BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF048E23

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011028243.1|  PREDICTED: tobamovirus multiplication protei...    124   5e-31   Populus euphratica
ref|XP_010104372.1|  hypothetical protein L484_023325                   121   2e-30   
dbj|BAD94952.1|  hypothetical protein                                   115   5e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KDO40488.1|  hypothetical protein CISIN_1g033708mg                   115   1e-29   Citrus sinensis [apfelsine]
ref|XP_006385612.1|  GMFP4 family protein                               120   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010275310.1|  PREDICTED: tobamovirus multiplication protei...    118   4e-29   Nelumbo nucifera [Indian lotus]
ref|XP_009397919.1|  PREDICTED: tobamovirus multiplication protei...    117   8e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002893721.1|  hypothetical protein ARALYDRAFT_473428             117   1e-28   
ref|XP_004148498.1|  PREDICTED: uncharacterized protein LOC101203030    117   1e-28   Cucumis sativus [cucumbers]
gb|AFK47448.1|  unknown                                                 115   2e-28   Medicago truncatula
ref|XP_008465936.1|  PREDICTED: tobamovirus multiplication protei...    116   2e-28   Cucumis melo [Oriental melon]
gb|AFK40219.1|  unknown                                                 116   3e-28   Lotus japonicus
gb|KJB25374.1|  hypothetical protein B456_004G188200                    116   3e-28   Gossypium raimondii
gb|AAF81337.1|AC007767_17  Contains similarity to GMFP4 from Glyc...    115   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006485406.1|  PREDICTED: tobamovirus multiplication protei...    116   3e-28   Citrus sinensis [apfelsine]
ref|XP_007156641.1|  hypothetical protein PHAVU_002G005100g             115   4e-28   Phaseolus vulgaris [French bean]
ref|XP_010499788.1|  PREDICTED: tobamovirus multiplication protei...    115   4e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002527636.1|  conserved hypothetical protein                     115   4e-28   Ricinus communis
ref|XP_003611446.1|  GMFP4                                              114   5e-28   
ref|NP_564399.1|  tobamovirus multiplication 2A protein                 115   5e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93836.1|  BnaA09g24360D                                          115   6e-28   
ref|XP_009114889.1|  PREDICTED: tobamovirus multiplication protei...    115   6e-28   Brassica rapa
gb|KHN42626.1|  hypothetical protein glysoja_018869                     115   7e-28   Glycine soja [wild soybean]
ref|XP_003517379.1|  PREDICTED: tobamovirus multiplication protei...    115   7e-28   Glycine max [soybeans]
gb|KHG01123.1|  hypothetical protein F383_00667                         115   7e-28   Gossypium arboreum [tree cotton]
gb|AIX10945.1|  putative tetraspanin family protein                     115   9e-28   Gardenia jasminoides
ref|XP_009385932.1|  PREDICTED: tobamovirus multiplication protei...    115   9e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011070225.1|  PREDICTED: tobamovirus multiplication protei...    114   1e-27   Sesamum indicum [beniseed]
ref|XP_007209447.1|  hypothetical protein PRUPE_ppa009704mg             114   1e-27   Prunus persica
emb|CDY48874.1|  BnaA05g35820D                                          115   1e-27   Brassica napus [oilseed rape]
ref|XP_009151428.1|  PREDICTED: tobamovirus multiplication protei...    114   1e-27   Brassica rapa
ref|XP_006305495.1|  hypothetical protein CARUB_v10009959mg             114   1e-27   
ref|XP_003611445.1|  GMFP4                                              114   1e-27   
ref|XP_003539155.1|  PREDICTED: tobamovirus multiplication protei...    114   1e-27   Glycine max [soybeans]
ref|XP_003611447.1|  GMFP4                                              114   1e-27   Medicago truncatula
emb|CDY32286.1|  BnaC05g28640D                                          115   1e-27   Brassica napus [oilseed rape]
ref|XP_009590611.1|  PREDICTED: tobamovirus multiplication protei...    114   2e-27   Nicotiana tomentosiformis
ref|XP_009788106.1|  PREDICTED: tobamovirus multiplication protei...    114   2e-27   Nicotiana sylvestris
ref|XP_007039575.1|  Tobamovirus multiplication 2A isoform 1            114   2e-27   Theobroma cacao [chocolate]
ref|XP_006305496.1|  hypothetical protein CARUB_v10009959mg             114   2e-27   Capsella rubella
emb|CDY01278.1|  BnaC05g24540D                                          114   2e-27   
gb|AAD09513.1|  GMFP4                                                   109   2e-27   Glycine max [soybeans]
ref|XP_010269960.1|  PREDICTED: tobamovirus multiplication protei...    114   2e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010478663.1|  PREDICTED: tobamovirus multiplication protei...    114   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_004511769.1|  PREDICTED: tetraspanin-20-like isoform X1          114   3e-27   Cicer arietinum [garbanzo]
gb|ACU24289.1|  unknown                                                 114   3e-27   Glycine max [soybeans]
emb|CBI33948.3|  unnamed protein product                                112   3e-27   Vitis vinifera
gb|KDP36200.1|  hypothetical protein JCGZ_10291                         113   3e-27   Jatropha curcas
emb|CDP12960.1|  unnamed protein product                                112   4e-27   Coffea canephora [robusta coffee]
ref|XP_008238361.1|  PREDICTED: tobamovirus multiplication protei...    113   5e-27   Prunus mume [ume]
gb|KHG08208.1|  Tetraspanin-33                                          113   5e-27   Gossypium arboreum [tree cotton]
gb|KHN01670.1|  hypothetical protein glysoja_012981                     112   6e-27   Glycine soja [wild soybean]
ref|XP_002279170.2|  PREDICTED: tobamovirus multiplication protei...    112   6e-27   Vitis vinifera
ref|XP_010461064.1|  PREDICTED: tobamovirus multiplication protei...    112   7e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006415200.1|  hypothetical protein EUTSA_v10008423mg             112   8e-27   Eutrema salsugineum [saltwater cress]
ref|NP_001240069.1|  uncharacterized protein LOC100793680               112   8e-27   Glycine max [soybeans]
ref|XP_004245872.1|  PREDICTED: tobamovirus multiplication protei...    112   8e-27   Solanum lycopersicum
ref|XP_011018623.1|  PREDICTED: tobamovirus multiplication protei...    111   2e-26   Populus euphratica
ref|XP_006368443.1|  GMFP4 family protein                               111   2e-26   Populus trichocarpa [western balsam poplar]
gb|KJB37690.1|  hypothetical protein B456_006G215600                    111   3e-26   Gossypium raimondii
gb|EPS67767.1|  hypothetical protein M569_07007                         111   3e-26   Genlisea aurea
gb|KHN21027.1|  hypothetical protein glysoja_034149                     110   4e-26   Glycine soja [wild soybean]
ref|XP_003524459.1|  PREDICTED: tobamovirus multiplication protei...    110   5e-26   
gb|KHG29162.1|  Solute carrier family 28 member 3                       107   1e-25   Gossypium arboreum [tree cotton]
ref|XP_008354195.1|  PREDICTED: tobamovirus multiplication protei...    105   1e-25   
ref|XP_006358577.1|  PREDICTED: tobamovirus multiplication protei...    108   2e-25   Solanum tuberosum [potatoes]
gb|KJB51696.1|  hypothetical protein B456_008G228700                    107   2e-25   Gossypium raimondii
ref|XP_007156638.1|  hypothetical protein PHAVU_002G004900g             108   2e-25   Phaseolus vulgaris [French bean]
gb|KHG29161.1|  Stk31                                                   107   4e-25   Gossypium arboreum [tree cotton]
gb|KJB51694.1|  hypothetical protein B456_008G228700                    107   4e-25   Gossypium raimondii
ref|XP_008784675.1|  PREDICTED: tobamovirus multiplication protei...    107   6e-25   Phoenix dactylifera
gb|KEH31557.1|  tetraspanin family protein                              107   6e-25   Medicago truncatula
ref|XP_004509001.1|  PREDICTED: tetraspanin-20-like isoform X1          107   7e-25   Cicer arietinum [garbanzo]
gb|KCW71821.1|  hypothetical protein EUGRSUZ_E00307                     107   7e-25   Eucalyptus grandis [rose gum]
ref|XP_010055355.1|  PREDICTED: tobamovirus multiplication protei...    107   7e-25   Eucalyptus grandis [rose gum]
ref|XP_009345636.1|  PREDICTED: tobamovirus multiplication protei...    106   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_010933519.1|  PREDICTED: tobamovirus multiplication protei...    106   1e-24   Elaeis guineensis
ref|XP_010919853.1|  PREDICTED: tobamovirus multiplication protei...    106   2e-24   Elaeis guineensis
ref|XP_008373605.1|  PREDICTED: tobamovirus multiplication protei...    102   2e-24   
ref|XP_010677296.1|  PREDICTED: tobamovirus multiplication protei...    105   2e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010518876.1|  PREDICTED: tobamovirus multiplication protei...    105   4e-24   Tarenaya hassleriana [spider flower]
ref|XP_007156640.1|  hypothetical protein PHAVU_002G005000g             101   9e-23   Phaseolus vulgaris [French bean]
gb|EYU17843.1|  hypothetical protein MIMGU_mgv1a0124672mg             99.4    2e-22   Erythranthe guttata [common monkey flower]
dbj|BAK04010.1|  predicted protein                                      100   2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006659267.1|  PREDICTED: tobamovirus multiplication protei...    100   3e-22   Oryza brachyantha
gb|EMS54049.1|  hypothetical protein TRIUR3_29725                       100   3e-22   Triticum urartu
ref|XP_003573849.1|  PREDICTED: tobamovirus multiplication protei...    100   3e-22   Brachypodium distachyon [annual false brome]
ref|XP_010934868.1|  PREDICTED: tobamovirus multiplication protei...    100   3e-22   Elaeis guineensis
gb|EYU33039.1|  hypothetical protein MIMGU_mgv1a011319mg              99.4    6e-22   Erythranthe guttata [common monkey flower]
ref|XP_008788693.1|  PREDICTED: tobamovirus multiplication protei...  97.8    7e-22   
gb|EAZ06370.1|  hypothetical protein OsI_28599                        95.5    1e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_008788690.1|  PREDICTED: tobamovirus multiplication protei...  98.2    2e-21   Phoenix dactylifera
ref|XP_009398578.1|  PREDICTED: tobamovirus multiplication protei...  97.1    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW87792.1|  hypothetical protein ZEAMMB73_665682                  93.2    5e-21   
ref|NP_001061444.1|  Os08g0282000                                     96.7    6e-21   
gb|ACL54399.1|  unknown                                               93.2    7e-21   Zea mays [maize]
gb|EYU33040.1|  hypothetical protein MIMGU_mgv1a011318mg              96.3    9e-21   Erythranthe guttata [common monkey flower]
ref|XP_006847670.1|  hypothetical protein AMTR_s00149p00039360        95.9    1e-20   Amborella trichopoda
ref|NP_001150827.1|  tetraspanin family protein                       95.5    1e-20   Zea mays [maize]
ref|XP_009371175.1|  PREDICTED: tobamovirus multiplication protei...  95.1    2e-20   Pyrus x bretschneideri [bai li]
ref|NP_001146619.1|  hypothetical protein                             94.0    4e-20   Zea mays [maize]
ref|XP_004983591.1|  PREDICTED: tetraspanin-18-like isoform X1        94.0    4e-20   
gb|ACG40574.1|  tetraspanin family protein                            94.0    5e-20   Zea mays [maize]
gb|AGW24511.1|  hypothetical protein                                  89.0    1e-19   Avicennia marina subsp. marina
ref|XP_010538377.1|  PREDICTED: tobamovirus multiplication protei...  91.3    5e-19   Tarenaya hassleriana [spider flower]
gb|KCW77897.1|  hypothetical protein EUGRSUZ_D021561                  89.7    5e-19   Eucalyptus grandis [rose gum]
gb|KCW77895.1|  hypothetical protein EUGRSUZ_D021561                  89.4    8e-19   Eucalyptus grandis [rose gum]
ref|XP_010053569.1|  PREDICTED: tobamovirus multiplication protei...  90.1    1e-18   Eucalyptus grandis [rose gum]
ref|XP_006850026.1|  hypothetical protein AMTR_s00022p00189290        89.7    1e-18   
gb|ABK25767.1|  unknown                                               87.4    4e-18   Picea sitchensis
gb|ABK22053.1|  unknown                                               87.4    1e-17   Picea sitchensis
ref|XP_009391069.1|  PREDICTED: tobamovirus multiplication protei...  84.0    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004300273.1|  PREDICTED: tobamovirus multiplication protei...  79.7    4e-15   Fragaria vesca subsp. vesca
ref|XP_002972323.1|  hypothetical protein SELMODRAFT_172827           72.0    3e-12   
gb|ACN35034.1|  unknown                                               67.0    1e-10   Zea mays [maize]
ref|XP_006659854.1|  PREDICTED: tobamovirus multiplication protei...  66.6    2e-10   
ref|XP_003573463.1|  PREDICTED: tobamovirus multiplication protei...  66.6    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_004972786.1|  PREDICTED: tetraspanin-20-like isoform X2        65.5    6e-10   Setaria italica
ref|XP_001775831.1|  predicted protein                                65.1    1e-09   
ref|NP_001061041.1|  Os08g0159100                                     64.3    1e-09   
ref|XP_002443902.1|  hypothetical protein SORBIDRAFT_07g004040        64.3    1e-09   Sorghum bicolor [broomcorn]
ref|XP_001763914.1|  predicted protein                                64.3    1e-09   
gb|EEC82932.1|  hypothetical protein OsI_27894                        64.3    2e-09   Oryza sativa Indica Group [Indian rice]
gb|EYU17846.1|  hypothetical protein MIMGU_mgv1a0219311mg             56.6    4e-08   Erythranthe guttata [common monkey flower]
gb|KCW71823.1|  hypothetical protein EUGRSUZ_E00307                   55.8    1e-06   Eucalyptus grandis [rose gum]
ref|XP_001762411.1|  predicted protein                                55.8    1e-06   
ref|XP_005644373.1|  hypothetical protein COCSUDRAFT_44255            54.3    4e-06   Coccomyxa subellipsoidea C-169
ref|XP_006854320.1|  hypothetical protein AMTR_s00039p00118150        53.5    1e-05   Amborella trichopoda
ref|XP_004966578.1|  PREDICTED: tetraspanin-18-like                   48.9    3e-04   Setaria italica
ref|XP_002437655.1|  hypothetical protein SORBIDRAFT_10g031310        48.5    5e-04   Sorghum bicolor [broomcorn]



>ref|XP_011028243.1| PREDICTED: tobamovirus multiplication protein 2A-like [Populus 
euphratica]
Length=280

 Score =   124 bits (310),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR  AP TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEFTYNPSES+R+QP + QP
Sbjct  211  LLNRPPAPATGVPVAGTLDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESHRFQPVSAQP  270

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  271  AEERSRCTIM  280



>ref|XP_010104372.1| hypothetical protein L484_023325 [Morus notabilis]
 gb|EXB99792.1| hypothetical protein L484_023325 [Morus notabilis]
Length=251

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ AP TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEFTYNPSESNR+Q    QP
Sbjct  182  LINRQAAPATGVPVAGTLDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESNRFQQVAPQP  241

Query  295  AEERGRCTIM  266
             EER RCTIM
Sbjct  242  TEERSRCTIM  251



>dbj|BAD94952.1| hypothetical protein [Arabidopsis thaliana]
Length=95

 Score =   115 bits (289),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  28   NRQAAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNE  87

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  88   EKGRCTIM  95



>gb|KDO40488.1| hypothetical protein CISIN_1g033708mg [Citrus sinensis]
Length=113

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR   P TGVPVAG+LD RPSRNDAWS RMREKYGLDTSEFTYNPSES+R+Q    QP
Sbjct  44   LINRPTPPATGVPVAGSLDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESHRFQQVATQP  103

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  104  AEERSRCTIM  113



>ref|XP_006385612.1| GMFP4 family protein [Populus trichocarpa]
 gb|ABK92751.1| unknown [Populus trichocarpa]
 gb|ERP63409.1| GMFP4 family protein [Populus trichocarpa]
Length=280

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR  AP TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEFTYNPSE +R+QP + QP
Sbjct  211  LLNRPPAPATGVPVAGTLDQRPSRNDAWSTRMREKYGLDTSEFTYNPSEPHRFQPVSAQP  270

Query  295  AEERGRCTIM  266
             EER RCTIM
Sbjct  271  TEERSRCTIM  280



>ref|XP_010275310.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275311.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275312.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275313.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
Length=280

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ  P TGVPVA  LD RPSRNDAWS RMREKYGLDTSEFTYNPSESNR+Q   VQP
Sbjct  211  LINRQGVPATGVPVACALDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESNRFQQGPVQP  270

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  271  AEERSRCTIM  280



>ref|XP_009397919.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=284

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ AP TGVPV GTLD RPSRNDAWS RMREKYGLDTSEFTYNPS+ +RYQ   V P
Sbjct  215  LMNRQGAPATGVPVLGTLDHRPSRNDAWSQRMREKYGLDTSEFTYNPSDPSRYQQATVPP  274

Query  295  AEERGRCTIM  266
            AEERG CTI+
Sbjct  275  AEERGHCTIL  284



>ref|XP_002893721.1| hypothetical protein ARALYDRAFT_473428 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69980.1| hypothetical protein ARALYDRAFT_473428 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ APVTGVPVA TLD RPSRND WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  213  NRQAAPVTGVPVAPTLDQRPSRNDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNE  272

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  273  EKGRCTIM  280



>ref|XP_004148498.1| PREDICTED: uncharacterized protein LOC101203030 [Cucumis sativus]
 ref|XP_004170668.1| PREDICTED: uncharacterized protein LOC101226567 [Cucumis sativus]
 gb|KGN60424.1| hypothetical protein Csa_3G904130 [Cucumis sativus]
Length=279

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR  AP TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEFTYNPSES+R+Q    QP
Sbjct  210  LINRPVAPATGVPVAGTLDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESHRFQQVAPQP  269

Query  295  AEERGRCTIM  266
            AEE+ RCTIM
Sbjct  270  AEEKSRCTIM  279



>gb|AFK47448.1| unknown [Medicago truncatula]
Length=220

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +NNRQ  P +G+PVAGT D RP+RNDAWS RMREKYGLDTSEFTYNPSES R+Q  N QP
Sbjct  151  LNNRQAGPPSGLPVAGTTDQRPNRNDAWSTRMREKYGLDTSEFTYNPSESQRFQQANFQP  210

Query  295  AEERGRCTIM  266
             EE+ RCTIM
Sbjct  211  TEEKSRCTIM  220



>ref|XP_008465936.1| PREDICTED: tobamovirus multiplication protein 2A [Cucumis melo]
Length=279

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR  AP TGVPVAGTLD RPSRNDAWSARMREKYGLDTSEFTYNPSES+R+Q    Q 
Sbjct  210  LINRPVAPATGVPVAGTLDQRPSRNDAWSARMREKYGLDTSEFTYNPSESHRFQQVAPQA  269

Query  295  AEERGRCTIM  266
            AEE+ RCTIM
Sbjct  270  AEEKSRCTIM  279



>gb|AFK40219.1| unknown [Lotus japonicus]
Length=282

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR  AP +GVPVAGT+D RPSRNDAWS RMREKYGLDTSEFTYNPSES R+Q  N QP
Sbjct  213  LLNRPAAPASGVPVAGTIDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESQRFQQVNSQP  272

Query  295  AEERGRCTIM  266
             EER RC IM
Sbjct  273  TEERSRCAIM  282



>gb|KJB25374.1| hypothetical protein B456_004G188200 [Gossypium raimondii]
Length=280

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR  AP  GVPV  TL+ RPSRNDAWS RMREKYGLDTSEFTYNPSESNRYQP   QP
Sbjct  211  LINRPPAPAAGVPVVPTLEQRPSRNDAWSTRMREKYGLDTSEFTYNPSESNRYQPVAPQP  270

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  271  AEERSRCTIM  280



>gb|AAF81337.1|AC007767_17 Contains similarity to GMFP4 from Glycine max gb|U64915. ESTs 
gb|AV442477, gb|AV441037, gb|AV534954, gb|AV560678 and gb|AV518757 
come from this gene [Arabidopsis thaliana]
Length=252

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  185  NRQAAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNE  244

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  245  EKGRCTIM  252



>ref|XP_006485406.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Citrus sinensis]
 ref|XP_006485407.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Citrus sinensis]
Length=279

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR   P TGVPVAG+LD RPSRNDAWS RMREKYGLDTSEFTYNPSES+R+Q    QP
Sbjct  210  LINRPTPPATGVPVAGSLDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESHRFQQVATQP  269

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  270  AEERSRCTIM  279



>ref|XP_007156641.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 ref|XP_007156642.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 gb|ESW28635.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 gb|ESW28636.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
Length=279

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +N    APVTG+PVAGT+D RPSRNDAWSARMREKYGLDTSEFTYNPSES+R+Q  N Q 
Sbjct  210  LNRPAAAPVTGLPVAGTIDQRPSRNDAWSARMREKYGLDTSEFTYNPSESSRFQQVNSQS  269

Query  295  AEERGRCTIM  266
             EE+ RCTIM
Sbjct  270  TEEKSRCTIM  279



>ref|XP_010499788.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Camelina 
sativa]
 ref|XP_010499789.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Camelina 
sativa]
Length=276

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  209  NRQAAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNE  268

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  269  EKGRCTIM  276



>ref|XP_002527636.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34707.1| conserved hypothetical protein [Ricinus communis]
Length=280

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR   P TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEF+YNPSES+R+Q  + QP
Sbjct  211  LLNRPPGPATGVPVAGTLDQRPSRNDAWSTRMREKYGLDTSEFSYNPSESHRFQQVSTQP  270

Query  295  AEERGRCTIM  266
             EER RCTIM
Sbjct  271  TEERSRCTIM  280



>ref|XP_003611446.1| GMFP4 [Medicago truncatula]
Length=220

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +NNRQ  P +G+PVAGT D RP+RNDAWS RMREKYGLDTSEFTYNPSES R+Q  N QP
Sbjct  151  LNNRQAGPPSGLPVAGTTDQRPNRNDAWSTRMREKYGLDTSEFTYNPSESQRFQQANSQP  210

Query  295  AEERGRCTIM  266
             EE+ RCTIM
Sbjct  211  TEEKSRCTIM  220



>ref|NP_564399.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 ref|NP_973952.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 ref|NP_001031127.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 sp|Q9C5W7.1|TOM2A_ARATH RecName: Full=Tobamovirus multiplication protein 2A; Short=AtTOM2A 
[Arabidopsis thaliana]
 gb|AAG50101.1|AF334723_1 unknown protein [Arabidopsis thaliana]
 gb|AAK60280.1|AF385687_1 At1g32400/F5D14_22 [Arabidopsis thaliana]
 gb|AAM66092.1| unknown [Arabidopsis thaliana]
 dbj|BAC24019.1| tobamovirus multiplication 2A [Arabidopsis thaliana]
 gb|AEE31476.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 gb|AEE31477.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 gb|AEE31478.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
Length=280

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  213  NRQAAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNE  272

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  273  EKGRCTIM  280



>emb|CDX93836.1| BnaA09g24360D [Brassica napus]
Length=281

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  214  NRQPAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNE  273

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  274  EKGRCTIM  281



>ref|XP_009114889.1| PREDICTED: tobamovirus multiplication protein 2A [Brassica rapa]
Length=281

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  214  NRQPAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNE  273

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  274  EKGRCTIM  281



>gb|KHN42626.1| hypothetical protein glysoja_018869 [Glycine soja]
Length=283

 Score =   115 bits (288),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +N    +P TG+PVAGT+D RPSRNDAWS RMREKYGLDTSEFTYNPSESNR+Q  N QP
Sbjct  214  LNRPAASPATGLPVAGTMDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESNRFQQVNSQP  273

Query  295  AEERGRCTIM  266
             EE+ RCTIM
Sbjct  274  TEEKSRCTIM  283



>ref|XP_003517379.1| PREDICTED: tobamovirus multiplication protein 2A-like [Glycine 
max]
Length=283

 Score =   115 bits (288),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +N    +P TG+PVAGT+D RPSRNDAWS RMREKYGLDTSEFTYNPSESNR+Q  N QP
Sbjct  214  LNRPAASPATGLPVAGTMDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESNRFQQVNSQP  273

Query  295  AEERGRCTIM  266
             EE+ RCTIM
Sbjct  274  TEEKSRCTIM  283



>gb|KHG01123.1| hypothetical protein F383_00667 [Gossypium arboreum]
Length=278

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR   P TGVPV G+LD RPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQ T  QP
Sbjct  209  LINRPPVPATGVPVTGSLDQRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQQTAPQP  268

Query  295  AEERGRCTIM  266
            AE   RCTIM
Sbjct  269  AEGSSRCTIM  278



>gb|AIX10945.1| putative tetraspanin family protein [Gardenia jasminoides]
Length=286

 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +N  Q AP TGVPVAGTLDSRPSRNDAWS RMREKYGLDTSEFTYNPSESNR      QP
Sbjct  217  INRPQPAPATGVPVAGTLDSRPSRNDAWSTRMREKYGLDTSEFTYNPSESNRTLQGAAQP  276

Query  295  AEERGRCTIM  266
             EER RCTIM
Sbjct  277  TEERSRCTIM  286



>ref|XP_009385932.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385933.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ  P TGVPV GTLD RPSRNDAWS RMREKYGLDTSEFTYNPS+ NRYQP     
Sbjct  214  LMNRQGTPATGVPVLGTLDHRPSRNDAWSQRMREKYGLDTSEFTYNPSDPNRYQPATAPQ  273

Query  295  AEERGRCTIM  266
             EERGRC IM
Sbjct  274  VEERGRCIIM  283



>ref|XP_011070225.1| PREDICTED: tobamovirus multiplication protein 2A [Sesamum indicum]
 ref|XP_011070226.1| PREDICTED: tobamovirus multiplication protein 2A [Sesamum indicum]
Length=281

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ  P TGVPVAGTLD RPSRNDAWS RMREKYGLDTSEFTYNP+ESNRY     QP
Sbjct  212  LINRQPVPATGVPVAGTLDQRPSRNDAWSTRMREKYGLDTSEFTYNPNESNRYPQAATQP  271

Query  295  AEERGRCTIM  266
             EER RC IM
Sbjct  272  QEERSRCIIM  281



>ref|XP_007209447.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 ref|XP_007209448.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 gb|EMJ10646.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 gb|EMJ10647.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
Length=281

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +NNR   P TGVPVAG  D RP+RNDAWS RMREKYGLDT+EFTYNPSESNR+QP   QP
Sbjct  212  INNRPAVPATGVPVAGASDQRPNRNDAWSTRMREKYGLDTAEFTYNPSESNRFQPVPAQP  271

Query  295  AEERGRCTIM  266
             EER RC+IM
Sbjct  272  QEERSRCSIM  281



>emb|CDY48874.1| BnaA05g35820D [Brassica napus]
Length=344

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  277  NRQPAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNE  336

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  337  EKGRCTIM  344



>ref|XP_009151428.1| PREDICTED: tobamovirus multiplication protein 2A [Brassica rapa]
Length=279

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  212  NRQPAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNE  271

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  272  EKGRCTIM  279



>ref|XP_006305495.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
 gb|EOA38393.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
Length=256

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ  PVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  189  NRQATPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNE  248

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  249  EKGRCTIM  256



>ref|XP_003611445.1| GMFP4 [Medicago truncatula]
Length=294

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +NNRQ  P +G+PVAGT D RP+RNDAWS RMREKYGLDTSEFTYNPSES R+Q  N QP
Sbjct  225  LNNRQAGPPSGLPVAGTTDQRPNRNDAWSTRMREKYGLDTSEFTYNPSESQRFQQANSQP  284

Query  295  AEERGRCTIM  266
             EE+ RCTIM
Sbjct  285  TEEKSRCTIM  294



>ref|XP_003539155.1| PREDICTED: tobamovirus multiplication protein 2A-like [Glycine 
max]
 gb|KHN34864.1| hypothetical protein glysoja_004630 [Glycine soja]
Length=283

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +N     P TG+PVAGT+D RPSRNDAWS RMREKYGLDTSEFTYNPSESNR+Q  N QP
Sbjct  214  LNRLPAGPATGIPVAGTIDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESNRFQQVNSQP  273

Query  295  AEERGRCTIM  266
             EE+ RC IM
Sbjct  274  TEEKSRCAIM  283



>ref|XP_003611447.1| GMFP4 [Medicago truncatula]
 gb|AES94405.1| tobamovirus multiplication protein 2A [Medicago truncatula]
Length=289

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +NNRQ  P +G+PVAGT D RP+RNDAWS RMREKYGLDTSEFTYNPSES R+Q  N QP
Sbjct  220  LNNRQAGPPSGLPVAGTTDQRPNRNDAWSTRMREKYGLDTSEFTYNPSESQRFQQANSQP  279

Query  295  AEERGRCTIM  266
             EE+ RCTIM
Sbjct  280  TEEKSRCTIM  289



>emb|CDY32286.1| BnaC05g28640D [Brassica napus]
Length=370

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  303  NRQPAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNE  362

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  363  EKGRCTIM  370



>ref|XP_009590611.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana tomentosiformis]
 ref|XP_009590612.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana tomentosiformis]
Length=283

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +NNR   P TGVPVAGTLD+RPSRNDAWS RMREKYGLDTSEFTYNPS+SNRY  T VQP
Sbjct  214  INNRPPNPATGVPVAGTLDNRPSRNDAWSTRMREKYGLDTSEFTYNPSDSNRYPQTAVQP  273

Query  295  AEERGRCTIM  266
             EER  C IM
Sbjct  274  QEERKGCAIM  283



>ref|XP_009788106.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana sylvestris]
 ref|XP_009788107.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana sylvestris]
Length=283

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +NNR   P TGVPVAGTLD+RPSRNDAWS RMREKYGLDTSEFTYNPS+SNRY  T VQP
Sbjct  214  INNRPPNPATGVPVAGTLDNRPSRNDAWSTRMREKYGLDTSEFTYNPSDSNRYPQTAVQP  273

Query  295  AEERGRCTIM  266
             EER  C IM
Sbjct  274  QEERKGCAIM  283



>ref|XP_007039575.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 ref|XP_007039576.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 ref|XP_007039577.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24076.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24077.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24078.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
Length=280

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR   P TGVPVAG+L+ R SRNDAWS RMREKYGLDTSEFTYNPSESNRYQ    QP
Sbjct  211  LINRPPVPATGVPVAGSLEQRSSRNDAWSTRMREKYGLDTSEFTYNPSESNRYQQVTPQP  270

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  271  AEERSRCTIM  280



>ref|XP_006305496.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
 gb|EOA38394.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
Length=280

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ  PVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  213  NRQATPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNE  272

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  273  EKGRCTIM  280



>emb|CDY01278.1| BnaC05g24540D [Brassica napus]
Length=281

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ APVTGVPV  TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  214  NRQPAPVTGVPVVPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNE  273

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  274  EKGRCTIM  281



>gb|AAD09513.1| GMFP4, partial [Glycine max]
Length=111

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NR   PV+G P  GTLD RPSRNDAWS RMREKYGLDTSEFTYNPSES+RYQ  N QP E
Sbjct  44   NRPAGPVSGAPATGTLDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESHRYQQVNSQPTE  103

Query  289  ERGRCTIM  266
            E  RC IM
Sbjct  104  EGSRCAIM  111



>ref|XP_010269960.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269962.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269963.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269964.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
Length=280

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ  P TG PVAG+LD RPSRNDAWS RMREKYGLDTSEFTYNPS+ NR+Q    QP
Sbjct  211  LINRQGVPSTGSPVAGSLDQRPSRNDAWSTRMREKYGLDTSEFTYNPSDPNRFQQAPAQP  270

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  271  AEERSRCTIM  280



>ref|XP_010478663.1| PREDICTED: tobamovirus multiplication protein 2A-like [Camelina 
sativa]
Length=281

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ  PVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  214  NRQATPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNE  273

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  274  EKGRCTIM  281



>ref|XP_004511769.1| PREDICTED: tetraspanin-20-like isoform X1 [Cicer arietinum]
 ref|XP_004511770.1| PREDICTED: tetraspanin-20-like isoform X2 [Cicer arietinum]
 ref|XP_004511771.1| PREDICTED: tetraspanin-20-like isoform X3 [Cicer arietinum]
Length=281

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ  P TG+PVAGT D RP+RNDAWS RMREKYGLDTSEFTYNPSES R+Q  N QP
Sbjct  212  LINRQTGPPTGLPVAGTTDQRPNRNDAWSTRMREKYGLDTSEFTYNPSESQRFQQVNSQP  271

Query  295  AEERGRCTIM  266
             EE+ RCTIM
Sbjct  272  TEEKSRCTIM  281



>gb|ACU24289.1| unknown [Glycine max]
Length=283

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +N    +P TG+PVAGT+D RP RNDAWS RMREKYGLDTSEFTYNPSESNR+Q  N QP
Sbjct  214  LNRPAASPATGLPVAGTMDQRPGRNDAWSTRMREKYGLDTSEFTYNPSESNRFQQVNSQP  273

Query  295  AEERGRCTIM  266
             EE+ RCTIM
Sbjct  274  TEEKSRCTIM  283



>emb|CBI33948.3| unnamed protein product [Vitis vinifera]
Length=217

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR     TGVPVAG +D RPSRNDAWS RMREKYGLDTSEFTYNPSESNRY P   QP
Sbjct  148  LINRPPVAATGVPVAGAIDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESNRYPPGQQQP  207

Query  295  AEERGRCTIM  266
             EER RCTIM
Sbjct  208  TEERSRCTIM  217



>gb|KDP36200.1| hypothetical protein JCGZ_10291 [Jatropha curcas]
Length=279

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR   P  GVPVAG LD RPSRNDAWS RMREKYGLDTSEF+YNPSES R+Q    QP
Sbjct  210  LINRPPGPAAGVPVAGALDQRPSRNDAWSTRMREKYGLDTSEFSYNPSESQRFQQVQTQP  269

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  270  AEERSRCTIM  279



>emb|CDP12960.1| unnamed protein product [Coffea canephora]
Length=221

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREK--YGLDTSEFTYNPSESNRYQPTNV  302
            +N  Q AP TGVPVAGTLDSRPSRNDAWS RMREK  YGLDTSEFTYNPS+SNRY     
Sbjct  150  INRPQPAPATGVPVAGTLDSRPSRNDAWSTRMREKACYGLDTSEFTYNPSDSNRYPQGTA  209

Query  301  QPAEERGRCTIM  266
            QP EER RCTIM
Sbjct  210  QPTEERSRCTIM  221



>ref|XP_008238361.1| PREDICTED: tobamovirus multiplication protein 2A [Prunus mume]
Length=281

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +N+R   P TGVPVAG  D RP+RNDAWS RMREKYGLDT+EFTYNPSESNR+QP   QP
Sbjct  212  INSRPAVPATGVPVAGASDQRPNRNDAWSTRMREKYGLDTAEFTYNPSESNRFQPVPAQP  271

Query  295  AEERGRCTIM  266
             EER RC+IM
Sbjct  272  QEERSRCSIM  281



>gb|KHG08208.1| Tetraspanin-33 [Gossypium arboreum]
Length=280

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR  AP  GVPV  +L+ RPSRNDAWS RMREKYGLDTSEFTY+PSESNRYQP   QP
Sbjct  211  LINRPPAPAAGVPVVPSLEQRPSRNDAWSTRMREKYGLDTSEFTYSPSESNRYQPVAPQP  270

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  271  AEERSRCTIM  280



>gb|KHN01670.1| hypothetical protein glysoja_012981 [Glycine soja]
Length=250

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR   P +G P  GTLD RPSRNDAWSARMREKYGLDTSEFTYNPSES+RYQ  N QP
Sbjct  181  LLNRPAGPASGAPATGTLDKRPSRNDAWSARMREKYGLDTSEFTYNPSESHRYQQVNPQP  240

Query  295  AEERGRCTIM  266
             EER RC IM
Sbjct  241  TEERSRCAIM  250



>ref|XP_002279170.2| PREDICTED: tobamovirus multiplication protein 2A [Vitis vinifera]
Length=280

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR     TGVPVAG +D RPSRNDAWS RMREKYGLDTSEFTYNPSESNRY P   QP
Sbjct  211  LINRPPVAATGVPVAGAIDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESNRYPPGQQQP  270

Query  295  AEERGRCTIM  266
             EER RCTIM
Sbjct  271  TEERSRCTIM  280



>ref|XP_010461064.1| PREDICTED: tobamovirus multiplication protein 2A-like [Camelina 
sativa]
Length=280

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ APVTGVPVA T D RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP E
Sbjct  213  NRQAAPVTGVPVAPTSDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNE  272

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  273  EKGRCTIM  280



>ref|XP_006415200.1| hypothetical protein EUTSA_v10008423mg [Eutrema salsugineum]
 dbj|BAJ34310.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33553.1| hypothetical protein EUTSA_v10008423mg [Eutrema salsugineum]
Length=280

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ APVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPSES+R+Q    Q  E
Sbjct  213  NRQAAPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQQNE  272

Query  289  ERGRCTIM  266
            E+GRCTIM
Sbjct  273  EKGRCTIM  280



>ref|NP_001240069.1| uncharacterized protein LOC100793680 [Glycine max]
 gb|ACU21254.1| unknown [Glycine max]
Length=277

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR   P +G P  GTLD RPSRNDAWSARMREKYGLDTSEFTYNPSES+RYQ  N QP
Sbjct  208  LLNRPAGPASGAPATGTLDKRPSRNDAWSARMREKYGLDTSEFTYNPSESHRYQQVNPQP  267

Query  295  AEERGRCTIM  266
             EER RC IM
Sbjct  268  TEERSRCAIM  277



>ref|XP_004245872.1| PREDICTED: tobamovirus multiplication protein 2A [Solanum lycopersicum]
Length=284

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = -3

Query  475  MNNRQQA-PVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQ  299
            +NNR  A P TGVPV  TLD+RPSRNDAWS RMREKYGLDTSEFTYNPSESNRY PT  Q
Sbjct  214  INNRPPANPATGVPVTATLDNRPSRNDAWSTRMREKYGLDTSEFTYNPSESNRYPPTAAQ  273

Query  298  PAEERGRCTIM  266
            P EER  CTIM
Sbjct  274  PQEERKGCTIM  284



>ref|XP_011018623.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
 ref|XP_011018624.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
 ref|XP_011018625.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
Length=280

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR  AP  GVPV GTLD RP RNDAWS RMREKYGLDTSEF+YNPSE +R QP + QP
Sbjct  211  LLNRPPAPAAGVPVTGTLDQRPGRNDAWSTRMREKYGLDTSEFSYNPSEPHRLQPASAQP  270

Query  295  AEERGRCTIM  266
             EER RCTIM
Sbjct  271  TEERSRCTIM  280



>ref|XP_006368443.1| GMFP4 family protein [Populus trichocarpa]
 gb|ERP65012.1| GMFP4 family protein [Populus trichocarpa]
Length=280

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR  AP  GVPV+GTLD RP RNDAWS RMREKYGLDTSEF+YNPSE +R QP   QP
Sbjct  211  LLNRPPAPAAGVPVSGTLDQRPGRNDAWSTRMREKYGLDTSEFSYNPSEPHRLQPAAAQP  270

Query  295  AEERGRCTIM  266
             EER RCTIM
Sbjct  271  TEERSRCTIM  280



>gb|KJB37690.1| hypothetical protein B456_006G215600 [Gossypium raimondii]
 gb|KJB37691.1| hypothetical protein B456_006G215600 [Gossypium raimondii]
Length=277

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -3

Query  466  RQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEE  287
            R   P TGVPV G+LD RPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQ    QPAEE
Sbjct  211  RPPVPATGVPVTGSLDQRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQQAAPQPAEE  270

Query  286  RGRCTIM  266
               CTIM
Sbjct  271  SSCCTIM  277



>gb|EPS67767.1| hypothetical protein M569_07007 [Genlisea aurea]
Length=281

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + +R   P  G+PVAGTLD RPSRNDAWS RMREKYGLDT+EFTYNPS+ NRYQ +  QP
Sbjct  212  LISRPPVPAAGIPVAGTLDQRPSRNDAWSTRMREKYGLDTTEFTYNPSDPNRYQQSATQP  271

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  272  AEERSRCTIM  281



>gb|KHN21027.1| hypothetical protein glysoja_034149 [Glycine soja]
Length=250

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR   PV+G P  GTLD RPSRNDAWS RMREKYGLDTSEFTYNPSES+RYQ  N QP
Sbjct  181  LLNRPAGPVSGAPATGTLDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESHRYQQVNSQP  240

Query  295  AEERGRCTIM  266
             EE  RC IM
Sbjct  241  TEEGSRCAIM  250



>ref|XP_003524459.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Glycine 
max]
 ref|XP_006579675.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Glycine 
max]
 ref|XP_006579676.1| PREDICTED: tobamovirus multiplication protein 2A isoform X3 [Glycine 
max]
Length=277

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR   PV+G P  GTLD RPSRNDAWS RMREKYGLDTSEFTYNPSES+RYQ  N QP
Sbjct  208  LLNRPAGPVSGAPATGTLDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESHRYQQVNSQP  267

Query  295  AEERGRCTIM  266
             EE  RC IM
Sbjct  268  TEEGSRCAIM  277



>gb|KHG29162.1| Solute carrier family 28 member 3 [Gossypium arboreum]
Length=201

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  457  APVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGR  278
             P +GVPV+ +LD RPSRNDAWSARMREKYGLDTSEFTYNP+ESNRYQ     PAEER R
Sbjct  138  VPASGVPVSVSLDQRPSRNDAWSARMREKYGLDTSEFTYNPAESNRYQQVVPPPAEERSR  197

Query  277  CTIM  266
            CTIM
Sbjct  198  CTIM  201



>ref|XP_008354195.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=111

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSR-PSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQ  299
            ++NR   P TGVPVAG LD R P+RNDAWS RMREKYGLDT+EFTYNPSES+R+Q    Q
Sbjct  41   ISNRPAVPATGVPVAGALDQRTPNRNDAWSTRMREKYGLDTAEFTYNPSESHRFQQVAAQ  100

Query  298  PAEERGRCTIM  266
            P EER RC +M
Sbjct  101  PQEERSRCIVM  111



>ref|XP_006358577.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358578.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Solanum tuberosum]
Length=284

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = -3

Query  475  MNNRQQA-PVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQ  299
            ++NR  A P TGVPV  TLD+RPSRNDAWS RMREKYGLDTSEFTYNPSESNRY PT  Q
Sbjct  214  ISNRPPANPATGVPVTATLDNRPSRNDAWSTRMREKYGLDTSEFTYNPSESNRYPPTATQ  273

Query  298  PAEERGRCTIM  266
            P EER  C IM
Sbjct  274  PQEERKGCAIM  284



>gb|KJB51696.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
Length=219

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  457  APVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGR  278
             P +GVPV+ +LD RPSRNDAWSARMREKYGLDTSEFTYNP+ESNRYQ     PAEER R
Sbjct  156  VPASGVPVSVSLDQRPSRNDAWSARMREKYGLDTSEFTYNPAESNRYQQVVPPPAEERSR  215

Query  277  CTIM  266
            CTIM
Sbjct  216  CTIM  219



>ref|XP_007156638.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 ref|XP_007156639.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 gb|ESW28632.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 gb|ESW28633.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
Length=283

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -3

Query  448  TGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTI  269
            TG+PV+GT+D RPSR+DAWSARMREKYGLDTSEFTYNPSES+R+Q  N QP EE+ RCTI
Sbjct  223  TGLPVSGTIDQRPSRSDAWSARMREKYGLDTSEFTYNPSESSRFQQVNSQPTEEKSRCTI  282

Query  268  M  266
            M
Sbjct  283  M  283



>gb|KHG29161.1| Stk31 [Gossypium arboreum]
Length=259

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  457  APVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGR  278
             P +GVPV+ +LD RPSRNDAWSARMREKYGLDTSEFTYNP+ESNRYQ     PAEER R
Sbjct  196  VPASGVPVSVSLDQRPSRNDAWSARMREKYGLDTSEFTYNPAESNRYQQVVPPPAEERSR  255

Query  277  CTIM  266
            CTIM
Sbjct  256  CTIM  259



>gb|KJB51694.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
 gb|KJB51695.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
Length=280

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  457  APVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGR  278
             P +GVPV+ +LD RPSRNDAWSARMREKYGLDTSEFTYNP+ESNRYQ     PAEER R
Sbjct  217  VPASGVPVSVSLDQRPSRNDAWSARMREKYGLDTSEFTYNPAESNRYQQVVPPPAEERSR  276

Query  277  CTIM  266
            CTIM
Sbjct  277  CTIM  280



>ref|XP_008784675.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
 ref|XP_008784676.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
 ref|XP_008784677.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
Length=282

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + +RQ  P TGVPV GTLD RPSRNDAWS RMREKYGLDTSEFTYNP + +R+Q  +  P
Sbjct  213  LIHRQAVPATGVPVPGTLDQRPSRNDAWSQRMREKYGLDTSEFTYNPLDPSRHQQASAPP  272

Query  295  AEERGRCTIM  266
            A ERGRCTI+
Sbjct  273  AAERGRCTIL  282



>gb|KEH31557.1| tetraspanin family protein [Medicago truncatula]
Length=280

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR   P  GVPV GT D R +RNDAWS RMREKYGLDTSEFTYNPSES R+Q  N QP
Sbjct  211  LLNRPAGPAPGVPVTGTTDPRSNRNDAWSTRMREKYGLDTSEFTYNPSESQRFQQVNSQP  270

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  271  AEERSRCTIM  280



>ref|XP_004509001.1| PREDICTED: tetraspanin-20-like isoform X1 [Cicer arietinum]
 ref|XP_004509002.1| PREDICTED: tetraspanin-20-like isoform X2 [Cicer arietinum]
Length=280

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NR   P  GVPV G +D R SRNDAWS RMREKYGLDTSEFTYNPSES+R+Q  N QP
Sbjct  211  LLNRPAGPAPGVPVTGPVDQRSSRNDAWSTRMREKYGLDTSEFTYNPSESHRFQQVNSQP  270

Query  295  AEERGRCTIM  266
             EER RCTIM
Sbjct  271  TEERSRCTIM  280



>gb|KCW71821.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=260

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -3

Query  454  PVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRC  275
            P TGVPVAGTLD RP RNDAW+ARMREKYGLDTSEFTYNPSES+R+Q    Q AEER RC
Sbjct  198  PATGVPVAGTLDQRPIRNDAWTARMREKYGLDTSEFTYNPSESSRHQQVPPQNAEERSRC  257

Query  274  TIM  266
            TIM
Sbjct  258  TIM  260



>ref|XP_010055355.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 gb|KCW71822.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=279

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -3

Query  454  PVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRC  275
            P TGVPVAGTLD RP RNDAW+ARMREKYGLDTSEFTYNPSES+R+Q    Q AEER RC
Sbjct  217  PATGVPVAGTLDQRPIRNDAWTARMREKYGLDTSEFTYNPSESSRHQQVPPQNAEERSRC  276

Query  274  TIM  266
            TIM
Sbjct  277  TIM  279



>ref|XP_009345636.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009345644.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
Length=282

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSR-PSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQ  299
            ++NR   P TGVPVAG LD R P+RNDAWS RMREKYGLDT+EFTYNPSES+R+Q    Q
Sbjct  212  ISNRPAVPATGVPVAGALDQRTPNRNDAWSTRMREKYGLDTAEFTYNPSESHRFQQVAAQ  271

Query  298  PAEERGRCTIM  266
            P EER RC +M
Sbjct  272  PQEERSRCIVM  282



>ref|XP_010933519.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
Length=283

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ  P TGVPV   LD RPSRNDAWS RMREKYGLDTSEFT+NPS  +RY   +  P
Sbjct  214  LINRQGVPATGVPVPAILDQRPSRNDAWSQRMREKYGLDTSEFTHNPSGLSRYHQASAPP  273

Query  295  AEERGRCTIM  266
            AEERGRCTI+
Sbjct  274  AEERGRCTIL  283



>ref|XP_010919853.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
 ref|XP_010919854.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
Length=282

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + +RQ  P TGVPV GTLD RPSRNDAWS RMREKYGLDTSEFTYNP + +R+Q  +  P
Sbjct  213  LMHRQGVPATGVPVHGTLDQRPSRNDAWSQRMREKYGLDTSEFTYNPLDPSRHQQASAPP  272

Query  295  AEERGRCTIM  266
             +ERGRCTI+
Sbjct  273  PDERGRCTIL  282



>ref|XP_008373605.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=109

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 54/71 (76%), Gaps = 3/71 (4%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRP-SRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQ  299
            + NRQ  P TG PVAGTLD RP SRNDAWS RMREKYGLDT+EFTYNPSES R    + Q
Sbjct  41   IANRQAVPATGAPVAGTLDQRPPSRNDAWSTRMREKYGLDTAEFTYNPSESQRQ--VSAQ  98

Query  298  PAEERGRCTIM  266
            P EER RC IM
Sbjct  99   PQEERSRCIIM  109



>ref|XP_010677296.1| PREDICTED: tobamovirus multiplication protein 2A [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 56/79 (71%), Gaps = 9/79 (11%)
 Frame = -3

Query  475  MNNRQQA---------PVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESN  323
            +N RQ A         P TGVPVAG +D RPSRNDAWSARMREKYGLDTSEFTYNP+ES 
Sbjct  200  INQRQSAKQPLINRPPPATGVPVAGAIDQRPSRNDAWSARMREKYGLDTSEFTYNPTESG  259

Query  322  RYQPTNVQPAEERGRCTIM  266
            RYQ    QP  E  RCTIM
Sbjct  260  RYQQPAAQPTVEGNRCTIM  278



>ref|XP_010518876.1| PREDICTED: tobamovirus multiplication protein 2A [Tarenaya hassleriana]
 ref|XP_010518877.1| PREDICTED: tobamovirus multiplication protein 2A [Tarenaya hassleriana]
Length=279

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ    TGVPVA TLD RPSRNDAWS RMREKYGLDTSEFTYNPSES+R+Q    Q  E
Sbjct  212  NRQPVAATGVPVAPTLDQRPSRNDAWSTRMREKYGLDTSEFTYNPSESHRFQQMPAQQNE  271

Query  289  ERGRCTIM  266
            ER RC +M
Sbjct  272  ERSRCIVM  279



>ref|XP_007156640.1| hypothetical protein PHAVU_002G005000g [Phaseolus vulgaris]
 gb|ESW28634.1| hypothetical protein PHAVU_002G005000g [Phaseolus vulgaris]
Length=282

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +N     P  G+P +GT D R SRNDAWS RMREKYGLDTSEFTYNPSES+R+Q  N Q 
Sbjct  213  LNRPAAGPSAGLPASGTTDQRSSRNDAWSTRMREKYGLDTSEFTYNPSESSRFQQVNSQI  272

Query  295  AEERGRCTIM  266
            AEE+ RCTIM
Sbjct  273  AEEKSRCTIM  282



>gb|EYU17843.1| hypothetical protein MIMGU_mgv1a0124672mg, partial [Erythranthe 
guttata]
Length=221

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +N     PVTG PV   LD R SR D+WS RMREKYGLDTSEFTYNPSESNRYQ +  QP
Sbjct  151  INRPAGGPVTGPPVTNNLDQRTSRTDSWSTRMREKYGLDTSEFTYNPSESNRYQQSATQP  210

Query  295  AEERGRCTIM  266
            +EER RC I+
Sbjct  211  SEERNRCCII  220



>dbj|BAK04010.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + + Q AP TGVPV  TLD R SRNDAWS RMREKYGLDTS+FTYNPS++ RYQ     P
Sbjct  217  LIHSQNAPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFTYNPSDATRYQQNGAPP  275

Query  295  AEERGRCTIM  266
            AEER RCT+M
Sbjct  276  AEERSRCTVM  285



>ref|XP_006659267.1| PREDICTED: tobamovirus multiplication protein 2A-like [Oryza 
brachyantha]
Length=287

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + + Q AP TGVPVA TL+ R SRNDAWS RMREKYGLDTS+FTYNPS++ RYQ     P
Sbjct  219  LIHSQNAPATGVPVA-TLEQRASRNDAWSQRMREKYGLDTSQFTYNPSDAGRYQQNGAPP  277

Query  295  AEERGRCTIM  266
            AEER RC IM
Sbjct  278  AEERSRCVIM  287



>gb|EMS54049.1| hypothetical protein TRIUR3_29725 [Triticum urartu]
Length=285

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + + Q AP TGVPV  TLD R SRNDAWS RMREKYGLDTS+FTYNPS++ RYQ     P
Sbjct  217  LIHSQNAPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFTYNPSDATRYQQNGAPP  275

Query  295  AEERGRCTIM  266
            AEER RCT+M
Sbjct  276  AEERSRCTVM  285



>ref|XP_003573849.1| PREDICTED: tobamovirus multiplication protein 2A-like [Brachypodium 
distachyon]
Length=283

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + + Q AP TGVPV  TLD R SRNDAWS RMREKYGLDTS+FTYNPS+S RYQ     P
Sbjct  215  LIHSQNAPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFTYNPSDSARYQQNGAPP  273

Query  295  AEERGRCTIM  266
            AEER RCTI+
Sbjct  274  AEERNRCTIL  283



>ref|XP_010934868.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Elaeis 
guineensis]
Length=280

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ  P +GVP   +LD RPSRNDAWS RMREKYGLDTSEFTYNPS+ +R+Q   +  
Sbjct  214  LINRQGLPPSGVP---SLDHRPSRNDAWSQRMREKYGLDTSEFTYNPSDPSRFQQATITS  270

Query  295  AEERGRCTIM  266
            AEERGRCTI+
Sbjct  271  AEERGRCTIL  280



>gb|EYU33039.1| hypothetical protein MIMGU_mgv1a011319mg [Erythranthe guttata]
Length=285

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +N     PVTG PV   LD R SR D+WS RMREKYGLDTSEFTYNPSESNRYQ +  QP
Sbjct  215  INRPAGGPVTGPPVTNNLDQRTSRTDSWSTRMREKYGLDTSEFTYNPSESNRYQQSATQP  274

Query  295  AEERGRCTIM  266
            +EER RC I+
Sbjct  275  SEERNRCCII  284



>ref|XP_008788693.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Phoenix dactylifera]
Length=202

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ  P +GVP   +LD RPSRNDAWS RMREKYGLDTSEFTYNPS+ +R+Q   V  
Sbjct  136  LINRQGLPPSGVP---SLDHRPSRNDAWSQRMREKYGLDTSEFTYNPSDPSRFQQATVTS  192

Query  295  AEERGRCTIM  266
            AEE GRCTI+
Sbjct  193  AEESGRCTIL  202



>gb|EAZ06370.1| hypothetical protein OsI_28599 [Oryza sativa Indica Group]
 gb|EAZ42170.1| hypothetical protein OsJ_26734 [Oryza sativa Japonica Group]
Length=134

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + + Q  P TGVPVA TL+ R SRNDAWS RMREKYGLDTS+FTYNPS+ +RYQ     P
Sbjct  66   LIHSQNVPATGVPVA-TLEQRASRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPP  124

Query  295  AEERGRCTIM  266
            AEER RC I+
Sbjct  125  AEERNRCVIL  134



>ref|XP_008788690.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008788691.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008788692.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
Length=279

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ  P +GVP   +LD RPSRNDAWS RMREKYGLDTSEFTYNPS+ +R+Q   V  
Sbjct  213  LINRQGLPPSGVP---SLDHRPSRNDAWSQRMREKYGLDTSEFTYNPSDPSRFQQATVTS  269

Query  295  AEERGRCTIM  266
            AEE GRCTI+
Sbjct  270  AEESGRCTIL  279



>ref|XP_009398578.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + N+Q AP TG+PV+GTLD RPSR+DAWS RMREKYGLDTS+FTYN S+ NR Q +    
Sbjct  214  LINQQGAPATGMPVSGTLDQRPSRHDAWSQRMREKYGLDTSKFTYNSSDPNRSQQSATPS  273

Query  295  AEERGRCTIM  266
            +EERG C I+
Sbjct  274  SEERGGCNIL  283



>gb|AFW87792.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=113

 Score = 93.2 bits (230),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = -3

Query  463  QQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEER  284
            Q  P TGVPV  TLD R SRNDAWS RMREKYGLDTS+FTYNPS+ +RYQ      AEER
Sbjct  49   QNVPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGTPRAEER  107

Query  283  GRCTIM  266
             RCTIM
Sbjct  108  SRCTIM  113



>ref|NP_001061444.1| Os08g0282000 [Oryza sativa Japonica Group]
 dbj|BAC99958.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF23358.1| Os08g0282000 [Oryza sativa Japonica Group]
 dbj|BAG95056.1| unnamed protein product [Oryza sativa Japonica Group]
Length=284

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + + Q  P TGVPVA TL+ R SRNDAWS RMREKYGLDTS+FTYNPS+ +RYQ     P
Sbjct  216  LIHSQNVPATGVPVA-TLEQRASRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPP  274

Query  295  AEERGRCTIM  266
            AEER RC I+
Sbjct  275  AEERNRCVIL  284



>gb|ACL54399.1| unknown [Zea mays]
 gb|AFW87793.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
 gb|AFW87794.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=129

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = -3

Query  463  QQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEER  284
            Q  P TGVPV  TLD R SRNDAWS RMREKYGLDTS+FTYNPS+ +RYQ      AEER
Sbjct  65   QNVPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGTPRAEER  123

Query  283  GRCTIM  266
             RCTIM
Sbjct  124  SRCTIM  129



>gb|EYU33040.1| hypothetical protein MIMGU_mgv1a011318mg [Erythranthe guttata]
Length=285

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +N     PVTGVPV  T D+  SR D+WS RMREKYGLDTSE+TYNPSESNRYQ +  QP
Sbjct  215  INKPAGGPVTGVPVTNTPDNLTSRTDSWSRRMREKYGLDTSEYTYNPSESNRYQQSTTQP  274

Query  295  AEERGR-CTIM  266
            +EER R CTIM
Sbjct  275  SEERSRGCTIM  285



>ref|XP_006847670.1| hypothetical protein AMTR_s00149p00039360 [Amborella trichopoda]
 gb|ERN09251.1| hypothetical protein AMTR_s00149p00039360 [Amborella trichopoda]
Length=284

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = -3

Query  472  NNRQQ-APVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            +NRQ  A VTGVPV+G  D R SRNDAWS R+REKYGLDTSEFTYNP++S+R+Q      
Sbjct  215  SNRQAGAQVTGVPVSGASDQRLSRNDAWSTRLREKYGLDTSEFTYNPTDSSRFQQQAAPV  274

Query  295  AEERGRCTIM  266
            AEER RC+I+
Sbjct  275  AEERSRCSIL  284



>ref|NP_001150827.1| tetraspanin family protein [Zea mays]
 ref|XP_008678655.1| PREDICTED: tetraspanin family protein isoform X1 [Zea mays]
 gb|ACN27909.1| unknown [Zea mays]
 tpg|DAA46389.1| TPA: tetraspanin family protein isoform 1 [Zea mays]
 tpg|DAA46390.1| TPA: tetraspanin family protein isoform 2 [Zea mays]
Length=279

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + + Q  P TGVPV  TLD R SRNDAWS RMREKYGLDTS+FTYNPS+ +RYQ      
Sbjct  211  LIHAQNVPATGVPVP-TLDQRSSRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPQ  269

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  270  AEERSRCTIM  279



>ref|XP_009371175.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009371176.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009371177.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
Length=280

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRP-SRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQ  299
            + NRQ  P TG PVAG LD RP +RNDAWS RMREKYGL+T+EFTYNPSES      + Q
Sbjct  212  IANRQAVPATGAPVAGALDQRPPNRNDAWSTRMREKYGLNTAEFTYNPSESQ--SQVSAQ  269

Query  298  PAEERGRCTIM  266
            P EER RC IM
Sbjct  270  PQEERSRCIIM  280



>ref|NP_001146619.1| hypothetical protein [Zea mays]
 gb|ACF86508.1| unknown [Zea mays]
 gb|ACR38384.1| unknown [Zea mays]
 gb|AFW87797.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=279

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + + Q  P TGVPV  TLD R SRNDAWS RMREKYGLDTS+FTYNPS+ +RYQ      
Sbjct  211  LIHTQNVPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGTPR  269

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  270  AEERSRCTIM  279



>ref|XP_004983591.1| PREDICTED: tetraspanin-18-like isoform X1 [Setaria italica]
 ref|XP_004983592.1| PREDICTED: tetraspanin-18-like isoform X2 [Setaria italica]
Length=278

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + + Q  P TGVPV  TLD R SRNDAWS RMREKYGLDTS+FTYNPS+ +RYQ      
Sbjct  210  LIHGQNVPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPQ  268

Query  295  AEERGRCTIM  266
            AEER RCTI+
Sbjct  269  AEERSRCTIL  278



>gb|ACG40574.1| tetraspanin family protein [Zea mays]
Length=279

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + + Q  P TGVPV  TLD R SRNDAWS RMREKYGLDTS+FTYNPS+ +RYQ      
Sbjct  211  LIHAQNVPATGVPVP-TLDQRSSRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPQ  269

Query  295  AEERGRCTIM  266
            AEER +CTIM
Sbjct  270  AEERSQCTIM  279



>gb|AGW24511.1| hypothetical protein, partial [Avicennia marina var. marina]
Length=91

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNR  320
            + NR  AP TG PV GTLD RPSRNDAWS RMREKYGLDTSEFTY+PSESNR
Sbjct  37   LINRPAAPTTGGPVVGTLDQRPSRNDAWSQRMREKYGLDTSEFTYSPSESNR  88



>ref|XP_010538377.1| PREDICTED: tobamovirus multiplication protein 2A-like [Tarenaya 
hassleriana]
 ref|XP_010538378.1| PREDICTED: tobamovirus multiplication protein 2A-like [Tarenaya 
hassleriana]
Length=280

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = -3

Query  469  NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAE  290
            NRQ    TGVPV   +   PSR+DAWS RMREKYGLDTSEFTYNPSE+NR+Q    Q  +
Sbjct  212  NRQPVTATGVPVTTAIPQPPSRDDAWSTRMREKYGLDTSEFTYNPSEANRFQQMPSQQND  271

Query  289  ERG-RCTIM  266
            ERG RCTIM
Sbjct  272  ERGSRCTIM  280



>gb|KCW77897.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
Length=188

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  424  LDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            LD RPSRNDAWS RMREKYGLDT+EF+YNP+ESNR+Q    QP EER RC+IM
Sbjct  136  LDQRPSRNDAWSTRMREKYGLDTAEFSYNPNESNRFQQGPTQPTEERSRCSIM  188



>gb|KCW77895.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
 gb|KCW77896.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
Length=204

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  424  LDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            LD RPSRNDAWS RMREKYGLDT+EF+YNP+ESNR+Q    QP EER RC+IM
Sbjct  152  LDQRPSRNDAWSTRMREKYGLDTAEFSYNPNESNRFQQGPTQPTEERSRCSIM  204



>ref|XP_010053569.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 ref|XP_010053570.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 ref|XP_010053571.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
Length=284

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  424  LDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            LD RPSRNDAWS RMREKYGLDT+EF+YNP+ESNR+Q    QP EER RC+IM
Sbjct  232  LDQRPSRNDAWSTRMREKYGLDTAEFSYNPNESNRFQQGPTQPTEERSRCSIM  284



>ref|XP_006850026.1| hypothetical protein AMTR_s00022p00189290 [Amborella trichopoda]
 gb|ERN11607.1| hypothetical protein AMTR_s00022p00189290 [Amborella trichopoda]
Length=276

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + +R  AP TG+PV    D R +R DAWS RM+EKYGLDTSEFTYNPSES RY      P
Sbjct  208  LISRAGAPATGIPV-NIADQRQNRPDAWSTRMKEKYGLDTSEFTYNPSESGRYTAPAPAP  266

Query  295  AEERGRCTIM  266
            AEER RCTIM
Sbjct  267  AEERSRCTIM  276



>gb|ABK25767.1| unknown [Picea sitchensis]
Length=196

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ A V  V   G+ + R SRNDAWS RMREKYGLDTSEFTYNP+++NRY      P
Sbjct  128  LINRQGAQVAAVSTPGS-EQRTSRNDAWSTRMREKYGLDTSEFTYNPTDANRYAQPAPPP  186

Query  295  AEERGRCTIM  266
             EE+ RCTIM
Sbjct  187  PEEKSRCTIM  196



>gb|ABK22053.1| unknown [Picea sitchensis]
Length=282

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ A V  V   G+ + R SRNDAWS RMREKYGLDTSEFTYNP+++NRY      P
Sbjct  214  LINRQGAQVAAVSTPGS-EQRTSRNDAWSTRMREKYGLDTSEFTYNPTDANRYAQPAPPP  272

Query  295  AEERGRCTIM  266
             EE+ RCTIM
Sbjct  273  PEEKSRCTIM  282



>ref|XP_009391069.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391140.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391209.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391294.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=275

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 47/71 (66%), Gaps = 5/71 (7%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ  P    PV GTLD RPSRNDAWS RMREKYGL+T EF Y  S  +RYQ      
Sbjct  209  LMNRQGVP----PVLGTLDHRPSRNDAWSQRMREKYGLNTFEFAYKQSNPSRYQQATASQ  264

Query  295  AEERG-RCTIM  266
            AEERG RC I+
Sbjct  265  AEERGSRCIIL  275



>ref|XP_004300273.1| PREDICTED: tobamovirus multiplication protein 2A [Fragaria vesca 
subsp. vesca]
Length=271

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -3

Query  457  APVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGR  278
             P TGVPVAG  + RP+RNDAWS RMREKYGLDTS + Y+PS+S+R Q    QP EER R
Sbjct  208  VPATGVPVAGAGNQRPTRNDAWSTRMREKYGLDTSLYPYDPSDSSRLQQPQAQPQEERSR  267

Query  277  CTIM  266
            C+IM
Sbjct  268  CSIM  271



>ref|XP_002972323.1| hypothetical protein SELMODRAFT_172827 [Selaginella moellendorffii]
 gb|EFJ26409.1| hypothetical protein SELMODRAFT_172827 [Selaginella moellendorffii]
Length=282

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + NRQ       P A   +SRP RNDAWS RMREKYGLDT+EFTYNP +S R    N  P
Sbjct  214  LLNRQATQSNATPSAPA-ESRPPRNDAWSTRMREKYGLDTAEFTYNPVDSKRVPAQNQPP  272

Query  295  AEERGRCTIM  266
             E +  C IM
Sbjct  273  PEPKRGCVIM  282



>gb|ACN35034.1| unknown [Zea mays]
 gb|AFW61169.1| hypothetical protein ZEAMMB73_111506 [Zea mays]
Length=275

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 7/53 (13%)
 Frame = -3

Query  424  LDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            LD RP RNDAWS RMREKYG+D    +++P   NR+QP  + P E+R RCTI+
Sbjct  230  LDYRPIRNDAWSQRMREKYGVD----SFDP---NRFQPATISPGEQRNRCTIL  275



>ref|XP_006659854.1| PREDICTED: tobamovirus multiplication protein 2A-like [Oryza 
brachyantha]
Length=250

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 7/53 (13%)
 Frame = -3

Query  424  LDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            LD RP RNDAWS RMREKYG+D    T++P   NR+Q   + PAE+R RCTI+
Sbjct  205  LDYRPIRNDAWSQRMREKYGVD----TFDP---NRFQQATISPAEQRSRCTIL  250



>ref|XP_003573463.1| PREDICTED: tobamovirus multiplication protein 2A-like [Brachypodium 
distachyon]
Length=278

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 10/70 (14%)
 Frame = -3

Query  475  MNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQP  296
            + N+Q A    VP    LD RP RNDAWS RMR+KYG+D    T++P   NR+Q   + P
Sbjct  219  LVNKQAAADPRVP---NLDYRPIRNDAWSQRMRDKYGVD----TFDP---NRFQQATISP  268

Query  295  AEERGRCTIM  266
            AE+R RCTI+
Sbjct  269  AEQRSRCTIL  278



>ref|XP_004972786.1| PREDICTED: tetraspanin-20-like isoform X2 [Setaria italica]
Length=278

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 7/53 (13%)
 Frame = -3

Query  424  LDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            LD RP RNDAWS RMREKYG+D    +++P   NR+Q   + PAE+R RCTI+
Sbjct  233  LDYRPIRNDAWSQRMREKYGVD----SFDP---NRFQQATISPAEQRNRCTIL  278



>ref|XP_001775831.1| predicted protein [Physcomitrella patens]
 gb|EDQ59370.1| predicted protein [Physcomitrella patens]
Length=297

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -3

Query  421  DSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            ++RP R+DAWS RMREKYGLDT+EFT NPSES R         E++ RCTIM
Sbjct  247  ETRP-RSDAWSIRMREKYGLDTTEFTSNPSESMRLSNQTPAAEEQQSRCTIM  297



>ref|NP_001061041.1| Os08g0159100 [Oryza sativa Japonica Group]
 dbj|BAC99658.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF22955.1| Os08g0159100 [Oryza sativa Japonica Group]
 dbj|BAG92210.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91640.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68082.1| hypothetical protein OsJ_26119 [Oryza sativa Japonica Group]
Length=278

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 7/53 (13%)
 Frame = -3

Query  424  LDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            LD RP RNDAWS RMREKYG+D    T++P   NR+Q   + PAE+R RC I+
Sbjct  233  LDYRPIRNDAWSQRMREKYGVD----TFDP---NRFQQATISPAEQRNRCAIL  278



>ref|XP_002443902.1| hypothetical protein SORBIDRAFT_07g004040 [Sorghum bicolor]
 gb|EES13397.1| hypothetical protein SORBIDRAFT_07g004040 [Sorghum bicolor]
Length=274

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 42/66 (64%), Gaps = 8/66 (12%)
 Frame = -3

Query  463  QQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEER  284
            QQA  T  P    LD RP RNDAWS RMREKYG+D    +++P   NR+Q   + P E+R
Sbjct  217  QQAAATD-PRVPNLDYRPIRNDAWSQRMREKYGVD----SFDP---NRFQQATISPGEQR  268

Query  283  GRCTIM  266
             RCTI+
Sbjct  269  NRCTIL  274



>ref|XP_001763914.1| predicted protein [Physcomitrella patens]
 gb|EDQ71318.1| predicted protein [Physcomitrella patens]
Length=284

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = -3

Query  433  AGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNR-YQPTNV-QPAEERGRCTIM  266
            A  +++R  R DAWS RMREKYGLDTSEFT  PSES R  QP     P E++  CTIM
Sbjct  227  AAAVEARAPRLDAWSTRMREKYGLDTSEFTSKPSESRRPLQPNQTPGPVEQQNFCTIM  284



>gb|EEC82932.1| hypothetical protein OsI_27894 [Oryza sativa Indica Group]
Length=305

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 7/53 (13%)
 Frame = -3

Query  424  LDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            LD RP RNDAWS RMREKYG+D    T++P   NR+Q   + PAE+R RC I+
Sbjct  260  LDYRPIRNDAWSQRMREKYGVD----TFDP---NRFQQATISPAEQRNRCAIL  305



>gb|EYU17846.1| hypothetical protein MIMGU_mgv1a0219311mg, partial [Erythranthe 
guttata]
Length=35

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = -3

Query  370  YGLDTSEFTYNPSESNRYQPTNVQPAEERGR-CTI  269
            YGLDTSE+TYNPSESNRYQ +  QP+EER R CTI
Sbjct  1    YGLDTSEYTYNPSESNRYQQSTTQPSEERSRGCTI  35



>gb|KCW71823.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=251

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  454  PVTGVPVAGTLDSRPSRNDAWSARMREK  371
            P TGVPVAGTLD RP RNDAW+ARMREK
Sbjct  217  PATGVPVAGTLDQRPIRNDAWTARMREK  244



>ref|XP_001762411.1| predicted protein [Physcomitrella patens]
 gb|EDQ72878.1| predicted protein [Physcomitrella patens]
Length=298

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -3

Query  421  DSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            ++RP R+DAWS RMREKYGLDT+EF+ N  +  R         E++ RC IM
Sbjct  247  EARPPRSDAWSTRMREKYGLDTTEFSSNSPDMRRLPNQTPGAEEQQSRCIIM  298



>ref|XP_005644373.1| hypothetical protein COCSUDRAFT_44255 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19829.1| hypothetical protein COCSUDRAFT_44255 [Coccomyxa subellipsoidea 
C-169]
Length=244

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 4/52 (8%)
 Frame = -3

Query  409  SRNDAWSARMREKYGLDTSEFTYNPSE----SNRYQPTNVQPAEERGRCTIM  266
            +R DAWSARMR+KYGLDTS +TYNP +    S    P   + A    RC +M
Sbjct  193  ARTDAWSARMRDKYGLDTSRYTYNPDDRRASSGSELPAGAETAATSRRCAVM  244



>ref|XP_006854320.1| hypothetical protein AMTR_s00039p00118150 [Amborella trichopoda]
 gb|ERN15787.1| hypothetical protein AMTR_s00039p00118150 [Amborella trichopoda]
Length=313

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = -3

Query  421  DSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEE-RGRCTIM  266
            D +  R DAWSARMREKYGL+ +EF YN  E++    T ++  EE +GRC IM
Sbjct  265  DIKNIRTDAWSARMREKYGLNPNEFAYNSIEAS----TGMRNGEENQGRCIIM  313



>ref|XP_004966578.1| PREDICTED: tetraspanin-18-like [Setaria italica]
Length=251

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 2/50 (4%)
 Frame = -3

Query  460  QAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQP  311
            QAP   +P   T+D+R  R D WS+RMR+KYGL+TS++TYN  ++N   P
Sbjct  203  QAPPPYLPT--TVDTRGFRPDLWSSRMRQKYGLNTSDYTYNTVDANAAPP  250



>ref|XP_002437655.1| hypothetical protein SORBIDRAFT_10g031310 [Sorghum bicolor]
 gb|EER89022.1| hypothetical protein SORBIDRAFT_10g031310 [Sorghum bicolor]
Length=251

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = -3

Query  460  QAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQ  314
            QAP   +P   T+D+R +R D WS+ +R KYGL+TS++TYN  ++N  Q
Sbjct  203  QAPAPYLPT--TVDARGARPDLWSSTLRHKYGLNTSDYTYNTMDANAAQ  249



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567171140730