bits (396),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   150 bits (378),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_007202754.1| hypothetical protein PRUPE_ppa013349mg [Prunus persica]
 ref|XP_007218596.1| hypothetical protein PRUPE_ppa013338mg [Prunus persica]
 ref|XP_008234674.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Prunus mume]
 ref|XP_008243521.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Prunus mume]
 gb|EMJ03953.1| hypothetical protein PRUPE_ppa013349mg [Prunus persica]
 gb|EMJ19795.1| hypothetical protein PRUPE_ppa013338mg [Prunus persica]
Length=128

 Score =   155 bits (393),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   160 bits (405),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (405),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  210  DYNIQKESTLHLVLRLRGGM  229


 Score =   154 bits (388),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 45/80 (56%), Gaps = 35/80 (44%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTIT                                   LEDGRTLA
Sbjct  226  RGGMQIFVKTLTGKTIT-----------------------------------LEDGRTLA  250

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  251  DYNIQKESTLHLVLRLRGGF  270



>gb|KJB46428.1| hypothetical protein B456_007G368200 [Gossypium raimondii]
Length=101

 Score =   155 bits (391),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>gb|EFN76024.1| Ubiquitin [Harpegnathos saltator]
Length=229

 Score =   159 bits (402),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  150  RGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  209

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGGF
Sbjct  210  DYNIQKESTLHLVLRLRGGF  229


 Score =   156 bits (395),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   147 bits (371),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFV+TL GKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVRTLAGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_008060805.1| PREDICTED: polyubiquitin-B [Tarsius syrichta]
 ref|XP_008060806.1| PREDICTED: polyubiquitin-B [Tarsius syrichta]
 ref|XP_008845333.1| PREDICTED: polyubiquitin-B [Nannospalax galili]
 gb|EDM04713.1| rCG34296, isoform CRA_a [Rattus norvegicus]
 gb|EDM04714.1| rCG34296, isoform CRA_a [Rattus norvegicus]
 gb|EGW01306.1| Ubiquitin [Cricetulus griseus]
Length=153

 Score =   156 bits (395),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG+
Sbjct  134  DYNIQKESTLHLVLRLRGGY  153


 Score =   149 bits (375),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>ref|XP_005824088.1| ubiquitin [Guillardia theta CCMP2712]
 gb|EKX37108.1| ubiquitin [Guillardia theta CCMP2712]
Length=199

 Score =   158 bits (399),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTID VK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  50   RGGMQIFVKTLTGKTITLEVESSDTIDMVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  109

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  110  DYNIQKESTLHLVLRLRGG  128


 Score =   107 bits (267),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/54 (94%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -1

Query  271  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  110
            VK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  I
Sbjct  2    VKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  55



>prf||1101405A ubiquitin precursor
Length=191

 Score =   158 bits (399),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  36   RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  95

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  96   DYNIQKESTLHLVLRLRGGM  115


 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  112  RGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  171

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  172  DYNIQKESTLHLVLRLRGG  190


 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  232  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  116
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  1    DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  39



>ref|XP_008924888.1| PREDICTED: ubiquitin isoform X14 [Manacus vitellinus]
Length=114

 Score =   155 bits (392),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  35   RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  94

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  95   DYNIQKESTLHLVLRLRGG  113


 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  205  KQLEDGRTLADYNIQKESTLHLVLRLRGGF*I  110
            ++LEDGRTL+DYNIQKESTLHLVLRLRGG  I
Sbjct  9    RKLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  40



>ref|XP_002530306.1| ubiquitin, putative [Ricinus communis]
 ref|XP_002530340.1| ubiquitin, putative [Ricinus communis]
 ref|XP_003523336.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Glycine 
max]
 ref|XP_003526741.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Glycine 
max]
 ref|XP_003554448.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like isoform X1 
[Glycine max]
 ref|XP_004137208.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cucumis 
sativus]
 ref|XP_004145956.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cucumis 
sativus]
 ref|XP_004160396.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cucumis 
sativus]
 ref|XP_006295234.1| hypothetical protein CARUB_v10024320mg [Capsella rubella]
 ref|XP_006403788.1| hypothetical protein EUTSA_v10010818mg [Eutrema salsugineum]
 ref|XP_006410789.1| hypothetical protein EUTSA_v10017417mg [Eutrema salsugineum]
 ref|XP_006430158.1| hypothetical protein CICLE_v10013083mg [Citrus clementina]
 ref|XP_006441206.1| hypothetical protein CICLE_v10022855mg [Citrus clementina]
 ref|XP_006481744.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Citrus sinensis]
 ref|XP_006493171.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Citrus sinensis]
 ref|XP_007027811.1| Ubiquitin extension protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007162922.1| hypothetical protein PHAVU_001G191700g [Phaseolus vulgaris]
 ref|XP_008437646.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Cucumis melo]
 ref|XP_008788944.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Phoenix dactylifera]
 ref|XP_008806099.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Phoenix dactylifera]
 ref|XP_008778063.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Phoenix dactylifera]
 ref|XP_009133066.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Brassica rapa]
 ref|XP_009115957.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Brassica rapa]
 ref|XP_009611807.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana tomentosiformis]
 ref|XP_009591639.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana tomentosiformis]
 ref|XP_009782560.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana sylvestris]
 ref|XP_009785771.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana sylvestris]
 ref|XP_009796884.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana sylvestris]
 ref|XP_010048686.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Eucalyptus grandis]
 ref|XP_010036664.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Eucalyptus grandis]
 ref|XP_010090891.1| Ubiquitin-60S ribosomal protein L40 [Morus notabilis]
 ref|XP_010245724.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nelumbo nucifera]
 ref|XP_010509505.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Camelina sativa]
 ref|XP_010516825.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Camelina sativa]
 ref|XP_010527444.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Tarenaya hassleriana]
 ref|XP_010543797.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Tarenaya hassleriana]
 ref|XP_010553389.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Tarenaya hassleriana]
 ref|XP_010558020.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Tarenaya hassleriana]
 ref|XP_010654111.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Vitis vinifera]
 ref|XP_010931116.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Elaeis guineensis]
 ref|XP_010943781.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Elaeis guineensis]
 ref|XP_010943822.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Elaeis guineensis]
 ref|XP_011094277.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Sesamum indicum]
 ref|XP_011075913.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Sesamum indicum]
 gb|AAZ20285.1| ubiquitin fusion protein [Arachis hypogaea]
 emb|CAN60770.1| hypothetical protein VITISV_012429 [Vitis vinifera]
 gb|ABR17437.1| unknown [Picea sitchensis]
 gb|EEF32056.1| ubiquitin, putative [Ricinus communis]
 gb|EEF32073.1| ubiquitin, putative [Ricinus communis]
 gb|ADB85098.1| ubiquitin C variant [Jatropha curcas]
 emb|CBI30322.3| unnamed protein product [Vitis vinifera]
 gb|AEC10952.1| ubiquitin fusion protein [Camellia sinensis]
 gb|AFK46422.1| unknown [Lotus japonicus]
 gb|EOA28132.1| hypothetical protein CARUB_v10024320mg [Capsella rubella]
 gb|EOY08313.1| Ubiquitin extension protein 1 isoform 1 [Theobroma cacao]
 gb|ESQ45241.1| hypothetical protein EUTSA_v10010818mg [Eutrema salsugineum]
 gb|ESQ52242.1| hypothetical protein EUTSA_v10017417mg [Eutrema salsugineum]
 gb|ESR43398.1| hypothetical protein CICLE_v10013083mg [Citrus clementina]
 gb|ESR54446.1| hypothetical protein CICLE_v10022855mg [Citrus clementina]
 gb|ESW34916.1| hypothetical protein PHAVU_001G191700g [Phaseolus vulgaris]
 gb|EXB41096.1| Ubiquitin-60S ribosomal protein L40 [Morus notabilis]
 gb|KDO70480.1| hypothetical protein CISIN_1g032678mg [Citrus sinensis]
 emb|CDP12226.1| unnamed protein product [Coffea canephora]
 emb|CDP08635.1| unnamed protein product [Coffea canephora]
 emb|CDX95351.1| BnaC04g28070D [Brassica napus]
 emb|CDX84576.1| BnaA03g16540D [Brassica napus]
 emb|CDX84153.1| BnaC04g09150D [Brassica napus]
 emb|CDX79660.1| BnaC03g19960D [Brassica napus]
 emb|CDX78108.1| BnaA09g33030D [Brassica napus]
 emb|CDX75065.1| BnaA05g08110D [Brassica napus]
 emb|CDX75066.1| BnaA05g08120D [Brassica napus]
 gb|KHG22768.1| Ubiquitin-60S ribosomal L40 [Gossypium arboreum]
 gb|KHN18789.1| Ubiquitin-60S ribosomal protein L40 [Glycine soja]
 gb|KHN23324.1| Ubiquitin-60S ribosomal protein L40 [Glycine soja]
 gb|KJB36319.1| hypothetical protein B456_006G153600 [Gossypium raimondii]
 gb|KJB36336.1| hypothetical protein B456_006G153300 [Gossypium raimondii]
 gb|KJB39497.1| hypothetical protein B456_007G016700 [Gossypium raimondii]
 gb|KJB46427.1| hypothetical protein B456_007G368200 [Gossypium raimondii]
 gb|KJB52528.1| hypothetical protein B456_008G266000 [Gossypium raimondii]
Length=128

 Score =   155 bits (393),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>gb|ABK93568.1| unknown [Populus trichocarpa]
Length=128

 Score =   155 bits (393),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>ref|XP_010683693.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Beta vulgaris 
subsp. vulgaris]
Length=128

 Score =   155 bits (393),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   159 bits (401),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGGF  116
            DYNIQKESTLHLVLRLRGG 
Sbjct  134  DYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  150  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  209

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  210  DYNIQKESTLHLVLRLRGG  228


 Score =   151 bits (381),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|KFK38522.1| hypothetical protein AALP_AA3G124500 [Arabis alpina]
Length=128

 Score =   155 bits (393),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>emb|CDY70361.1| BnaAnng33460D, partial [Brassica napus]
Length=105

 Score =   155 bits (391),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77


 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  260
            RGGMQIFVKTLTGKTITLEVESSDTIDNVK K
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDTIDNVKTK  105



>dbj|BAH71116.1| ACYPI006410 [Acyrthosiphon pisum]
Length=154

 Score =   156 bits (395),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -1

Query  355  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  176
            RGGMQIFVKTLTGKTITLEVESSD+I+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  74   RGGMQIFVKTLTGKTITLEVESSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  133

Query  175  DYNIQKESTLHLVLRLRGG  119
            DYNIQKESTLHLVLRLRGG
Sbjct  134  DYNIQKESTLHLVLRLRGG  152


 Score =   150 bits (379),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSD+I+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  166  IQKESTLHLVLRLRGGF  116
            IQKESTLHLVLRLRGG 
Sbjct  61   IQKESTLHLVLRLRGGM  77



>gb|AFK47149.1| unknown [Lotus japonicus]
Length=128

 Score =   155 bits (393),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>ref|XP_003602319.1| Ubiquitin [Medicago truncatula]
 ref|XP_004494208.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cicer arietinum]
 ref|XP_004502715.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cicer arietinum]
 ref|XP_004515215.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cicer arietinum]
 gb|ABQ32305.1| putative ubiquitin-conjugating enzyme [Artemisia annua]
 gb|ACJ84010.1| unknown [Medicago truncatula]
 gb|AES72570.1| ubiquitin-60S ribosomal L40 fusion protein [Medicago truncatula]
 gb|AFK33676.1| unknown [Medicago truncatula]
 gb|AFK34296.1| unknown [Medicago truncatula]
 gb|AFK38276.1| unknown [Medicago truncatula]
 gb|EYU32285.1| hypothetical protein MIMGU_mgv1a016271mg [Erythranthe guttata]
 gb|KEH24146.1| ubiquitin-60S ribosomal L40 fusion protein [Medicago truncatula]
 gb|KEH42002.1| ubiquitin-60S ribosomal L40 fusion protein [Medicago truncatula]
Length=128

 Score =   155 bits (393),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



>dbj|BAB32735.1| ubiquitin [Eustoma grandiflorum]
Length=100

 Score =   155 bits (391),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  346  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  167
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  166  IQKESTLHLVLRLRGGF*IP  107
            IQKESTLHLVLRLRGG   P
Sbjct  61   IQKESTLHLVLRLRGGIIEP  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567748279395