BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF048C06

Length=634
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008340166.1|  PREDICTED: uncharacterized protein LOC103403120  36.6    4e-04   



>ref|XP_008340166.1| PREDICTED: uncharacterized protein LOC103403120 [Malus domestica]
 ref|XP_008361836.1| PREDICTED: uncharacterized protein LOC103425520 [Malus domestica]
Length=92

 Score = 36.6 bits (83),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -2

Query  312  TRSPEIMPSLNRFFSDPQ  259
            TR+P+IMPS+N++FSDPQ
Sbjct  72   TRAPQIMPSINKYFSDPQ  89


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 34/70 (49%), Gaps = 3/70 (4%)
 Frame = -1

Query  508  PKVFSLVVVPRG*AVGFWGFQVIREYPPPIPKFGVYKEGRAAGRFWSIVRGGRSMVEHSF  329
            P+VF L     G AVG  G Q++R      P+  V K+ R AG   +   G R   EH  
Sbjct  10   PEVFPLFAAV-GVAVGICGMQLVRNITSN-PEVRVTKQNRTAGVLENHEEGER-YAEHGL  66

Query  328  RKFVPNKKPR  299
            RK+V  + P+
Sbjct  67   RKYVRTRAPQ  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500