BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF047P18

Length=552
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009590977.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        164   2e-45   Nicotiana tomentosiformis
ref|XP_004234074.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    162   7e-45   Solanum lycopersicum
gb|EYU28126.1|  hypothetical protein MIMGU_mgv1a007967mg                161   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_010316856.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    160   3e-44   Solanum lycopersicum
ref|XP_009785426.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        160   3e-44   Nicotiana sylvestris
ref|XP_004233053.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    160   3e-44   Solanum lycopersicum
ref|XP_009607196.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    160   3e-44   Nicotiana tomentosiformis
ref|XP_009800423.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    160   4e-44   Nicotiana sylvestris
gb|EYU28125.1|  hypothetical protein MIMGU_mgv1a007967mg                161   4e-44   Erythranthe guttata [common monkey flower]
ref|XP_006358089.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    158   3e-43   Solanum tuberosum [potatoes]
ref|XP_006358087.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    158   3e-43   Solanum tuberosum [potatoes]
ref|XP_011101448.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        151   7e-41   Sesamum indicum [beniseed]
emb|CDO96875.1|  unnamed protein product                                149   3e-40   Coffea canephora [robusta coffee]
ref|XP_011033513.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    149   1e-39   Populus euphratica
ref|XP_002305719.1|  hypothetical protein POPTR_0004s06100g             149   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_006377531.1|  hypothetical protein POPTR_0011s06800g             145   3e-39   
ref|XP_002522271.1|  BRASSINAZOLE-RESISTANT 2 protein, putative         147   3e-39   Ricinus communis
ref|XP_007025289.1|  BES1/BZR1                                          146   8e-39   Theobroma cacao [chocolate]
gb|KDP21147.1|  hypothetical protein JCGZ_21618                         146   8e-39   Jatropha curcas
gb|KHG25078.1|  BES1/BZR1 4 -like protein                               145   1e-38   Gossypium arboreum [tree cotton]
ref|XP_011039378.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        145   1e-38   Populus euphratica
gb|KJB69668.1|  hypothetical protein B456_011G036300                    144   6e-38   Gossypium raimondii
gb|KJB13026.1|  hypothetical protein B456_002G052400                    144   7e-38   Gossypium raimondii
gb|KHG15415.1|  BES1/BZR1 4 -like protein                               144   7e-38   Gossypium arboreum [tree cotton]
gb|KDO77946.1|  hypothetical protein CISIN_1g020318mg                   141   9e-38   Citrus sinensis [apfelsine]
ref|XP_006449559.1|  hypothetical protein CICLE_v10015910mg             141   4e-37   Citrus clementina [clementine]
ref|XP_010242162.1|  PREDICTED: BES1/BZR1 homolog protein 4             140   8e-37   Nelumbo nucifera [Indian lotus]
ref|XP_007021866.1|  BES1/BZR1                                          140   1e-36   
ref|XP_004309625.1|  PREDICTED: BES1/BZR1 homolog protein 4             140   2e-36   Fragaria vesca subsp. vesca
ref|XP_002267082.1|  PREDICTED: BES1/BZR1 homolog protein 4             140   2e-36   Vitis vinifera
gb|KJB45771.1|  hypothetical protein B456_007G327000                    139   3e-36   Gossypium raimondii
ref|XP_004137229.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        139   5e-36   Cucumis sativus [cucumbers]
gb|KHG20428.1|  BES1/BZR1 4 -like protein                               139   5e-36   Gossypium arboreum [tree cotton]
ref|XP_006442379.1|  hypothetical protein CICLE_v10021151mg             137   9e-36   
ref|XP_008371512.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        138   1e-35   Malus domestica [apple tree]
ref|XP_008451746.1|  PREDICTED: BES1/BZR1 homolog protein 4             138   1e-35   Cucumis melo [Oriental melon]
gb|KJB68361.1|  hypothetical protein B456_010G240700                    137   2e-35   Gossypium raimondii
ref|XP_006442380.1|  hypothetical protein CICLE_v10021151mg             137   3e-35   Citrus clementina [clementine]
ref|XP_007211637.1|  hypothetical protein PRUPE_ppa008675mg             137   3e-35   Prunus persica
ref|XP_006477843.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    137   3e-35   Citrus sinensis [apfelsine]
ref|XP_002317445.1|  brassinosteroid signaling positive regulator...    136   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_007211588.1|  hypothetical protein PRUPE_ppa008637mg             136   4e-35   Prunus persica
ref|XP_003596274.1|  Brassinosteroid signaling positive regulator...    138   5e-35   
ref|XP_008226380.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        136   5e-35   Prunus mume [ume]
gb|AES66525.2|  brassinazole-resistant 1 protein                        138   6e-35   Medicago truncatula
gb|KHG21553.1|  BES1/BZR1 4 -like protein                               135   7e-35   Gossypium arboreum [tree cotton]
ref|XP_008443587.1|  PREDICTED: BES1/BZR1 homolog protein 4             135   7e-35   Cucumis melo [Oriental melon]
ref|XP_004147390.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        135   8e-35   Cucumis sativus [cucumbers]
ref|XP_006348323.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        135   9e-35   Solanum tuberosum [potatoes]
ref|XP_008383594.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        135   9e-35   
ref|XP_010644097.1|  PREDICTED: BES1/BZR1 homolog protein 4             135   1e-34   Vitis vinifera
ref|XP_010093488.1|  hypothetical protein L484_017551                   135   2e-34   
ref|XP_009352718.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        134   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_011044050.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        134   3e-34   Populus euphratica
ref|XP_010052157.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    132   1e-33   Eucalyptus grandis [rose gum]
ref|XP_011002765.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    130   2e-33   Populus euphratica
gb|KJB69670.1|  hypothetical protein B456_011G036300                    131   2e-33   Gossypium raimondii
ref|XP_009622768.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        131   2e-33   Nicotiana tomentosiformis
ref|XP_004489001.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    131   3e-33   Cicer arietinum [garbanzo]
ref|XP_008386283.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        131   4e-33   
ref|XP_004244287.1|  PREDICTED: BES1/BZR1 homolog protein 4             130   4e-33   Solanum lycopersicum
ref|XP_011002762.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    130   6e-33   Populus euphratica
ref|XP_009768995.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        130   7e-33   Nicotiana sylvestris
ref|XP_009359371.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        130   1e-32   Pyrus x bretschneideri [bai li]
gb|KEH38594.1|  brassinazole-resistant 1 protein                        127   1e-32   Medicago truncatula
ref|XP_011082785.1|  PREDICTED: BES1/BZR1 homolog protein 4             128   5e-32   
ref|XP_003543195.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        127   8e-32   Glycine max [soybeans]
gb|EPS61611.1|  hypothetical protein M569_13185                         127   8e-32   Genlisea aurea
ref|XP_010088009.1|  hypothetical protein L484_004599                   128   9e-32   
ref|XP_003596275.1|  Brassinosteroid signaling positive regulator...    127   9e-32   Medicago truncatula
ref|XP_007149549.1|  hypothetical protein PHAVU_005G079400g             127   1e-31   Phaseolus vulgaris [French bean]
gb|KHN36918.1|  BES1/BZR1 like protein 4                                127   1e-31   Glycine soja [wild soybean]
ref|XP_004294130.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        126   3e-31   Fragaria vesca subsp. vesca
ref|XP_009334016.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        125   4e-31   Pyrus x bretschneideri [bai li]
ref|XP_008381083.1|  PREDICTED: BES1/BZR1 homolog protein 4             125   4e-31   
ref|XP_003540502.1|  PREDICTED: BES1/BZR1 homolog protein 4             124   9e-31   Glycine max [soybeans]
ref|XP_004489003.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    124   2e-30   
ref|XP_004489004.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    123   2e-30   Cicer arietinum [garbanzo]
ref|XP_010537716.1|  PREDICTED: BES1/BZR1 homolog protein 4             122   8e-30   Tarenaya hassleriana [spider flower]
ref|XP_006387974.1|  hypothetical protein POPTR_0439s00200g             120   8e-30   
ref|NP_193624.1|  BES1/BZR1-like protein 3                              120   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006370100.1|  hypothetical protein POPTR_0001s39520g             120   4e-29   Populus trichocarpa [western balsam poplar]
gb|KFK28557.1|  hypothetical protein AALP_AA7G011700                    119   6e-29   Arabis alpina [alpine rockcress]
ref|XP_006284265.1|  hypothetical protein CARUB_v10005431mg             119   8e-29   Capsella rubella
ref|XP_010434483.1|  PREDICTED: BES1/BZR1 homolog protein 3             118   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010062789.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        119   1e-28   Eucalyptus grandis [rose gum]
ref|XP_002887754.1|  hypothetical protein ARALYDRAFT_895772             118   2e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_010665681.1|  PREDICTED: BES1/BZR1 homolog protein 4             118   3e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009128310.1|  PREDICTED: BES1/BZR1 homolog protein 4             117   4e-28   Brassica rapa
ref|XP_002870016.1|  hypothetical protein ARALYDRAFT_492971             117   4e-28   
ref|XP_010429699.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        117   6e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006414043.1|  hypothetical protein EUTSA_v10025918mg             116   8e-28   Eutrema salsugineum [saltwater cress]
ref|NP_565187.1|  BES1/BZR1 homolog 4                                   116   9e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302567.1|  hypothetical protein CARUB_v10020674mg             116   9e-28   Capsella rubella
ref|XP_010417476.1|  PREDICTED: BES1/BZR1 homolog protein 4             116   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010472705.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        116   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010518826.1|  PREDICTED: BES1/BZR1 homolog protein 3 isofo...    114   4e-27   Tarenaya hassleriana [spider flower]
ref|XP_010518825.1|  PREDICTED: BES1/BZR1 homolog protein 3 isofo...    114   4e-27   Tarenaya hassleriana [spider flower]
gb|KFK42252.1|  hypothetical protein AALP_AA2G231000                    114   7e-27   Arabis alpina [alpine rockcress]
emb|CDX98592.1|  BnaA03g43770D                                          112   2e-26   
emb|CDY01563.1|  BnaC07g35530D                                          112   2e-26   
emb|CDX87440.1|  BnaA07g34330D                                          112   4e-26   
ref|XP_006389963.1|  hypothetical protein EUTSA_v10018888mg             112   5e-26   Eutrema salsugineum [saltwater cress]
emb|CDY26877.1|  BnaA02g19020D                                          111   5e-26   Brassica napus [oilseed rape]
ref|XP_009106588.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        111   6e-26   Brassica rapa
emb|CDY14593.1|  BnaC02g25200D                                          110   1e-25   Brassica napus [oilseed rape]
emb|CDY66394.1|  BnaC03g78350D                                          105   5e-25   Brassica napus [oilseed rape]
ref|XP_009132289.1|  PREDICTED: BES1/BZR1 homolog protein 3             108   6e-25   Brassica rapa
emb|CDX88466.1|  BnaC06g39100D                                          108   8e-25   
ref|XP_009136969.1|  PREDICTED: BES1/BZR1 homolog protein 3-like        107   8e-25   Brassica rapa
gb|EYU29527.1|  hypothetical protein MIMGU_mgv1a010055mg                108   9e-25   Erythranthe guttata [common monkey flower]
emb|CDX99414.1|  BnaC01g11380D                                          108   1e-24   
gb|KHN36917.1|  BES1/BZR1 like protein 4                                106   2e-24   Glycine soja [wild soybean]
emb|CDP06034.1|  unnamed protein product                                107   2e-24   Coffea canephora [robusta coffee]
ref|XP_006592940.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    106   3e-24   Glycine max [soybeans]
ref|XP_010916623.1|  PREDICTED: protein BZR1 homolog 3-like             107   4e-24   Elaeis guineensis
ref|XP_006594721.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    106   6e-24   Glycine max [soybeans]
ref|XP_003543196.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    106   6e-24   Glycine max [soybeans]
ref|XP_003540501.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    105   8e-24   Glycine max [soybeans]
ref|XP_006592939.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    105   8e-24   Glycine max [soybeans]
ref|XP_008796066.1|  PREDICTED: protein BZR1 homolog 3                  102   1e-22   Phoenix dactylifera
gb|ACE97214.1|  brassinosteroid signaling positive regulator-rela...  99.4    2e-22   Populus tremula [European aspen]
gb|ACE97192.1|  brassinosteroid signaling positive regulator-rela...  99.4    2e-22   Populus tremula [European aspen]
gb|ACE97191.1|  brassinosteroid signaling positive regulator-rela...  99.4    2e-22   Populus tremula [European aspen]
gb|ACE97196.1|  brassinosteroid signaling positive regulator-rela...  99.4    2e-22   Populus tremula [European aspen]
ref|XP_009415180.1|  PREDICTED: protein BZR1 homolog 3-like             102   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397454.1|  PREDICTED: protein BZR1 homolog 2-like           99.4    2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010924706.1|  PREDICTED: protein BZR1 homolog 3-like           98.6    3e-21   Elaeis guineensis
ref|XP_008792311.1|  PREDICTED: protein BZR1 homolog 3-like           98.6    3e-21   Phoenix dactylifera
ref|XP_009388695.1|  PREDICTED: protein BZR1 homolog 3-like           98.2    5e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008790049.1|  PREDICTED: protein BZR1 homolog 3-like           97.8    6e-21   Phoenix dactylifera
ref|XP_010675300.1|  PREDICTED: BES1/BZR1 homolog protein 4           97.4    6e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010915465.1|  PREDICTED: protein BZR1 homolog 3-like           97.4    8e-21   Elaeis guineensis
ref|XP_009381197.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      95.5    6e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC70129.1|  hypothetical protein OsI_00807                        92.8    4e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_006643883.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      91.7    5e-19   Oryza brachyantha
gb|EEE65864.1|  hypothetical protein OsJ_21656                        92.0    8e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80795.1|  hypothetical protein OsI_23332                        91.7    1e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001057840.1|  Os06g0552300                                     91.7    1e-18   
gb|EMS49339.1|  hypothetical protein TRIUR3_13720                     90.5    1e-18   Triticum urartu
ref|XP_002454981.1|  hypothetical protein SORBIDRAFT_03g002480        90.9    1e-18   Sorghum bicolor [broomcorn]
ref|XP_004968562.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      90.9    2e-18   Setaria italica
ref|XP_003563774.1|  PREDICTED: protein BZR1 homolog 3                90.5    2e-18   Brachypodium distachyon [annual false brome]
gb|EMT21245.1|  hypothetical protein F775_32777                       90.1    3e-18   
emb|CDM82126.1|  unnamed protein product                              89.7    4e-18   Triticum aestivum [Canadian hard winter wheat]
gb|EEE54074.1|  hypothetical protein OsJ_00786                        89.4    4e-18   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB33003.1|  unknown protein                                      89.4    5e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042330.1|  Os01g0203000                                     89.7    6e-18   
ref|XP_010925590.1|  PREDICTED: protein BZR1 homolog 3-like           89.0    8e-18   
ref|XP_009416433.1|  PREDICTED: protein BZR1 homolog 3                88.2    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001136786.1|  BES transcription factor                         87.4    3e-17   Zea mays [maize]
ref|XP_003565213.1|  PREDICTED: protein BZR1 homolog 2                87.4    3e-17   
ref|XP_004965584.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      87.4    3e-17   Setaria italica
ref|XP_002437132.1|  hypothetical protein SORBIDRAFT_10g021750        87.4    3e-17   Sorghum bicolor [broomcorn]
ref|NP_001132634.1|  uncharacterized protein LOC100194109             85.1    2e-16   Zea mays [maize]
gb|ACG41016.1|  brassinazole-resistant 1 protein                      84.7    2e-16   Zea mays [maize]
dbj|BAJ97997.1|  predicted protein                                    82.0    3e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003571150.2|  PREDICTED: protein BZR1 homolog 3-like           80.5    1e-14   Brachypodium distachyon [annual false brome]
emb|CBI30731.3|  unnamed protein product                              75.9    7e-14   Vitis vinifera
gb|EMT29878.1|  hypothetical protein F775_52316                       77.4    1e-13   
emb|CDY00299.1|  BnaA06g22000D                                        75.5    2e-13   
gb|EMS63049.1|  hypothetical protein TRIUR3_11319                     77.0    4e-13   Triticum urartu
sp|Q6EUF1.2|BZR4_ORYSJ  RecName: Full=Protein BZR1 homolog 4; Sho...  72.8    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001172869.1|  Os02g0233200                                     72.8    6e-12   
gb|EAY85121.1|  hypothetical protein OsI_06471                        72.8    6e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_006833072.1|  hypothetical protein AMTR_s00170p00061300        71.6    7e-12   Amborella trichopoda
gb|EAZ22344.1|  hypothetical protein OsJ_05997                        68.9    4e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABK21940.1|  unknown                                               67.0    6e-10   Picea sitchensis
gb|ABR18463.1|  unknown                                               56.6    2e-06   Picea sitchensis
ref|XP_002510347.1|  BRASSINAZOLE-RESISTANT 1 protein, putative       52.0    7e-05   Ricinus communis
ref|XP_011074507.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1 ...  51.6    8e-05   Sesamum indicum [beniseed]
ref|XP_011074506.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1 ...  51.6    8e-05   Sesamum indicum [beniseed]
gb|EYU45114.1|  hypothetical protein MIMGU_mgv1a009718mg              50.1    3e-04   Erythranthe guttata [common monkey flower]
ref|XP_011083731.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      49.7    4e-04   Sesamum indicum [beniseed]
gb|EPS60905.1|  hypothetical protein M569_13896                       48.5    9e-04   Genlisea aurea



>ref|XP_009590977.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana tomentosiformis]
Length=324

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  552  PNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            PNPFGFKEPLS GGSRMWTPGQSGTCSPA+ A +DR+AD+PMSDAI AEFAFGSN  G+V
Sbjct  238  PNPFGFKEPLSYGGSRMWTPGQSGTCSPAIGAGIDRTADIPMSDAISAEFAFGSNMKGLV  297

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC+TDDLELTLGNS+TR
Sbjct  298  KPWEGERIHEECVTDDLELTLGNSSTR  324



>ref|XP_004234074.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Solanum lycopersicum]
 ref|XP_004234075.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Solanum lycopersicum]
 ref|XP_006356092.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356093.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Solanum 
tuberosum]
Length=323

 Score =   162 bits (409),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  552  PNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            PNPFGFKEP+SNGGSRMWTPGQSG CSPA+A+ +D++ADVPMSDAI AEFAFGS+ MG+V
Sbjct  237  PNPFGFKEPISNGGSRMWTPGQSGACSPAIASGIDQTADVPMSDAISAEFAFGSHMMGLV  296

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC TDDLELTLGNS+TR
Sbjct  297  KPWEGERIHEECATDDLELTLGNSSTR  323



>gb|EYU28126.1| hypothetical protein MIMGU_mgv1a007967mg [Erythranthe guttata]
Length=328

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFGFKEPLSNGGSRMWTPGQSGTCSPA+ A +D++AD+PMSDA+ AEFAFGSN MG+VK
Sbjct  243  NPFGFKEPLSNGGSRMWTPGQSGTCSPAITAGVDQTADIPMSDAMSAEFAFGSNIMGLVK  302

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERIHEEC  DDLELTLGNSNTR
Sbjct  303  PWEGERIHEECAPDDLELTLGNSNTR  328



>ref|XP_010316856.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Solanum lycopersicum]
Length=325

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFGFKEPLSNGGSRMWTPGQSGTCSPAV   +D++ADVPMSDAI AEFAFGSN  G+VK
Sbjct  240  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVGPCMDQTADVPMSDAISAEFAFGSNMKGVVK  299

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERIHEECI+DDLELTLGNS+TR
Sbjct  300  PWEGERIHEECISDDLELTLGNSSTR  325



>ref|XP_009785426.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana sylvestris]
Length=323

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  552  PNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            PNPFGF+EPLSNGGSRMWTPGQSG CSPA+ A +D++ADVPMSDAI AEFAFGSN  G+V
Sbjct  237  PNPFGFREPLSNGGSRMWTPGQSGVCSPAIGAGIDQTADVPMSDAISAEFAFGSNMKGLV  296

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC+TDDLELTLGNS+T+
Sbjct  297  KPWEGERIHEECLTDDLELTLGNSSTK  323



>ref|XP_004233053.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X3 [Solanum lycopersicum]
 ref|XP_010316857.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Solanum lycopersicum]
Length=324

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFGFKEPLSNGGSRMWTPGQSGTCSPAV   +D++ADVPMSDAI AEFAFGSN  G+VK
Sbjct  239  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVGPCMDQTADVPMSDAISAEFAFGSNMKGVVK  298

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERIHEECI+DDLELTLGNS+TR
Sbjct  299  PWEGERIHEECISDDLELTLGNSSTR  324



>ref|XP_009607196.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009607197.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=326

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFGFKEPLSNGGSRMWTPGQSGTCSPAV A +D++AD+PMSD I AEFAFGSN  G+VK
Sbjct  241  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVGAGMDQTADIPMSDVISAEFAFGSNVKGVVK  300

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERIHEEC++DDLELTLGNS+TR
Sbjct  301  PWEGERIHEECVSDDLELTLGNSSTR  326



>ref|XP_009800423.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009800424.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Nicotiana 
sylvestris]
Length=326

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFGFKEPLSNGGSRMWTPGQSGTCSPAV A +D++AD+PMSD I AEFAFGSN  G+VK
Sbjct  241  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVGAGMDQTADIPMSDVISAEFAFGSNVKGVVK  300

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERIHEEC++DDLELTLGNS+TR
Sbjct  301  PWEGERIHEECVSDDLELTLGNSSTR  326



>gb|EYU28125.1| hypothetical protein MIMGU_mgv1a007967mg [Erythranthe guttata]
Length=389

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFGFKEPLSNGGSRMWTPGQSGTCSPA+ A +D++AD+PMSDA+ AEFAFGSN MG+VK
Sbjct  295  NPFGFKEPLSNGGSRMWTPGQSGTCSPAITAGVDQTADIPMSDAMSAEFAFGSNIMGLVK  354

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERIHEEC  DDLELTLGNSNTR
Sbjct  355  PWEGERIHEECAPDDLELTLGNSNTR  380



>ref|XP_006358089.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006358090.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X4 [Solanum 
tuberosum]
Length=325

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFGFKEPLSNGGSRMWTPGQSGTCSPAV   +D++ DVPMSD I AEFAFGSN  G+VK
Sbjct  240  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVGPCMDQTGDVPMSDVISAEFAFGSNMKGVVK  299

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERIHEECI+DDLELTLGNS+TR
Sbjct  300  PWEGERIHEECISDDLELTLGNSSTR  325



>ref|XP_006358087.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006358088.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Solanum 
tuberosum]
Length=326

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFGFKEPLSNGGSRMWTPGQSGTCSPAV   +D++ DVPMSD I AEFAFGSN  G+VK
Sbjct  241  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVGPCMDQTGDVPMSDVISAEFAFGSNMKGVVK  300

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERIHEECI+DDLELTLGNS+TR
Sbjct  301  PWEGERIHEECISDDLELTLGNSSTR  326



>ref|XP_011101448.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Sesamum indicum]
Length=325

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFGFKEP+SNGGSRMWTPGQSGTCSPA+A   D++ADVPMSDAI +EFAFGSN  G+VK
Sbjct  240  NPFGFKEPISNGGSRMWTPGQSGTCSPAIAPGFDQTADVPMSDAISSEFAFGSNTKGLVK  299

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERIH+EC+ DDLELTLG  +TR
Sbjct  300  PWEGERIHDECVPDDLELTLGIPSTR  325



>emb|CDO96875.1| unnamed protein product [Coffea canephora]
Length=295

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFG KEPLSNGGSRMWTPGQSG CSPA+AA  D++ADVPM+DA+ AEFAFG++  G+VK
Sbjct  210  NPFGIKEPLSNGGSRMWTPGQSGACSPAIAAGFDQTADVPMADAVSAEFAFGNSTKGLVK  269

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERIHEE ++DDLELTLGNS TR
Sbjct  270  PWEGERIHEEFVSDDLELTLGNSKTR  295



>ref|XP_011033513.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011033514.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Populus 
euphratica]
 ref|XP_011010915.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011010916.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Populus 
euphratica]
Length=331

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGF+E  LS  GSRMWTPGQSGTCSPA+ A +D++ADVPMSD++ AEFAFGSNA G+V
Sbjct  245  NPFGFREEALSGAGSRMWTPGQSGTCSPAIPAGIDQTADVPMSDSMAAEFAFGSNAAGLV  304

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC++DDLELTLGNSNTR
Sbjct  305  KPWEGERIHEECVSDDLELTLGNSNTR  331



>ref|XP_002305719.1| hypothetical protein POPTR_0004s06100g [Populus trichocarpa]
 gb|EEE86230.1| hypothetical protein POPTR_0004s06100g [Populus trichocarpa]
Length=331

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGF+E  LS  GSRMWTPGQSGTCSPA+ A +D++ADVPMSD++ AEFAFGSNA G+V
Sbjct  245  NPFGFREEALSGAGSRMWTPGQSGTCSPAIPAGIDQTADVPMSDSMAAEFAFGSNAAGLV  304

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC++DDLELTLGNSNTR
Sbjct  305  KPWEGERIHEECVSDDLELTLGNSNTR  331



>ref|XP_006377531.1| hypothetical protein POPTR_0011s06800g [Populus trichocarpa]
 gb|ERP55328.1| hypothetical protein POPTR_0011s06800g [Populus trichocarpa]
Length=254

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  LS  GSRMWTPGQSGTCSPAV A +D++ADVPM+D++ AEFAFGSN  G+V
Sbjct  168  NPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGIDQTADVPMADSMAAEFAFGSNTAGLV  227

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC++DDLELTLGNS+TR
Sbjct  228  KPWEGERIHEECVSDDLELTLGNSSTR  254



>ref|XP_002522271.1| BRASSINAZOLE-RESISTANT 2 protein, putative [Ricinus communis]
 gb|EEF40129.1| BRASSINAZOLE-RESISTANT 2 protein, putative [Ricinus communis]
Length=331

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGF+ EPLS  GSRMWTPGQSGTCSPAV A +D +ADVPM+D++ AEFAFGSN  G+V
Sbjct  245  NPFGFRDEPLSGAGSRMWTPGQSGTCSPAVPAGVDHTADVPMADSMAAEFAFGSNTTGLV  304

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC++DDLELTLGNS+TR
Sbjct  305  KPWEGERIHEECVSDDLELTLGNSSTR  331



>ref|XP_007025289.1| BES1/BZR1 [Theobroma cacao]
 gb|EOY27911.1| BES1/BZR1 [Theobroma cacao]
Length=327

 Score =   146 bits (368),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK E LS GGSRMWTPGQSGTCSPA  A +D+++DVPMSDAI AEFAFGSN  G+V
Sbjct  241  NPFGFKDETLSGGGSRMWTPGQSGTCSPAFPAGVDQTSDVPMSDAIAAEFAFGSNVTGLV  300

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGE+IHEEC+ DDLELTLGNS TR
Sbjct  301  KPWEGEKIHEECVADDLELTLGNSKTR  327



>gb|KDP21147.1| hypothetical protein JCGZ_21618 [Jatropha curcas]
Length=331

 Score =   146 bits (368),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGF+ EPLS  GSRMWTPGQSGTCSPAV A +D++ADVPM+D+I +EFAFGSN  G+V
Sbjct  245  NPFGFRDEPLSGAGSRMWTPGQSGTCSPAVPAGVDQTADVPMADSIASEFAFGSNTGGLV  304

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC++DDLELTLGNS TR
Sbjct  305  KPWEGERIHEECVSDDLELTLGNSRTR  331



>gb|KHG25078.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=319

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK E LS GGSRMWTPGQSGTCSPA  A +D+++DVPMSDAI AEFAFGSN  G+V
Sbjct  233  NPFGFKDEALSRGGSRMWTPGQSGTCSPAFPAGVDQTSDVPMSDAIAAEFAFGSNMTGLV  292

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGE+IHEEC+ DDLELTLGNS TR
Sbjct  293  KPWEGEKIHEECVADDLELTLGNSKTR  319



>ref|XP_011039378.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Populus euphratica]
Length=333

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 78/87 (90%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  LS  GSRMWTPGQSGTCSPAV A +D++ADVPMSD++ AEFAFGSNA G+V
Sbjct  247  NPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGIDQTADVPMSDSMAAEFAFGSNAAGLV  306

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC++DDLELTLGN +TR
Sbjct  307  KPWEGERIHEECVSDDLELTLGNPSTR  333



>gb|KJB69668.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
 gb|KJB69671.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
Length=319

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK E LS GGSRMWTPGQSGTCSPA  A +D+++DVPMSDAI AEFAFGSN  G+V
Sbjct  233  NPFGFKDEALSGGGSRMWTPGQSGTCSPAFPAGVDQTSDVPMSDAIAAEFAFGSNMTGLV  292

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGE+IHEEC+ +DLELTLGNS TR
Sbjct  293  KPWEGEKIHEECVANDLELTLGNSKTR  319



>gb|KJB13026.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13027.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13028.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13029.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
Length=325

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA LD++ADVPMS+ I  EFAFGSNA G+V
Sbjct  239  NPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGLDQTADVPMSEVISDEFAFGSNATGLV  298

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC +DDLELTLG+S TR
Sbjct  299  KPWEGERIHEECGSDDLELTLGSSKTR  325



>gb|KHG15415.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=325

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA LD++ADVPMS+ I  EFAFGSNA G+V
Sbjct  239  NPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGLDQTADVPMSEVISDEFAFGSNATGLV  298

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC +DDLELTLG+S TR
Sbjct  299  KPWEGERIHEECGSDDLELTLGSSKTR  325



>gb|KDO77946.1| hypothetical protein CISIN_1g020318mg [Citrus sinensis]
Length=248

 Score =   141 bits (356),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGF+E  LS G SRMWTPGQSGTCSPAV A +D ++DVPMSD I  EFAFG NA G+V
Sbjct  162  NPFGFREEVLSGGPSRMWTPGQSGTCSPAVPAGVDNTSDVPMSDCIATEFAFGCNATGLV  221

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC++DDLELTLGNS TR
Sbjct  222  KPWEGERIHEECVSDDLELTLGNSKTR  248



>ref|XP_006449559.1| hypothetical protein CICLE_v10015910mg [Citrus clementina]
 ref|XP_006467592.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006467593.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Citrus 
sinensis]
 gb|ESR62799.1| hypothetical protein CICLE_v10015910mg [Citrus clementina]
 gb|KDO77944.1| hypothetical protein CISIN_1g020318mg [Citrus sinensis]
 gb|KDO77945.1| hypothetical protein CISIN_1g020318mg [Citrus sinensis]
Length=327

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGF+E  LS G SRMWTPGQSGTCSPAV A +D ++DVPMSD I  EFAFG NA G+V
Sbjct  241  NPFGFREEVLSGGPSRMWTPGQSGTCSPAVPAGVDNTSDVPMSDCIATEFAFGCNATGLV  300

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC++DDLELTLGNS TR
Sbjct  301  KPWEGERIHEECVSDDLELTLGNSKTR  327



>ref|XP_010242162.1| PREDICTED: BES1/BZR1 homolog protein 4 [Nelumbo nucifera]
Length=327

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  L+ GGSRMWTPGQSGTCSPAVA   D++ADVPMSD I  EFAFGSNA G+V
Sbjct  241  NPFGFKEEVLAGGGSRMWTPGQSGTCSPAVAGGSDQTADVPMSDRISDEFAFGSNATGLV  300

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC +DDLELTLG S TR
Sbjct  301  KPWEGERIHEECGSDDLELTLGTSRTR  327



>ref|XP_007021866.1| BES1/BZR1 [Theobroma cacao]
 gb|EOY13391.1| BES1/BZR1 [Theobroma cacao]
Length=325

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  D +ADVPMS+ I  EFAFGSNA G+V
Sbjct  239  NPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGSDHTADVPMSEVISDEFAFGSNATGLV  298

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC +DDLELTLG+S TR
Sbjct  299  KPWEGERIHEECGSDDLELTLGSSRTR  325



>ref|XP_004309625.1| PREDICTED: BES1/BZR1 homolog protein 4 [Fragaria vesca subsp. 
vesca]
Length=329

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFGFKE LS GGSRMWTPGQSGTCSP VAA LD + DV MSD + AEFAFGSNA G+VK
Sbjct  245  NPFGFKEALSGGGSRMWTPGQSGTCSPVVAAGLDHTGDVAMSDGMAAEFAFGSNATGLVK  304

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERI EEC++DDLELTLG++ TR
Sbjct  305  PWEGERI-EECVSDDLELTLGSTKTR  329



>ref|XP_002267082.1| PREDICTED: BES1/BZR1 homolog protein 4 [Vitis vinifera]
Length=341

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  L+ GGSRMWTPGQSGTCSPAVAA  D +ADVPM+D I AEFAFGSN  G+V
Sbjct  255  NPFGFKEEVLAGGGSRMWTPGQSGTCSPAVAAGSDHTADVPMADGIAAEFAFGSNTTGLV  314

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC +D+LELTLG+S TR
Sbjct  315  KPWEGERIHEECGSDELELTLGSSRTR  341



>gb|KJB45771.1| hypothetical protein B456_007G327000 [Gossypium raimondii]
Length=317

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  D +ADVPMS+ I  EFAFGSNA G+V
Sbjct  231  NPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGSDHTADVPMSEVISDEFAFGSNATGLV  290

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHE+C +DDLELTLG+S TR
Sbjct  291  KPWEGERIHEDCGSDDLELTLGSSRTR  317



>ref|XP_004137229.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 ref|XP_004156512.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 gb|KGN53574.1| hypothetical protein Csa_4G083490 [Cucumis sativus]
Length=325

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  ++ GGSRMWTPGQSGTCSPA+AA  D +AD+PMS+ I  EFAFGSNA GIV
Sbjct  239  NPFGFKEAAITGGGSRMWTPGQSGTCSPAIAAGSDHTADIPMSEVISDEFAFGSNAAGIV  298

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGE IHEEC +DDLELTLGNS TR
Sbjct  299  KPWEGEIIHEECGSDDLELTLGNSRTR  325



>gb|KHG20428.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=322

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 75/88 (85%), Gaps = 2/88 (2%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK E LS GGSRMWTPGQSGTCSPA  A +D+++DVPMSD I AEFAFGSN  G+V
Sbjct  235  NPFGFKDEALSAGGSRMWTPGQSGTCSPAFPAGVDQTSDVPMSDVIAAEFAFGSNFTGLV  294

Query  372  KPWEGERIHEECIT-DDLELTLGNSNTR  292
            KPWEGE+IHEEC+  DDLELTLGNS TR
Sbjct  295  KPWEGEKIHEECVADDDLELTLGNSKTR  322



>ref|XP_006442379.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
 gb|ESR55619.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
Length=278

 Score =   137 bits (344),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  D +ADVPMS+ +  EFAFGSNA G+V
Sbjct  192  NPFGFKDETLAGGGSRMWTPGQSGTCSPAIAAGSDHTADVPMSEVVTDEFAFGSNATGLV  251

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            K WEGERIHEEC +DDLELTLG+S TR
Sbjct  252  KAWEGERIHEECGSDDLELTLGSSRTR  278



>ref|XP_008371512.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
 ref|XP_009351745.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=331

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPF  KE LS GGSRMWTPGQSGTCSPAVAA++D + DVPMSD + AEFAFGSN  G+VK
Sbjct  247  NPFNLKEALSGGGSRMWTPGQSGTCSPAVAASIDHTGDVPMSDGMAAEFAFGSNTTGLVK  306

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERI EEC++DDLELTLG++ TR
Sbjct  307  PWEGERI-EECVSDDLELTLGSTRTR  331



>ref|XP_008451746.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
 ref|XP_008451748.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
Length=325

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  ++ GGSRMWTPGQSGTCSPA+AA  D +AD+PMS+ I  EFAFGSNA G+V
Sbjct  239  NPFGFKEAAITGGGSRMWTPGQSGTCSPAIAAGSDHTADIPMSEVISDEFAFGSNAAGLV  298

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGE IHEEC +DDLELTLGNS TR
Sbjct  299  KPWEGEIIHEECGSDDLELTLGNSRTR  325



>gb|KJB68361.1| hypothetical protein B456_010G240700 [Gossypium raimondii]
Length=322

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 74/88 (84%), Gaps = 2/88 (2%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK E LS GGSRMWTPGQSGTCSPA  A +D+++DVPMSD I AEFAFGSN  G+V
Sbjct  235  NPFGFKDEALSAGGSRMWTPGQSGTCSPAFPAGVDQTSDVPMSDVIAAEFAFGSNFTGLV  294

Query  372  KPWEGERIHEECIT-DDLELTLGNSNTR  292
            KPWEGE IHEEC+  DDLELTLGNS TR
Sbjct  295  KPWEGEMIHEECVADDDLELTLGNSKTR  322



>ref|XP_006442380.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
 gb|ESR55620.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
Length=324

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  D +ADVPMS+ +  EFAFGSNA G+V
Sbjct  238  NPFGFKDETLAGGGSRMWTPGQSGTCSPAIAAGSDHTADVPMSEVVTDEFAFGSNATGLV  297

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            K WEGERIHEEC +DDLELTLG+S TR
Sbjct  298  KAWEGERIHEECGSDDLELTLGSSRTR  324



>ref|XP_007211637.1| hypothetical protein PRUPE_ppa008675mg [Prunus persica]
 ref|XP_008225238.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Prunus mume]
 ref|XP_008225239.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Prunus mume]
 gb|EMJ12836.1| hypothetical protein PRUPE_ppa008675mg [Prunus persica]
Length=323

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPF  KE LS GGSRMWTPGQSGTCSP VAA++D S DVPMSD + AEFAFGSN  G+VK
Sbjct  239  NPFNLKEALSGGGSRMWTPGQSGTCSPVVAASVDHSGDVPMSDGMAAEFAFGSNTSGLVK  298

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERI EEC++DDLELTLG++ TR
Sbjct  299  PWEGERI-EECVSDDLELTLGSARTR  323



>ref|XP_006477843.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006477844.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Citrus 
sinensis]
 gb|KDO43794.1| hypothetical protein CISIN_1g020567mg [Citrus sinensis]
Length=324

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  D +ADVPMS+ +  EFAFGSNA G+V
Sbjct  238  NPFGFKDETLAGGGSRMWTPGQSGTCSPAIAAGSDHTADVPMSEVVTDEFAFGSNATGLV  297

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            K WEGERIHEEC +DDLELTLG+S TR
Sbjct  298  KAWEGERIHEECGSDDLELTLGSSRTR  324



>ref|XP_002317445.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
 gb|EEE98057.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
Length=319

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  D++AD+PM++ I  EFAF  NA G+V
Sbjct  233  NPFGFKEEALAGGGSRMWTPGQSGTCSPAIAAGSDQTADIPMAEVISDEFAFRCNATGLV  292

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC +DDLELTLGNS TR
Sbjct  293  KPWEGERIHEECGSDDLELTLGNSRTR  319



>ref|XP_007211588.1| hypothetical protein PRUPE_ppa008637mg [Prunus persica]
 gb|EMJ12787.1| hypothetical protein PRUPE_ppa008637mg [Prunus persica]
Length=324

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  D +AD+PMS+ I  EFAFG N  G+V
Sbjct  238  NPFGFKDEALAGGGSRMWTPGQSGTCSPAIAAGSDHTADIPMSEVISDEFAFGCNTAGLV  297

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC +DDLELTLG+S TR
Sbjct  298  KPWEGERIHEECGSDDLELTLGSSRTR  324



>ref|XP_003596274.1| Brassinosteroid signaling positive regulator-related protein 
[Medicago truncatula]
Length=447

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            +PF FKE   S GGSRMWTPGQSG CSPA+AA  D++AD+PMS+AI  EFAFGSN  GIV
Sbjct  230  SPFAFKEDGFSGGGSRMWTPGQSGACSPAIAAGFDQTADIPMSEAISDEFAFGSNTFGIV  289

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEE + DDLELTLGNS TR
Sbjct  290  KPWEGERIHEEFVADDLELTLGNSKTR  316



>ref|XP_008226380.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Prunus mume]
Length=324

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  D +AD+PMS+ I  EFAFG N  G+V
Sbjct  238  NPFGFKDEALAGGGSRMWTPGQSGTCSPAIAAGSDHTADIPMSEVISDEFAFGCNTAGLV  297

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC +DDLELTLG+S TR
Sbjct  298  KPWEGERIHEECGSDDLELTLGSSRTR  324



>gb|AES66525.2| brassinazole-resistant 1 protein [Medicago truncatula]
Length=517

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            +PF FKE   S GGSRMWTPGQSG CSPA+AA  D++AD+PMS+AI  EFAFGSN  GIV
Sbjct  230  SPFAFKEDGFSGGGSRMWTPGQSGACSPAIAAGFDQTADIPMSEAISDEFAFGSNTFGIV  289

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEE + DDLELTLGNS TR
Sbjct  290  KPWEGERIHEEFVADDLELTLGNSKTR  316



>gb|KHG21553.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=317

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  D +ADVPMS+ I  EFAFGSNA G++
Sbjct  231  NPFGFKEEVLAGGGSRMWTPGQSGTCSPAIAAGSDHTADVPMSEVISDEFAFGSNATGLM  290

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHE+C +DDLELTLG+S  R
Sbjct  291  KPWEGERIHEDCGSDDLELTLGSSRIR  317



>ref|XP_008443587.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
Length=327

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFGFKE +S G SR WTP QSGTCSP VAA +D ++DVPM+D    +FAFGS ++G+VK
Sbjct  242  NPFGFKEAMSAGVSRNWTPTQSGTCSPTVAAGIDHTSDVPMTDGTATDFAFGSCSIGLVK  301

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERIHEECI+DDLELTLGNS+TR
Sbjct  302  PWEGERIHEECISDDLELTLGNSSTR  327



>ref|XP_004147390.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 ref|XP_004172293.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 gb|KGN65601.1| hypothetical protein Csa_1G467200 [Cucumis sativus]
Length=327

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFGFKE +S G SR WTP QSGTCSP VAA +D ++DVPM+D    +FAFGS ++G+VK
Sbjct  242  NPFGFKEAMSAGVSRNWTPTQSGTCSPTVAAGIDHTSDVPMTDGTATDFAFGSCSIGLVK  301

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERIHEECI+DDLELTLGNS+TR
Sbjct  302  PWEGERIHEECISDDLELTLGNSSTR  327



>ref|XP_006348323.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Solanum tuberosum]
Length=315

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 2/89 (2%)
 Frame = -1

Query  552  PNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDA-IQAEFAFGSNAMG  379
            PNPFGFK + LS GGSRM TPGQSGTCSPA+AA LDR+ADVPM++  I  EFAFGSN  G
Sbjct  227  PNPFGFKMDSLSRGGSRMCTPGQSGTCSPAIAAGLDRNADVPMAEVMISDEFAFGSNIAG  286

Query  378  IVKPWEGERIHEECITDDLELTLGNSNTR  292
            +VKPWEGERIHE+C+ DDLELTLG+S TR
Sbjct  287  MVKPWEGERIHEDCVPDDLELTLGSSKTR  315



>ref|XP_008383594.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
Length=331

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPF  KE LS  GSRMWTPGQSGTCSPAVAA++D + D+PMSD + AEFAFGSN  G+VK
Sbjct  247  NPFNLKEALSGAGSRMWTPGQSGTCSPAVAASIDHTGDIPMSDGMAAEFAFGSNTTGLVK  306

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERI EEC++DDLELTLG++ TR
Sbjct  307  PWEGERI-EECVSDDLELTLGSTRTR  331



>ref|XP_010644097.1| PREDICTED: BES1/BZR1 homolog protein 4 [Vitis vinifera]
Length=326

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 73/88 (83%), Gaps = 2/88 (2%)
 Frame = -1

Query  549  NPFGFKEPL--SNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            NPFGFKE +  S  GSRMWTPGQSGTCSPA+AA  D +ADVPMS+ I  EFAFG N +G+
Sbjct  239  NPFGFKEEMLASASGSRMWTPGQSGTCSPAIAAGSDHTADVPMSEVISDEFAFGCNTVGL  298

Query  375  VKPWEGERIHEECITDDLELTLGNSNTR  292
            VKPWEGERIHEEC +DDLELTLG+S TR
Sbjct  299  VKPWEGERIHEECGSDDLELTLGSSRTR  326



>ref|XP_010093488.1| hypothetical protein L484_017551 [Morus notabilis]
 gb|EXB54112.1| hypothetical protein L484_017551 [Morus notabilis]
Length=391

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK E ++ GGSRMWTPGQSGTCSPA+AA  D +AD+PM++ I  EFAFGS+A G+V
Sbjct  305  NPFGFKDEVMAGGGSRMWTPGQSGTCSPAIAAGSDHTADIPMAEVISDEFAFGSHATGLV  364

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC +DDLELTLG+S TR
Sbjct  365  KPWEGERIHEECGSDDLELTLGSSRTR  391



>ref|XP_009352718.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=331

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPF  KE LS  GSRMWTPGQSGTCSP VAA++D + D+PMSD + AEFAFGSN  G+VK
Sbjct  247  NPFNLKEALSGAGSRMWTPGQSGTCSPVVAASIDHTGDIPMSDGMAAEFAFGSNTTGLVK  306

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PWEGERI EEC++DDLELTLG++ TR
Sbjct  307  PWEGERI-EECVSDDLELTLGSTRTR  331



>ref|XP_011044050.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Populus euphratica]
Length=319

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = -1

Query  552  PNPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            PN FGFKE   + GGSRMWTPGQSGTCSPA+AA  D +AD+PM++ I  EFAF  NA G+
Sbjct  232  PNSFGFKEEAFAGGGSRMWTPGQSGTCSPAIAAGSDHTADIPMAEVISDEFAFRCNATGL  291

Query  375  VKPWEGERIHEECITDDLELTLGNSNTR  292
            VKPWEGERIHEEC +DDLELTLGNS TR
Sbjct  292  VKPWEGERIHEECGSDDLELTLGNSRTR  319



>ref|XP_010052157.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010052158.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Eucalyptus 
grandis]
 gb|KCW76060.1| hypothetical protein EUGRSUZ_D00428 [Eucalyptus grandis]
Length=320

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 2/87 (2%)
 Frame = -1

Query  549  NPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE   S GGSRMWTPGQSGTCSPA+AA  D ++D+PMSD++  EFAFGSNA G+V
Sbjct  235  NPFGFKEEAFSGGGSRMWTPGQSGTCSPAIAAGADLTSDIPMSDSMATEFAFGSNATGLV  294

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHE+  +DDLELTLGN+ TR
Sbjct  295  KPWEGERIHEDA-SDDLELTLGNARTR  320



>ref|XP_011002765.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X3 [Populus euphratica]
Length=272

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 73/91 (80%), Gaps = 6/91 (7%)
 Frame = -1

Query  549  NPFGFKEPL-----SNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA  385
            NPFGFKE       SNGGSRMWTPGQSGTCSPA+AA  D +AD+PM++ I  EFAF  NA
Sbjct  183  NPFGFKEEALAGGGSNGGSRMWTPGQSGTCSPAIAAGSDHTADIPMAE-ISDEFAFRCNA  241

Query  384  MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             G+VKPWEGERIHEEC +DDLELTLGNS TR
Sbjct  242  TGLVKPWEGERIHEECGSDDLELTLGNSRTR  272



>gb|KJB69670.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
Length=285

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  552  PNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            P+P     P   GGSRMWTPGQSGTCSPA  A +D+++DVPMSDAI AEFAFGSN  G+V
Sbjct  199  PSPSRQVFPDPGGGSRMWTPGQSGTCSPAFPAGVDQTSDVPMSDAIAAEFAFGSNMTGLV  258

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGE+IHEEC+ +DLELTLGNS TR
Sbjct  259  KPWEGEKIHEECVANDLELTLGNSKTR  285



>ref|XP_009622768.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana tomentosiformis]
Length=316

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 3/89 (3%)
 Frame = -1

Query  549  NPFGFKEP---LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMG  379
            NPFGFK     LS+GGSRM TPGQSGTCSPA+AA LD +AD+PM++ I  EFAFGSNA G
Sbjct  228  NPFGFKMDGLVLSHGGSRMCTPGQSGTCSPAIAAGLDNTADIPMAEVISDEFAFGSNAGG  287

Query  378  IVKPWEGERIHEECITDDLELTLGNSNTR  292
            +VKPWEGERIHE+C  DDLELTLG+S TR
Sbjct  288  MVKPWEGERIHEDCGPDDLELTLGSSKTR  316



>ref|XP_004489001.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Cicer 
arietinum]
 ref|XP_004489002.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Cicer 
arietinum]
Length=321

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = -1

Query  552  PNPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDA-IQAEFAFGSNAMG  379
            PNPF FKE   S  GSRMWTPG SGTCSPA+AA  D +AD+PMS+A I  EFAFGSN  G
Sbjct  233  PNPFAFKEDGFSGSGSRMWTPGPSGTCSPAIAAGSDHNADIPMSEAAISDEFAFGSNTFG  292

Query  378  IVKPWEGERIHEECITDDLELTLGNSNTR  292
            IVKPWEGERIHEE + DDLELTLGNS TR
Sbjct  293  IVKPWEGERIHEEFVADDLELTLGNSKTR  321



>ref|XP_008386283.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
Length=324

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK E L+ GGSRMWTPGQSGTCSPA+AA  D +AD+PMS+ I  EFAFG N  G+V
Sbjct  238  NPFGFKDEVLAGGGSRMWTPGQSGTCSPAIAAGSDHTADIPMSEVISDEFAFGCNTTGLV  297

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            K WEGE+IHEEC +DDLELTLG+S TR
Sbjct  298  KAWEGEKIHEECGSDDLELTLGSSRTR  324



>ref|XP_004244287.1| PREDICTED: BES1/BZR1 homolog protein 4 [Solanum lycopersicum]
Length=315

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 2/89 (2%)
 Frame = -1

Query  552  PNPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDA-IQAEFAFGSNAMG  379
            PNPFGFK + LS GGSRM TPGQSG CSPA+AA LD +ADVPM++  I  EFAFGSN  G
Sbjct  227  PNPFGFKMDGLSRGGSRMCTPGQSGACSPAIAAGLDHNADVPMAEVMISDEFAFGSNVAG  286

Query  378  IVKPWEGERIHEECITDDLELTLGNSNTR  292
            +VKPWEGERIHE+C+ DDLELTLG+S TR
Sbjct  287  MVKPWEGERIHEDCVPDDLELTLGSSKTR  315



>ref|XP_011002762.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Populus euphratica]
 ref|XP_011002763.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Populus euphratica]
Length=328

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 73/91 (80%), Gaps = 6/91 (7%)
 Frame = -1

Query  549  NPFGFKEPL-----SNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA  385
            NPFGFKE       SNGGSRMWTPGQSGTCSPA+AA  D +AD+PM++ I  EFAF  NA
Sbjct  239  NPFGFKEEALAGGGSNGGSRMWTPGQSGTCSPAIAAGSDHTADIPMAE-ISDEFAFRCNA  297

Query  384  MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             G+VKPWEGERIHEEC +DDLELTLGNS TR
Sbjct  298  TGLVKPWEGERIHEECGSDDLELTLGNSRTR  328



>ref|XP_009768995.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana sylvestris]
Length=316

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 3/89 (3%)
 Frame = -1

Query  549  NPFGFKE---PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMG  379
            NPFGFK     LS+GGSRM TPGQSGTCSPA+ A LD +AD+PM++ I  EFAFGSNA G
Sbjct  228  NPFGFKMDGLALSHGGSRMCTPGQSGTCSPAITAGLDNTADIPMAEVISDEFAFGSNAGG  287

Query  378  IVKPWEGERIHEECITDDLELTLGNSNTR  292
            +VKPWEGERIHE+C  DDLELTLG+S TR
Sbjct  288  MVKPWEGERIHEDCGPDDLELTLGSSKTR  316



>ref|XP_009359371.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=324

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK E L+  GSRMWTPGQSGTCSPA+AA  D +AD+PMS+ I  EFAFG N  G+V
Sbjct  238  NPFGFKDEVLAGAGSRMWTPGQSGTCSPAIAAGSDHTADIPMSEVISDEFAFGCNTTGLV  297

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            K WEGE+IHEEC +DDLELTLG+S TR
Sbjct  298  KAWEGEKIHEECGSDDLELTLGSSRTR  324



>gb|KEH38594.1| brassinazole-resistant 1 protein [Medicago truncatula]
Length=236

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEPLSNGG-SRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGF+E +  G  SRMWTPGQSGTCSPA+AA  D +AD+PMS+AI  EFAFGS+A+G+V
Sbjct  150  NPFGFREEVFCGSDSRMWTPGQSGTCSPALAAGSDHNADIPMSEAISDEFAFGSSAVGLV  209

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHE+  +DDLELTLG S TR
Sbjct  210  KPWEGERIHEDSGSDDLELTLGTSKTR  236



>ref|XP_011082785.1| PREDICTED: BES1/BZR1 homolog protein 4 [Sesamum indicum]
 ref|XP_011082786.1| PREDICTED: BES1/BZR1 homolog protein 4 [Sesamum indicum]
Length=325

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGF+ E LS GGS M TPGQSGTCSPAVAAA +++AD+PM++ I  +FAFGSN  G+V
Sbjct  239  NPFGFRVEDLSRGGSLMCTPGQSGTCSPAVAAASEQNADIPMAEVISNDFAFGSNIAGLV  298

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEEC +DDLELTLG+S TR
Sbjct  299  KPWEGERIHEECGSDDLELTLGSSKTR  325



>ref|XP_003543195.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Glycine max]
Length=325

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPF FKE  L   GSRMWTP QSGTCSPA+    D++AD+PMS+A+  EFAFGSN +G+V
Sbjct  239  NPFAFKEDGLPGSGSRMWTPAQSGTCSPAIPPGSDQNADIPMSEAVSDEFAFGSNTLGLV  298

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEE  +DDLELTLGNS TR
Sbjct  299  KPWEGERIHEEFGSDDLELTLGNSKTR  325



>gb|EPS61611.1| hypothetical protein M569_13185 [Genlisea aurea]
Length=307

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -1

Query  537  FKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEG  358
             KEPLSNGGSRMWTPGQSGTCSPAVA   D++ADVPM+D +  EFAFG+NA  +VKPWEG
Sbjct  224  IKEPLSNGGSRMWTPGQSGTCSPAVAPGSDQTADVPMADVMSTEFAFGNNAKRLVKPWEG  283

Query  357  ERIHEECIT-DDLELTLGNSNT  295
            E IH+ECI  DDLEL LGNS+T
Sbjct  284  EIIHDECIIPDDLELKLGNSST  305



>ref|XP_010088009.1| hypothetical protein L484_004599 [Morus notabilis]
 gb|EXB31125.1| hypothetical protein L484_004599 [Morus notabilis]
Length=368

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 75/91 (82%), Gaps = 6/91 (7%)
 Frame = -1

Query  549  NPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDA-IQAEFAFGSNAM--  382
            NPFGFKE  +S GGSRMWTPGQSGTCSPAVAA  D +ADVPM D  + AEFAFG NA+  
Sbjct  262  NPFGFKEEAMSGGGSRMWTPGQSGTCSPAVAAGADNTADVPMCDGNMAAEFAFGCNAIAT  321

Query  381  -GIVKPWEGERIHEECITDDLELTLGNSNTR  292
             G+VKPWEGERI EEC++DDLELTLGNS TR
Sbjct  322  GGLVKPWEGERI-EECVSDDLELTLGNSRTR  351



>ref|XP_003596275.1| Brassinosteroid signaling positive regulator-related protein 
[Medicago truncatula]
 gb|AES66526.1| brassinazole-resistant 1 protein [Medicago truncatula]
Length=323

 Score =   127 bits (319),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEPLSNGG-SRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGF+E +  G  SRMWTPGQSGTCSPA+AA  D +AD+PMS+AI  EFAFGS+A+G+V
Sbjct  237  NPFGFREEVFCGSDSRMWTPGQSGTCSPALAAGSDHNADIPMSEAISDEFAFGSSAVGLV  296

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHE+  +DDLELTLG S TR
Sbjct  297  KPWEGERIHEDSGSDDLELTLGTSKTR  323



>ref|XP_007149549.1| hypothetical protein PHAVU_005G079400g [Phaseolus vulgaris]
 gb|ESW21543.1| hypothetical protein PHAVU_005G079400g [Phaseolus vulgaris]
Length=325

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPF FKE  L   GSRMWTP  SGTCSPA+A   D +AD+PMS+A+  EFAFGSN +G+V
Sbjct  239  NPFAFKEDGLVGSGSRMWTPAHSGTCSPAIAPGTDHNADIPMSEAVSDEFAFGSNMLGLV  298

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEE  +DDLELTLGNS TR
Sbjct  299  KPWEGERIHEEFGSDDLELTLGNSKTR  325



>gb|KHN36918.1| BES1/BZR1 like protein 4 [Glycine soja]
Length=331

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPF FKE  L   GSRMWTP QSGTCSPA+    D++AD+PMS+A+  EFAFGSN +G+V
Sbjct  239  NPFAFKEDGLPGSGSRMWTPAQSGTCSPAIPPGSDQNADIPMSEAVSDEFAFGSNMLGLV  298

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEE  +DDLELTLGNS TR
Sbjct  299  KPWEGERIHEEFGSDDLELTLGNSKTR  325



>ref|XP_004294130.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Fragaria vesca subsp. 
vesca]
Length=324

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 71/88 (81%), Gaps = 2/88 (2%)
 Frame = -1

Query  549  NPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGS-NAMGI  376
            NPFGFKE  L+ GGSRMWTPGQSGTCSPA+AA  D +AD+PMS+ I  EFAFGS N  G+
Sbjct  237  NPFGFKEEALAGGGSRMWTPGQSGTCSPAIAAGSDHTADIPMSEVISDEFAFGSCNTAGL  296

Query  375  VKPWEGERIHEECITDDLELTLGNSNTR  292
            VK WEGERIHEE  +DDLELTLG S TR
Sbjct  297  VKAWEGERIHEESGSDDLELTLGCSKTR  324



>ref|XP_009334016.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=324

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEPLS-NGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK+ +S  GGSRMWTPGQSGTCSPA+AA  D +AD+PMS+ I  EFAFG N  G+V
Sbjct  238  NPFGFKDEVSAGGGSRMWTPGQSGTCSPAIAAGSDHAADIPMSEVISDEFAFGCNTTGLV  297

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            K WEGE+IHE+  +DDLELTLG+S TR
Sbjct  298  KAWEGEKIHEDSGSDDLELTLGSSRTR  324



>ref|XP_008381083.1| PREDICTED: BES1/BZR1 homolog protein 4 [Malus domestica]
Length=324

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKEPLS-NGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFK+ +S  GGSRMWTPGQSGTCSPA+AA  D +AD+PMS+ I  EFAFG N  G+V
Sbjct  238  NPFGFKDEVSAGGGSRMWTPGQSGTCSPAIAAGSDHAADIPMSEVISDEFAFGCNTTGLV  297

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            K WEGE+IHE+  +DDLELTLG+S TR
Sbjct  298  KAWEGEKIHEDSGSDDLELTLGSSRTR  324



>ref|XP_003540502.1| PREDICTED: BES1/BZR1 homolog protein 4 [Glycine max]
Length=322

 Score =   124 bits (312),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPF FKE  L + GS MWTP QSGTCSPAV     ++AD+PMSDA+  EFAFGSN +G+V
Sbjct  236  NPFAFKEHALPSSGSPMWTPAQSGTCSPAVPPGSYQNADIPMSDAVSDEFAFGSNVLGLV  295

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHEE  +DDLELTLGNS TR
Sbjct  296  KPWEGERIHEEFGSDDLELTLGNSKTR  322



>ref|XP_004489003.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Cicer 
arietinum]
Length=342

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 72/88 (82%), Gaps = 2/88 (2%)
 Frame = -1

Query  549  NPFGFKEPLSNGG-SRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGF+E +  G  SRMWTPGQSGTCSPAVAA  D +AD+PM++A+  EFAFGS+  G+V
Sbjct  238  NPFGFREEVFCGSDSRMWTPGQSGTCSPAVAAGSDHTADIPMAEAVSDEFAFGSHTAGLV  297

Query  372  KPWEGERIHEECI-TDDLELTLGNSNTR  292
            KPWEGERIHE+C  +DDLELTLG S TR
Sbjct  298  KPWEGERIHEDCDGSDDLELTLGCSKTR  325



>ref|XP_004489004.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Cicer 
arietinum]
Length=325

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 72/88 (82%), Gaps = 2/88 (2%)
 Frame = -1

Query  549  NPFGFKEPLSNGG-SRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGF+E +  G  SRMWTPGQSGTCSPAVAA  D +AD+PM++A+  EFAFGS+  G+V
Sbjct  238  NPFGFREEVFCGSDSRMWTPGQSGTCSPAVAAGSDHTADIPMAEAVSDEFAFGSHTAGLV  297

Query  372  KPWEGERIHEECI-TDDLELTLGNSNTR  292
            KPWEGERIHE+C  +DDLELTLG S TR
Sbjct  298  KPWEGERIHEDCDGSDDLELTLGCSKTR  325



>ref|XP_010537716.1| PREDICTED: BES1/BZR1 homolog protein 4 [Tarenaya hassleriana]
Length=309

 Score =   122 bits (305),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 70/90 (78%), Gaps = 4/90 (4%)
 Frame = -1

Query  549  NPFGFKEPLSN---GGSRMWTPGQSGTCSPA-VAAALDRSADVPMSDAIQAEFAFGSNAM  382
            NPFGFKE   N   GGS MWTPGQSGTCSPA +    D++ADVPMS+A+ AEFAFG N  
Sbjct  219  NPFGFKEASGNNGSGGSMMWTPGQSGTCSPAAIPPGSDQTADVPMSEAVPAEFAFGGNEN  278

Query  381  GIVKPWEGERIHEECITDDLELTLGNSNTR  292
            G+VK WEGERIHEE  +DDLELTLGNS TR
Sbjct  279  GLVKAWEGERIHEESGSDDLELTLGNSTTR  308



>ref|XP_006387974.1| hypothetical protein POPTR_0439s00200g [Populus trichocarpa]
 gb|ERP46888.1| hypothetical protein POPTR_0439s00200g [Populus trichocarpa]
Length=249

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 73/91 (80%), Gaps = 6/91 (7%)
 Frame = -1

Query  549  NPFGFKE-----PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA  385
            NPFGFKE       SNGGSRMWTPGQSGTCSPA+AA  D +AD+PM++ I  EFAF  NA
Sbjct  160  NPFGFKEEAFGGGGSNGGSRMWTPGQSGTCSPAIAAGSDHTADIPMAE-ISDEFAFRCNA  218

Query  384  MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             G+VKPWEGERIHEEC +DDLELTLGNS TR
Sbjct  219  TGLVKPWEGERIHEECGSDDLELTLGNSRTR  249



>ref|NP_193624.1| BES1/BZR1-like protein 3 [Arabidopsis thaliana]
 sp|O49404.1|BEH3_ARATH RecName: Full=BES1/BZR1 homolog protein 3 [Arabidopsis thaliana]
 emb|CAA16746.1| putative protein [Arabidopsis thaliana]
 emb|CAB78891.1| putative protein [Arabidopsis thaliana]
 gb|AAM65918.1| unknown [Arabidopsis thaliana]
 dbj|BAC43438.1| unknown protein [Arabidopsis thaliana]
 gb|ABD19693.1| At4g18890 [Arabidopsis thaliana]
 gb|AEE84102.1| BES1/BZR1-like protein 3 [Arabidopsis thaliana]
Length=284

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 70/91 (77%), Gaps = 5/91 (5%)
 Frame = -1

Query  549  NPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAM--  382
            NPF  KE    G   S MWTPGQSG CSPA+ A +D+++DVPM+D + AEFAFG NAM  
Sbjct  194  NPFFDKEAFKMGDCNSPMWTPGQSGNCSPAIPAGVDQNSDVPMADGMTAEFAFGCNAMAA  253

Query  381  -GIVKPWEGERIHEECITDDLELTLGNSNTR  292
             G+VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  254  NGMVKPWEGERIHGECVSDDLELTLGNSRTR  284



>ref|XP_006370100.1| hypothetical protein POPTR_0001s39520g [Populus trichocarpa]
 ref|XP_006370101.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
 gb|ABK93591.1| unknown [Populus trichocarpa]
 gb|ERP66669.1| hypothetical protein POPTR_0001s39520g [Populus trichocarpa]
 gb|ERP66670.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
Length=328

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 73/91 (80%), Gaps = 6/91 (7%)
 Frame = -1

Query  549  NPFGFKE-----PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA  385
            NPFGFKE       SNGGSRMWTPGQSGTCSPA+AA  D +AD+PM++ I  EFAF  NA
Sbjct  239  NPFGFKEEAFGGGGSNGGSRMWTPGQSGTCSPAIAAGSDHTADIPMAE-ISDEFAFRCNA  297

Query  384  MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             G+VKPWEGERIHEEC +DDLELTLGNS TR
Sbjct  298  TGLVKPWEGERIHEECGSDDLELTLGNSRTR  328



>gb|KFK28557.1| hypothetical protein AALP_AA7G011700 [Arabis alpina]
Length=284

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 69/91 (76%), Gaps = 5/91 (5%)
 Frame = -1

Query  549  NPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN---A  385
            NPF   +    G   S MWTPGQSG CSPA+ A LD++ADVPMSD + AEFAFG N   A
Sbjct  194  NPFFDNQAFKMGDCNSPMWTPGQSGNCSPAIPAGLDQTADVPMSDGMAAEFAFGCNAIAA  253

Query  384  MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +G+VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  254  IGMVKPWEGERIHGECVSDDLELTLGNSRTR  284



>ref|XP_006284265.1| hypothetical protein CARUB_v10005431mg [Capsella rubella]
 gb|EOA17163.1| hypothetical protein CARUB_v10005431mg [Capsella rubella]
Length=284

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 69/91 (76%), Gaps = 5/91 (5%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSR--MWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA---  385
            NPF  KE    G S   MWTPGQSG CSPA+ A  D+++DVPMSD + AEFAFG NA   
Sbjct  194  NPFFDKEAFKMGDSNSPMWTPGQSGNCSPAIPAGADQNSDVPMSDGMAAEFAFGCNATAV  253

Query  384  MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +G+VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  254  IGMVKPWEGERIHGECVSDDLELTLGNSRTR  284



>ref|XP_010434483.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
 ref|XP_010439796.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
 ref|XP_010449452.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
Length=284

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 5/91 (5%)
 Frame = -1

Query  549  NPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA---  385
            NPF  KE    G   S MWTPGQSG CSPA+ A +D+++DVPM+D + AEFAFG NA   
Sbjct  194  NPFFDKEAFKMGDCNSPMWTPGQSGNCSPAIPAGVDQNSDVPMADGMAAEFAFGCNATTV  253

Query  384  MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +G+VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  254  IGMVKPWEGERIHGECVSDDLELTLGNSRTR  284



>ref|XP_010062789.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Eucalyptus grandis]
 gb|KCW69907.1| hypothetical protein EUGRSUZ_F03236 [Eucalyptus grandis]
Length=320

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFG K E L+ GGSR WTPGQSGTCSPA+AAA D + D+PMS+ +  EFAFG +  G+V
Sbjct  234  NPFGSKQEVLAVGGSRTWTPGQSGTCSPAIAAAADHTGDIPMSEVMSNEFAFGVSGKGLV  293

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIH+E  +DDLELTLG S  R
Sbjct  294  KPWEGERIHDEPGSDDLELTLGGSKCR  320



>ref|XP_002887754.1| hypothetical protein ARALYDRAFT_895772 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64013.1| hypothetical protein ARALYDRAFT_895772 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 72/92 (78%), Gaps = 6/92 (7%)
 Frame = -1

Query  549  NPFGFKE-----PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA-EFAFGSN  388
            NPFGFKE         GGSRMWTPGQSGTCSPA+  A D++ADVPMS+A+   EFAFGSN
Sbjct  233  NPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAIPPAADQTADVPMSEAVAPPEFAFGSN  292

Query  387  AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  293  TNGLVKAWEGERIHEESGSDDLELTLGNSSTR  324



>ref|XP_010665681.1| PREDICTED: BES1/BZR1 homolog protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=329

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAM-GI  376
            NPF  +E  ++ GGSRMWTPGQSGTCSP +AA   R+ADV MSD I AEFAFG+  M G+
Sbjct  242  NPFASREEVMAGGGSRMWTPGQSGTCSPIIAAGPARTADVHMSDGIAAEFAFGNGMMGGL  301

Query  375  VKPWEGERIHEECITDDLELTLGNSNTR  292
            VK WEGE IHEEC+ DDLELTLG+S TR
Sbjct  302  VKAWEGEIIHEECVPDDLELTLGSSRTR  329



>ref|XP_009128310.1| PREDICTED: BES1/BZR1 homolog protein 4 [Brassica rapa]
Length=292

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 71/88 (81%), Gaps = 6/88 (7%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA--EFAFGSNAMGI  376
            NPFGFKE    GGSRMWTPGQSGTCSPA+     ++ADVPMS+A+ A  EFAFGSNA G+
Sbjct  209  NPFGFKEGGGGGGSRMWTPGQSGTCSPAIP----QTADVPMSEAVVAPPEFAFGSNANGL  264

Query  375  VKPWEGERIHEECITDDLELTLGNSNTR  292
            VK WEGERIHE   +DDLELTLGNS+TR
Sbjct  265  VKAWEGERIHEVSGSDDLELTLGNSSTR  292



>ref|XP_002870016.1| hypothetical protein ARALYDRAFT_492971 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46275.1| hypothetical protein ARALYDRAFT_492971 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 5/91 (5%)
 Frame = -1

Query  549  NPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN---A  385
            NPF  KE    G   S MWTPGQSG CSPA+ A +D+++DVPM+D + AEFAFG N   A
Sbjct  194  NPFFDKEAFKMGDCNSPMWTPGQSGNCSPAIPAGVDQNSDVPMADGMAAEFAFGCNAIAA  253

Query  384  MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +G+VKPWEGERIH EC++DDLELTLGNS T+
Sbjct  254  IGMVKPWEGERIHGECVSDDLELTLGNSRTK  284



>ref|XP_010429699.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Camelina sativa]
Length=325

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 71/92 (77%), Gaps = 6/92 (7%)
 Frame = -1

Query  549  NPFGFKE-----PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA-EFAFGSN  388
            NPFGFKE         GGSRMWTPGQSGTCSPA+ +  D +ADVPMS+A+   EFAFGSN
Sbjct  234  NPFGFKEEAASAAGCGGGSRMWTPGQSGTCSPAIPSGADHTADVPMSEAVAPPEFAFGSN  293

Query  387  AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  294  TNGLVKAWEGERIHEESGSDDLELTLGNSSTR  325



>ref|XP_006414043.1| hypothetical protein EUTSA_v10025918mg [Eutrema salsugineum]
 gb|ESQ55496.1| hypothetical protein EUTSA_v10025918mg [Eutrema salsugineum]
Length=285

 Score =   116 bits (290),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 69/91 (76%), Gaps = 5/91 (5%)
 Frame = -1

Query  549  NPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAM--  382
            NPF  KE    G   S MWTPGQSG CSPA+ A +D+++DVPM+D + AEFAFG NA+  
Sbjct  195  NPFFDKEAFKMGDCNSPMWTPGQSGNCSPAIPAGVDQNSDVPMADGMAAEFAFGCNAIAA  254

Query  381  -GIVKPWEGERIHEECITDDLELTLGNSNTR  292
             G+VKPWEGERIH EC++DDLELTLG S TR
Sbjct  255  VGMVKPWEGERIHGECVSDDLELTLGTSRTR  285



>ref|NP_565187.1| BES1/BZR1 homolog 4 [Arabidopsis thaliana]
 sp|Q9ZV88.1|BEH4_ARATH RecName: Full=BES1/BZR1 homolog protein 4 [Arabidopsis thaliana]
 gb|AAC83038.1| EST gb|R30300 comes from this gene [Arabidopsis thaliana]
 gb|AAK91446.1| At1g78700/F9K20_26 [Arabidopsis thaliana]
 gb|AAL90992.1| At1g78700/F9K20_26 [Arabidopsis thaliana]
 gb|AEE36140.1| BES1/BZR1 homolog 4 [Arabidopsis thaliana]
Length=325

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 71/92 (77%), Gaps = 6/92 (7%)
 Frame = -1

Query  549  NPFGFKE-----PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA-EFAFGSN  388
            NPFGFKE         GGSRMWTPGQSGTCSPA+    D++ADVPMS+A+   EFAFGSN
Sbjct  234  NPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAIPPGADQTADVPMSEAVAPPEFAFGSN  293

Query  387  AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  294  TNGLVKAWEGERIHEESGSDDLELTLGNSSTR  325



>ref|XP_006302567.1| hypothetical protein CARUB_v10020674mg [Capsella rubella]
 gb|EOA35465.1| hypothetical protein CARUB_v10020674mg [Capsella rubella]
Length=317

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 71/92 (77%), Gaps = 6/92 (7%)
 Frame = -1

Query  549  NPFGFKE-----PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA-EFAFGSN  388
            NPFGFKE         GGSRMWTPGQSGTCSPA+    D++ADVPMS+A+   EFAFGSN
Sbjct  226  NPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAIPPGADQTADVPMSEAVAPPEFAFGSN  285

Query  387  AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  286  TNGLVKAWEGERIHEESGSDDLELTLGNSSTR  317



>ref|XP_010417476.1| PREDICTED: BES1/BZR1 homolog protein 4 [Camelina sativa]
Length=325

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 70/92 (76%), Gaps = 6/92 (7%)
 Frame = -1

Query  549  NPFGFKE-----PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA-EFAFGSN  388
            NPFGFKE         GGSRMWTPGQSGTCSPA+    D +ADVPMS+A+   EFAFGSN
Sbjct  234  NPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAIPPGADHTADVPMSEAVAPPEFAFGSN  293

Query  387  AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  294  TNGLVKAWEGERIHEESGSDDLELTLGNSSTR  325



>ref|XP_010472705.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Camelina sativa]
Length=325

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 70/92 (76%), Gaps = 6/92 (7%)
 Frame = -1

Query  549  NPFGFKE-----PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA-EFAFGSN  388
            NPFGFKE         GGSRMWTPGQSGTCSPA+    D +ADVPMS+A+   EFAFGSN
Sbjct  234  NPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAIPPGADHTADVPMSEAVAPPEFAFGSN  293

Query  387  AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  294  TDGLVKAWEGERIHEESGSDDLELTLGNSSTR  325



>ref|XP_010518826.1| PREDICTED: BES1/BZR1 homolog protein 3 isoform X2 [Tarenaya hassleriana]
Length=294

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 65/89 (73%), Gaps = 3/89 (3%)
 Frame = -1

Query  549  NPFGFKEPL-SNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN--AMG  379
            NPF  KE   +   S MWTPGQSG CSPA+ A  D++ADVPM+D +  EFAFG N    G
Sbjct  206  NPFFEKEAFKARDCSPMWTPGQSGNCSPAIPAGADQTADVPMADGMAVEFAFGCNPRTTG  265

Query  378  IVKPWEGERIHEECITDDLELTLGNSNTR  292
            +VKPWEGERIHEEC  DDLELTLGNS TR
Sbjct  266  LVKPWEGERIHEECAPDDLELTLGNSRTR  294



>ref|XP_010518825.1| PREDICTED: BES1/BZR1 homolog protein 3 isoform X1 [Tarenaya hassleriana]
Length=311

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 72/104 (69%), Gaps = 5/104 (5%)
 Frame = -1

Query  549  NPFGFKEPL-SNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN--AMG  379
            NPF  KE   +   S MWTPGQSG CSPA+ A  D++ADVPM+D +  EFAFG N    G
Sbjct  206  NPFFEKEAFKARDCSPMWTPGQSGNCSPAIPAGADQTADVPMADGMAVEFAFGCNPRTTG  265

Query  378  IVKPWEGERIHEECITDDLELTLGNSNTR*GVEGRVKIQSRSIS  247
            +VKPWEGERIHEEC  DDLELTLGNS TR   E R K +  +++
Sbjct  266  LVKPWEGERIHEECAPDDLELTLGNSRTR--CERREKEKGENVA  307



>gb|KFK42252.1| hypothetical protein AALP_AA2G231000 [Arabis alpina]
Length=317

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 8/88 (9%)
 Frame = -1

Query  546  PFGFKEPL-SNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA--EFAFGSNAMGI  376
            PFGFK+ + S GGSRMWTPGQSGTCSPA+      + DVPMS+A+ A  EFAFGSN  G+
Sbjct  235  PFGFKDEVASAGGSRMWTPGQSGTCSPALP-----TGDVPMSEAVVAPPEFAFGSNINGL  289

Query  375  VKPWEGERIHEECITDDLELTLGNSNTR  292
            VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  290  VKAWEGERIHEESGSDDLELTLGNSSTR  317



>emb|CDX98592.1| BnaA03g43770D [Brassica napus]
Length=276

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 66/88 (75%), Gaps = 7/88 (8%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSR--MWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            NPF  KE    G S   MWTPGQSG CSPA+ A +D+++DVPM+D + AEFAF     G+
Sbjct  194  NPFFDKEAFKMGDSNSPMWTPGQSGNCSPAIPAGVDQNSDVPMADGMAAEFAF-----GM  248

Query  375  VKPWEGERIHEECITDDLELTLGNSNTR  292
            VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  249  VKPWEGERIHGECVSDDLELTLGNSRTR  276



>emb|CDY01563.1| BnaC07g35530D [Brassica napus]
Length=276

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 66/88 (75%), Gaps = 7/88 (8%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSR--MWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            NPF  KE    G S   MWTPGQSG CSPA+ A +D+++DVPM+D + AEFAF     G+
Sbjct  194  NPFFDKEAFKMGDSSSPMWTPGQSGNCSPAIPAGVDQNSDVPMADGMAAEFAF-----GM  248

Query  375  VKPWEGERIHEECITDDLELTLGNSNTR  292
            VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  249  VKPWEGERIHGECVSDDLELTLGNSRTR  276



>emb|CDX87440.1| BnaA07g34330D [Brassica napus]
Length=307

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 10/92 (11%)
 Frame = -1

Query  549  NPFGFKE-PLSNGG----SRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA-EFAFGSN  388
            NPFGF+E  L++ G    SRMWTPGQSGTCSPA+     ++ DVPMS+A+   EFAFGSN
Sbjct  218  NPFGFREDQLASAGGGDGSRMWTPGQSGTCSPAIP----QTGDVPMSEAVAPPEFAFGSN  273

Query  387  AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            A G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  274  ANGLVKAWEGERIHEESGSDDLELTLGNSSTR  305



>ref|XP_006389963.1| hypothetical protein EUTSA_v10018888mg [Eutrema salsugineum]
 gb|ESQ27249.1| hypothetical protein EUTSA_v10018888mg [Eutrema salsugineum]
Length=319

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 9/91 (10%)
 Frame = -1

Query  549  NPFGFKEPLSN---GGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA-EFAFGS-NA  385
            NPFGFKE +++   GGSRMWTP QSGTCSPA+     ++ADVPMS+A+   EFAFGS N 
Sbjct  233  NPFGFKEEVASARGGGSRMWTPSQSGTCSPAIP----QTADVPMSEAVAPPEFAFGSSNT  288

Query  384  MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  289  NGLVKAWEGERIHEESGSDDLELTLGNSSTR  319



>emb|CDY26877.1| BnaA02g19020D [Brassica napus]
Length=293

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 71/89 (80%), Gaps = 7/89 (8%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSR-MWTPGQSGTCSPAVAAALDRSADVPMSDAIQA--EFAFGSNAMG  379
            NPFGFKE    GGSR +WTPGQSGTCSPA+     ++ADVPMS+A+ A  EFAFGSNA G
Sbjct  209  NPFGFKEGGGGGGSRILWTPGQSGTCSPAIP----QTADVPMSEAVVAPPEFAFGSNANG  264

Query  378  IVKPWEGERIHEECITDDLELTLGNSNTR  292
            +VK WEGERIHE   +DDLELTLGNS+TR
Sbjct  265  LVKAWEGERIHEVSGSDDLELTLGNSSTR  293



>ref|XP_009106588.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Brassica rapa]
Length=307

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 10/92 (11%)
 Frame = -1

Query  549  NPFGFKE-PLSNGG----SRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA-EFAFGSN  388
            NPFGF+E  L++ G    SRMWTPGQSGTCSPA+     ++ DVPMS+A+   EFAFGSN
Sbjct  218  NPFGFREDQLASAGGGDGSRMWTPGQSGTCSPAIP----QTGDVPMSEAVAPPEFAFGSN  273

Query  387  AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            A G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  274  ANGLVKAWEGERIHEESGSDDLELTLGNSSTR  305



>emb|CDY14593.1| BnaC02g25200D [Brassica napus]
Length=293

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 71/89 (80%), Gaps = 7/89 (8%)
 Frame = -1

Query  549  NPFGFKE-PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA--EFAFGSNAMG  379
            NPFGFKE     GGSRMWTPGQSGTCSPA+     ++ADVPMS+A+ A  EFAFGS+A G
Sbjct  209  NPFGFKEAGGGGGGSRMWTPGQSGTCSPAIP----QTADVPMSEAVVAPPEFAFGSSANG  264

Query  378  IVKPWEGERIHEECITDDLELTLGNSNTR  292
            +VK WEGERIHE   +DDLELTLGNS+TR
Sbjct  265  LVKAWEGERIHEVSGSDDLELTLGNSSTR  293



>emb|CDY66394.1| BnaC03g78350D [Brassica napus]
Length=139

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 69/92 (75%), Gaps = 10/92 (11%)
 Frame = -1

Query  549  NPFGFKE-----PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA-EFAFGSN  388
            NPFGF+E         GGSRMWT GQSGTCSPA+     ++ DVPMS+A+   EFAFGSN
Sbjct  50   NPFGFREDQLASAGGGGGSRMWTLGQSGTCSPAIT----QTGDVPMSEAVAPPEFAFGSN  105

Query  387  AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            A G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  106  ANGLVKAWEGERIHEESGSDDLELTLGNSSTR  137



>ref|XP_009132289.1| PREDICTED: BES1/BZR1 homolog protein 3 [Brassica rapa]
 emb|CDX78903.1| BnaA01g09700D [Brassica napus]
Length=276

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 66/88 (75%), Gaps = 7/88 (8%)
 Frame = -1

Query  549  NPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            NPF  K   + G   S MWTPGQSG CSPA+ A +D+++DVPM+D + AEFAF     G+
Sbjct  194  NPFFDKAAFTMGDCSSPMWTPGQSGNCSPAIPAGVDQNSDVPMADGMAAEFAF-----GM  248

Query  375  VKPWEGERIHEECITDDLELTLGNSNTR  292
            VKPWEGERIH EC+++DLELTLGNS TR
Sbjct  249  VKPWEGERIHGECVSEDLELTLGNSRTR  276



>emb|CDX88466.1| BnaC06g39100D [Brassica napus]
Length=307

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 70/92 (76%), Gaps = 10/92 (11%)
 Frame = -1

Query  549  NPFGFKE-----PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQA-EFAFGSN  388
            NPFGF+E         GGSRMWTPGQSGTCSPA+     ++ DVPMS+A+   EFAFGSN
Sbjct  218  NPFGFREDQLASAGGGGGSRMWTPGQSGTCSPAIP----QTGDVPMSEAVAPPEFAFGSN  273

Query  387  AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            A G+VK WEGERIHEE  +DDLELTLGNS+TR
Sbjct  274  ANGLVKAWEGERIHEESGSDDLELTLGNSSTR  305



>ref|XP_009136969.1| PREDICTED: BES1/BZR1 homolog protein 3-like [Brassica rapa]
Length=276

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 65/88 (74%), Gaps = 7/88 (8%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSR--MWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            NPF  KE    G S   MWTPGQSG CSPA+ A +D+++D+ M+D + AEFAFG     +
Sbjct  194  NPFFDKEAFKMGDSSSPMWTPGQSGNCSPAIPAGVDQNSDLTMADGMAAEFAFG-----M  248

Query  375  VKPWEGERIHEECITDDLELTLGNSNTR  292
            VKPWEGERIH EC++DDLELTLGNS TR
Sbjct  249  VKPWEGERIHGECVSDDLELTLGNSRTR  276



>gb|EYU29527.1| hypothetical protein MIMGU_mgv1a010055mg [Erythranthe guttata]
Length=324

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 64/87 (74%), Gaps = 6/87 (7%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGF+ E LS  GS M TPGQSGTCSP + A+     D+PM++ I  EFAFGSN  G+V
Sbjct  243  NPFGFRVEDLSRSGSLMCTPGQSGTCSPVIGAS-----DIPMAEVIPNEFAFGSNTKGLV  297

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            K WEGERIHE C +D+LELTLG S TR
Sbjct  298  KAWEGERIHEVCGSDELELTLGTSKTR  324



>emb|CDX99414.1| BnaC01g11380D [Brassica napus]
Length=308

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 65/88 (74%), Gaps = 7/88 (8%)
 Frame = -1

Query  549  NPFGFKEPLSNG--GSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            NPF  K     G   S MWTPGQSG CSPA+ A +D+++DVPM+D + AEFAF     G+
Sbjct  226  NPFFDKAAFKMGDCSSPMWTPGQSGNCSPAIPAGVDQNSDVPMADGMAAEFAF-----GM  280

Query  375  VKPWEGERIHEECITDDLELTLGNSNTR  292
            VKPWEGERIH EC+++DLELTLGNS TR
Sbjct  281  VKPWEGERIHGECVSEDLELTLGNSRTR  308



>gb|KHN36917.1| BES1/BZR1 like protein 4 [Glycine soja]
Length=254

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 68/89 (76%), Gaps = 3/89 (3%)
 Frame = -1

Query  549  NPFGFKE-PLSNGGSRMWT-PGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            NPFG KE  +   GSRMWT PG SGTCSPAVAA  + ++D+PM++A+  EFAFGS++ G+
Sbjct  162  NPFGLKEDAMVGSGSRMWTTPGASGTCSPAVAAGSENTSDIPMAEAVSDEFAFGSSSSGL  221

Query  375  VKPWEGERIHEECI-TDDLELTLGNSNTR  292
            V  W+GERIHE    TDDLELTLG+S TR
Sbjct  222  VNAWKGERIHEASFGTDDLELTLGSSKTR  250



>emb|CDP06034.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 65/87 (75%), Gaps = 5/87 (6%)
 Frame = -1

Query  549  NPFGFK-EPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPF FK E L + GS M TPGQSGTCSPA+ A     +DVPM++ I  EFAF S   G+V
Sbjct  237  NPFAFKFESLRHTGSHMCTPGQSGTCSPAIPAG----SDVPMAEVISDEFAFRSIKGGLV  292

Query  372  KPWEGERIHEECITDDLELTLGNSNTR  292
            KPWEGERIHE+C +DDLELTLG+S TR
Sbjct  293  KPWEGERIHEDCGSDDLELTLGSSKTR  319



>ref|XP_006592940.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X3 [Glycine 
max]
Length=278

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 3/89 (3%)
 Frame = -1

Query  549  NPFGFKEPLSNG-GSRMWT-PGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            NPFGFKE    G GSRMWT PG SGTCSPAVAA  + ++D+PM++A+  EFAFGS++  +
Sbjct  186  NPFGFKEDAMGGSGSRMWTTPGASGTCSPAVAAGSENTSDIPMAEAVSDEFAFGSSSSVL  245

Query  375  VKPWEGERIHEECI-TDDLELTLGNSNTR  292
            V  W+GERIHE    TDDLELTLG+S TR
Sbjct  246  VNAWKGERIHEASFGTDDLELTLGSSKTR  274



>ref|XP_010916623.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=340

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 66/97 (68%), Gaps = 11/97 (11%)
 Frame = -1

Query  549  NPFGFKEPLSNGG--SRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN----  388
            NPFGF +  S G   SRMWTPGQSGTCSP         ADV MSD I  EFAFGS+    
Sbjct  247  NPFGFFKEASAGAGSSRMWTPGQSGTCSPVPGGG---HADVQMSDGISDEFAFGSSSNGN  303

Query  387  --AMGIVKPWEGERIHEECITDDLELTLGNSNTR*GV  283
              A G+VKPWEGERIHEEC +D+LELTLG+S TR G 
Sbjct  304  LPANGLVKPWEGERIHEECASDELELTLGSSRTRSGA  340



>ref|XP_006594721.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Glycine 
max]
Length=330

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 68/89 (76%), Gaps = 3/89 (3%)
 Frame = -1

Query  549  NPFGFKE-PLSNGGSRMWT-PGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            NPFG KE  +   GSRMWT PG SGTCSPAVAA  + ++D+PM++A+  EFAFGS++ G+
Sbjct  242  NPFGLKEDAMVGSGSRMWTTPGASGTCSPAVAAGSENTSDIPMAEAVSDEFAFGSSSSGL  301

Query  375  VKPWEGERIHEECI-TDDLELTLGNSNTR  292
            V  W+GERIHE    TDDLELTLG+S TR
Sbjct  302  VNAWKGERIHEASFGTDDLELTLGSSKTR  330



>ref|XP_003543196.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Glycine 
max]
Length=334

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 68/89 (76%), Gaps = 3/89 (3%)
 Frame = -1

Query  549  NPFGFKE-PLSNGGSRMWT-PGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            NPFG KE  +   GSRMWT PG SGTCSPAVAA  + ++D+PM++A+  EFAFGS++ G+
Sbjct  242  NPFGLKEDAMVGSGSRMWTTPGASGTCSPAVAAGSENTSDIPMAEAVSDEFAFGSSSSGL  301

Query  375  VKPWEGERIHEECI-TDDLELTLGNSNTR  292
            V  W+GERIHE    TDDLELTLG+S TR
Sbjct  302  VNAWKGERIHEASFGTDDLELTLGSSKTR  330



>ref|XP_003540501.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Glycine 
max]
Length=330

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 3/89 (3%)
 Frame = -1

Query  549  NPFGFKEPLSNG-GSRMWT-PGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            NPFGFKE    G GSRMWT PG SGTCSPAVAA  + ++D+PM++A+  EFAFGS++  +
Sbjct  242  NPFGFKEDAMGGSGSRMWTTPGASGTCSPAVAAGSENTSDIPMAEAVSDEFAFGSSSSVL  301

Query  375  VKPWEGERIHEECI-TDDLELTLGNSNTR  292
            V  W+GERIHE    TDDLELTLG+S TR
Sbjct  302  VNAWKGERIHEASFGTDDLELTLGSSKTR  330



>ref|XP_006592939.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Glycine 
max]
Length=334

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 3/89 (3%)
 Frame = -1

Query  549  NPFGFKEPLSNG-GSRMWT-PGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGI  376
            NPFGFKE    G GSRMWT PG SGTCSPAVAA  + ++D+PM++A+  EFAFGS++  +
Sbjct  242  NPFGFKEDAMGGSGSRMWTTPGASGTCSPAVAAGSENTSDIPMAEAVSDEFAFGSSSSVL  301

Query  375  VKPWEGERIHEECI-TDDLELTLGNSNTR  292
            V  W+GERIHE    TDDLELTLG+S TR
Sbjct  302  VNAWKGERIHEASFGTDDLELTLGSSKTR  330



>ref|XP_008796066.1| PREDICTED: protein BZR1 homolog 3 [Phoenix dactylifera]
Length=338

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 65/97 (67%), Gaps = 11/97 (11%)
 Frame = -1

Query  549  NPFGFKEPLSNGG--SRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN----  388
            NPFGF +  S G   SRM TPGQSGTCSP         ADV MSD I  EFAFGS+    
Sbjct  245  NPFGFFKEASAGAGSSRMLTPGQSGTCSPVPGGG---HADVQMSDGISDEFAFGSSSNGD  301

Query  387  --AMGIVKPWEGERIHEECITDDLELTLGNSNTR*GV  283
              A G+VKPWEGERIHEEC +D+LELTLG+S TR G 
Sbjct  302  LPANGLVKPWEGERIHEECASDELELTLGSSRTRSGA  338



>gb|ACE97214.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
Length=174

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  LS  GSRMWTPGQSGTCSPAV A +D++ADVPM+D++ AEFAFGSN  G+V
Sbjct  111  NPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGIDQTADVPMADSMAAEFAFGSNTAGLV  170

Query  372  KPWE  361
            KPWE
Sbjct  171  KPWE  174



>gb|ACE97192.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97197.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97198.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97208.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
Length=174

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  LS  GSRMWTPGQSGTCSPAV A +D++ADVPM+D++ AEFAFGSN  G+V
Sbjct  111  NPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGIDQTADVPMADSMAAEFAFGSNTAGLV  170

Query  372  KPWE  361
            KPWE
Sbjct  171  KPWE  174



>gb|ACE97191.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97193.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97194.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97195.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97199.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97200.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97201.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97202.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97203.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97204.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97205.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97206.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97207.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97209.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97210.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97211.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97212.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97213.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97215.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97216.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97217.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97218.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97219.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97220.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97221.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97222.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97223.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97224.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97225.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97226.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97227.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
 gb|ACE97228.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
Length=174

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  LS  GSRMWTPGQSGTCSPAV A +D++ADVPM+D++ AEFAFGSN  G+V
Sbjct  111  NPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGIDQTADVPMADSMAAEFAFGSNTAGLV  170

Query  372  KPWE  361
            KPWE
Sbjct  171  KPWE  174



>gb|ACE97196.1| brassinosteroid signaling positive regulator-related protein, 
partial [Populus tremula]
Length=174

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIV  373
            NPFGFKE  LS  GSRMWTPGQSGTCSPAV A +D++ADVPM+D++ AEFAFGSN  G+V
Sbjct  111  NPFGFKEEALSGAGSRMWTPGQSGTCSPAVPAGIDQTADVPMADSMAAEFAFGSNTAGLV  170

Query  372  KPWE  361
            KPWE
Sbjct  171  KPWE  174



>ref|XP_009415180.1| PREDICTED: protein BZR1 homolog 3-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 65/93 (70%), Gaps = 10/93 (11%)
 Frame = -1

Query  552  PNPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA----  385
            PNPFG  +  S  GSRMWTPGQSGTCSP          +V MSD    EFAFGS++    
Sbjct  246  PNPFGLYKEAS--GSRMWTPGQSGTCSPVPGG--HSHGNVQMSDVGSDEFAFGSSSNHIP  301

Query  384  --MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              +G+VKPWEGERIHEE ++D+LELTLG+SNTR
Sbjct  302  TTVGLVKPWEGERIHEEFVSDELELTLGSSNTR  334



>ref|XP_009397454.1| PREDICTED: protein BZR1 homolog 2-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 62/92 (67%), Gaps = 10/92 (11%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMG---  379
            NPF F      G SRMWTPGQSGT SPA+   +  +  + MSD I  EFAFGS+A     
Sbjct  247  NPFSFS---GGGSSRMWTPGQSGTSSPALPG-MPHNVGIQMSDGISQEFAFGSSATDDNP  302

Query  378  ---IVKPWEGERIHEECITDDLELTLGNSNTR  292
               +VKPWEGERIHEEC +DDLELTLG+S TR
Sbjct  303  IATLVKPWEGERIHEECGSDDLELTLGSSRTR  334



>ref|XP_010924706.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=339

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 62/94 (66%), Gaps = 12/94 (13%)
 Frame = -1

Query  549  NPFGFKEPLSNGG--SRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN----  388
            NPFGF    S G   SRMWTPGQSG CSP         ADV M + I  EFAFGS+    
Sbjct  247  NPFGFCNEASAGAGSSRMWTPGQSGACSPVPGG----HADVRMCNGISDEFAFGSSCNGN  302

Query  387  --AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
              + G+VKPWEGERIHEEC +D+LELTLG+S TR
Sbjct  303  LQSNGLVKPWEGERIHEECASDELELTLGSSRTR  336



>ref|XP_008792311.1| PREDICTED: protein BZR1 homolog 3-like [Phoenix dactylifera]
Length=339

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 65/95 (68%), Gaps = 13/95 (14%)
 Frame = -1

Query  549  NPFGF--KEPLSNGGS-RMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMG  379
            NPFGF  KE  +  GS RMWTPGQSGTCSP         A V +SD I  EFAFGS++ G
Sbjct  246  NPFGFFCKEASAGAGSSRMWTPGQSGTCSPVPGG----HAGVRVSDGISDEFAFGSSSNG  301

Query  378  ------IVKPWEGERIHEECITDDLELTLGNSNTR  292
                  +VKPWEGERIHEEC +D+LELTLG+S TR
Sbjct  302  NLQSNGLVKPWEGERIHEECGSDELELTLGSSRTR  336



>ref|XP_009388695.1| PREDICTED: protein BZR1 homolog 3-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 61/92 (66%), Gaps = 10/92 (11%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMG---  379
            NP GF      G SRMWTPGQSGT SP V   +    D+ MSD I  EFAFGS++ G   
Sbjct  247  NPQGFS---GGGSSRMWTPGQSGTSSP-VMPGMPCCVDIQMSDGISDEFAFGSSSNGGHL  302

Query  378  ---IVKPWEGERIHEECITDDLELTLGNSNTR  292
               +VKPWEGERIHEEC +DDLELTLG S TR
Sbjct  303  QAVLVKPWEGERIHEECGSDDLELTLGGSRTR  334



>ref|XP_008790049.1| PREDICTED: protein BZR1 homolog 3-like [Phoenix dactylifera]
Length=315

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 66/94 (70%), Gaps = 9/94 (10%)
 Frame = -1

Query  549  NPFGF-KEPLSNGGS-RMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMG-  379
            NPFGF KE ++ GGS RM TPGQSGTCSP +        DV MSD +  EFAFGS++ G 
Sbjct  220  NPFGFFKEVIAGGGSSRMMTPGQSGTCSPVMPGGAGH-VDVQMSDGMSDEFAFGSSSNGN  278

Query  378  -----IVKPWEGERIHEECITDDLELTLGNSNTR  292
                 +VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  279  HPPPGLVKAWEGERIHEECGSDELELTLGSSRTR  312



>ref|XP_010675300.1| PREDICTED: BES1/BZR1 homolog protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=286

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -1

Query  519  NGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEE  340
            +G SRM +P QSGTCSPA+ A  D +A++PM   I  EFAFGS+A G+VK WEGERIHEE
Sbjct  206  DGFSRMLSPLQSGTCSPAIPAGSDHTANIPMFGVICDEFAFGSSANGLVKAWEGERIHEE  265

Query  339  CITDDLELTLGNSNTR  292
              +DDL+LTLG+S TR
Sbjct  266  YGSDDLDLTLGSSMTR  281



>ref|XP_010915465.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=343

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 66/95 (69%), Gaps = 10/95 (11%)
 Frame = -1

Query  549  NPFGF-KEPLSNGGS-RMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA---  385
            NPFGF KE ++ GGS RM TPGQSGTCSP +        DV MSD +  EFAFGS++   
Sbjct  247  NPFGFFKEVIAGGGSSRMLTPGQSGTCSPVMPGGSGH-VDVQMSDGVSDEFAFGSSSSNR  305

Query  384  ----MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                 G+V+ WEGERIHEEC +D+LELTLG+S TR
Sbjct  306  HHPPAGLVRAWEGERIHEECGSDELELTLGSSRTR  340



>ref|XP_009381197.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Musa acuminata subsp. 
malaccensis]
Length=411

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 63/107 (59%), Gaps = 24/107 (22%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPA----------------VAAALDRSADVPMSDA  418
            NPFGF      G SRMWTPGQSGT SP                 V   +  + DV MS+ 
Sbjct  305  NPFGFS---GGGSSRMWTPGQSGTSSPVMPGIIWMPGQSGTRSPVMPGISHNIDVQMSNG  361

Query  417  IQAEFAFGSNA-----MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            I  EFAFGS++      G+VKPWEGERIHEEC  DDL+LTLG+S TR
Sbjct  362  ITDEFAFGSSSNGNSLRGLVKPWEGERIHEECGPDDLQLTLGSSRTR  408



>gb|EEC70129.1| hypothetical protein OsI_00807 [Oryza sativa Indica Group]
Length=334

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 65/95 (68%), Gaps = 10/95 (11%)
 Frame = -1

Query  549  NPFG-FKE--PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN---  388
            NPF  FK+  P+ N  SRM TPGQSGTCSPA+   +    D+ M DA+  EFAFGS+   
Sbjct  238  NPFSVFKDAIPVGNNSSRMCTPGQSGTCSPAIPG-MAPHPDIHMMDAVSDEFAFGSSTNG  296

Query  387  ---AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
               A G+V+ WEGERIHE+  +DDLELTLG+S TR
Sbjct  297  GHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRTR  331



>ref|XP_006643883.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Oryza brachyantha]
Length=261

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 64/95 (67%), Gaps = 10/95 (11%)
 Frame = -1

Query  549  NPFG-FKE--PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN---  388
            NPF  FK+  P+ N  SRM TPGQSGTCSPA+   +    D+ M D +  EFAFGS+   
Sbjct  165  NPFSVFKDAIPVGNSSSRMCTPGQSGTCSPAIPG-MAPHPDIHMMDVVSDEFAFGSSTNG  223

Query  387  ---AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
               A G+V+ WEGERIHE+  +DDLELTLG+S TR
Sbjct  224  GHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRTR  258



>gb|EEE65864.1| hypothetical protein OsJ_21656 [Oryza sativa Japonica Group]
Length=369

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 9/94 (10%)
 Frame = -1

Query  552  PNPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMG-  379
            PNPFG FKE +++  SR+ TPGQSGTCSP V   +    DV M D    +FAFGS++ G 
Sbjct  274  PNPFGIFKEAIAST-SRVCTPGQSGTCSP-VMGGMPAHHDVQMVDGAPDDFAFGSSSNGN  331

Query  378  -----IVKPWEGERIHEECITDDLELTLGNSNTR  292
                 +VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  332  NESPGLVKAWEGERIHEECASDELELTLGSSKTR  365



>gb|EEC80795.1| hypothetical protein OsI_23332 [Oryza sativa Indica Group]
Length=354

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 9/94 (10%)
 Frame = -1

Query  552  PNPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMG-  379
            PNPFG FKE +++  SR+ TPGQSGTCSP V   +    DV M D    +FAFGS++ G 
Sbjct  259  PNPFGIFKEAIAST-SRVCTPGQSGTCSP-VMGGMPAHHDVQMVDGAPDDFAFGSSSNGN  316

Query  378  -----IVKPWEGERIHEECITDDLELTLGNSNTR  292
                 +VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  317  NESPGLVKAWEGERIHEECASDELELTLGSSKTR  350



>ref|NP_001057840.1| Os06g0552300 [Oryza sativa Japonica Group]
 sp|Q5Z9E5.1|BZR3_ORYSJ RecName: Full=Protein BZR1 homolog 3; Short=OsBZR3; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 3 [Oryza sativa 
Japonica Group]
 dbj|BAD53662.1| putative mature anther-specific protein LAT61 [Oryza sativa Japonica 
Group]
 dbj|BAF19754.1| Os06g0552300 [Oryza sativa Japonica Group]
 dbj|BAG94965.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 9/94 (10%)
 Frame = -1

Query  552  PNPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMG-  379
            PNPFG FKE +++  SR+ TPGQSGTCSP V   +    DV M D    +FAFGS++ G 
Sbjct  260  PNPFGIFKEAIAST-SRVCTPGQSGTCSP-VMGGMPAHHDVQMVDGAPDDFAFGSSSNGN  317

Query  378  -----IVKPWEGERIHEECITDDLELTLGNSNTR  292
                 +VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  318  NESPGLVKAWEGERIHEECASDELELTLGSSKTR  351



>gb|EMS49339.1| hypothetical protein TRIUR3_13720 [Triticum urartu]
Length=245

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 63/96 (66%), Gaps = 11/96 (11%)
 Frame = -1

Query  549  NPFG-FKEPLSNGGS-RMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA---  385
            NPF  FKE +  GGS RM TPGQSGTCSP V   + R  DV M D +  EFAFGS+    
Sbjct  150  NPFSVFKEAIPGGGSSRMCTPGQSGTCSP-VIPGMARHPDVHMMDVVSDEFAFGSSTNGG  208

Query  384  -----MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                  G+V+ WEGERIHE+  +D+LELTLG+S TR
Sbjct  209  AQQATAGLVRAWEGERIHEDSGSDELELTLGSSRTR  244



>ref|XP_002454981.1| hypothetical protein SORBIDRAFT_03g002480 [Sorghum bicolor]
 gb|EES00101.1| hypothetical protein SORBIDRAFT_03g002480 [Sorghum bicolor]
Length=348

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 61/89 (69%), Gaps = 10/89 (11%)
 Frame = -1

Query  549  NPFG-FKE--PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN---  388
            NPF  FKE  P+ N  SRM TPGQSGTCSPA+   L  S DV M DA+  EFAFGS+   
Sbjct  259  NPFSVFKESIPVGNSSSRMCTPGQSGTCSPAIPGMLQHS-DVHMMDAVSDEFAFGSSTNG  317

Query  387  ---AMGIVKPWEGERIHEECITDDLELTL  310
               A G+V+ WEGERIHE+  +DDLELTL
Sbjct  318  AQQAAGLVRAWEGERIHEDSGSDDLELTL  346



>ref|XP_004968562.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Setaria italica]
Length=347

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 63/89 (71%), Gaps = 10/89 (11%)
 Frame = -1

Query  549  NPFG-FKEPLSNGG--SRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN---  388
            NPF  FKE +S GG  SRM TPGQSGTCSPA+   + R +DV M DA+  EFAFGS+   
Sbjct  258  NPFSVFKESISVGGNSSRMCTPGQSGTCSPAIPG-MPRPSDVHMMDAVSDEFAFGSSTNG  316

Query  387  ---AMGIVKPWEGERIHEECITDDLELTL  310
               A G+V+ WEGERIHE+  +DDLELTL
Sbjct  317  AQQAAGLVRAWEGERIHEDSGSDDLELTL  345



>ref|XP_003563774.1| PREDICTED: protein BZR1 homolog 3 [Brachypodium distachyon]
Length=355

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 65/93 (70%), Gaps = 9/93 (10%)
 Frame = -1

Query  549  NPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMG--  379
            NPFG FKE L++  SR+ TPGQSGTCSP +  A     DV M+D    +FAFGS++ G  
Sbjct  261  NPFGIFKEALAST-SRVCTPGQSGTCSPVMGGAPTHH-DVQMADGATDDFAFGSSSNGNN  318

Query  378  ----IVKPWEGERIHEECITDDLELTLGNSNTR  292
                +VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  319  ESPGLVKAWEGERIHEECASDELELTLGSSMTR  351



>gb|EMT21245.1| hypothetical protein F775_32777 [Aegilops tauschii]
Length=335

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 63/96 (66%), Gaps = 11/96 (11%)
 Frame = -1

Query  549  NPFG-FKEPLSNGGS-RMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA---  385
            NPF  FKE +  GGS RM TPGQSGTCSP V   + R  DV M D +  EFAFGS+    
Sbjct  240  NPFSVFKEAIPGGGSSRMCTPGQSGTCSP-VIPGMARHPDVHMMDVVSDEFAFGSSTNGG  298

Query  384  -----MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                  G+V+ WEGERIHE+  +D+LELTLG+S TR
Sbjct  299  AQQATAGLVRAWEGERIHEDSGSDELELTLGSSRTR  334



>emb|CDM82126.1| unnamed protein product [Triticum aestivum]
Length=333

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 63/96 (66%), Gaps = 11/96 (11%)
 Frame = -1

Query  549  NPFG-FKEPLSNGGS-RMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA---  385
            NPF  FKE +  GGS RM TPGQSGTCSP V   + R  DV M D +  EFAFGS+    
Sbjct  238  NPFSVFKEAIPGGGSSRMCTPGQSGTCSP-VIPGMARHPDVHMMDVVSDEFAFGSSTNGG  296

Query  384  -----MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                  G+V+ WEGERIHE+  +D+LELTLG+S TR
Sbjct  297  AQQATAGLVRAWEGERIHEDSGSDELELTLGSSRTR  332



>gb|EEE54074.1| hypothetical protein OsJ_00786 [Oryza sativa Japonica Group]
Length=334

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 64/95 (67%), Gaps = 10/95 (11%)
 Frame = -1

Query  549  NPFG-FKEPL--SNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN---  388
            NPF  FK+ +   N  SRM TPGQSGTCSPA+   +    D+ M DA+  EFAFGS+   
Sbjct  238  NPFSVFKDAILVGNNSSRMCTPGQSGTCSPAIPG-MAPHPDIHMMDAVSDEFAFGSSTNG  296

Query  387  ---AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
               A G+V+ WEGERIHE+  +DDLELTLG+S TR
Sbjct  297  GHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRTR  331



>dbj|BAB33003.1| unknown protein [Oryza sativa Japonica Group]
Length=354

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 64/95 (67%), Gaps = 10/95 (11%)
 Frame = -1

Query  549  NPFG-FKEPL--SNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN---  388
            NPF  FK+ +   N  SRM TPGQSGTCSPA+   +    D+ M DA+  EFAFGS+   
Sbjct  258  NPFSVFKDAILVGNNSSRMCTPGQSGTCSPAIPG-MAPHPDIHMMDAVSDEFAFGSSTNG  316

Query  387  ---AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
               A G+V+ WEGERIHE+  +DDLELTLG+S TR
Sbjct  317  GHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRTR  351



>ref|NP_001042330.1| Os01g0203000 [Oryza sativa Japonica Group]
 sp|Q0JPT4.1|BZR2_ORYSJ RecName: Full=Protein BZR1 homolog 2; Short=OsBZR2; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 2 [Oryza sativa 
Japonica Group]
 dbj|BAF04244.1| Os01g0203000, partial [Oryza sativa Japonica Group]
Length=365

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 64/95 (67%), Gaps = 10/95 (11%)
 Frame = -1

Query  549  NPFG-FKEPL--SNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN---  388
            NPF  FK+ +   N  SRM TPGQSGTCSPA+   +    D+ M DA+  EFAFGS+   
Sbjct  269  NPFSVFKDAILVGNNSSRMCTPGQSGTCSPAIPG-MAPHPDIHMMDAVSDEFAFGSSTNG  327

Query  387  ---AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
               A G+V+ WEGERIHE+  +DDLELTLG+S TR
Sbjct  328  GHQAAGLVRAWEGERIHEDSGSDDLELTLGSSRTR  362



>ref|XP_010925590.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=337

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 62/94 (66%), Gaps = 9/94 (10%)
 Frame = -1

Query  549  NPFGF-KEPLSNGGS-RMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA---  385
            NPFGF KE ++ GGS R+  PGQSGTCSP +        DVPM D    EFAFGS +   
Sbjct  241  NPFGFFKEAMAGGGSSRVVRPGQSGTCSPVMPGGPGH-IDVPMPDGTSDEFAFGSGSNSN  299

Query  384  ---MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                G+VK WEGERIHEEC +D+L+LTLG+S  R
Sbjct  300  HPPAGLVKAWEGERIHEECGSDELDLTLGSSWAR  333



>ref|XP_009416433.1| PREDICTED: protein BZR1 homolog 3 [Musa acuminata subsp. malaccensis]
Length=337

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 58/92 (63%), Gaps = 10/92 (11%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN------  388
            NP  F +  S  GSRM TPGQSGTCSP          DV MSD    EF FGS+      
Sbjct  247  NPLVFYKEAS--GSRMLTPGQSGTCSPIPGG--HSHGDVQMSDGGSDEFEFGSSSNGTDT  302

Query  387  AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            A G+VKPWEGE IHEEC +D+L+LTLG+S TR
Sbjct  303  ATGLVKPWEGEMIHEECASDELDLTLGSSKTR  334



>ref|NP_001136786.1| BES transcription factor [Zea mays]
 gb|ACF82630.1| unknown [Zea mays]
 gb|ACG34754.1| brassinazole-resistant 1 protein [Zea mays]
 gb|ACR37890.1| unknown [Zea mays]
 gb|ADX60154.1| BES transcription factor [Zea mays]
 gb|ADX60163.1| MYBGA transcription factor, partial [Zea mays]
 gb|AFW86961.1| brassinazole-resistant 1 protein [Zea mays]
Length=355

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 65/96 (68%), Gaps = 11/96 (11%)
 Frame = -1

Query  552  PNPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAM--  382
            PNPFG FKE + +  SRM TPGQSGTCSP +  A     DV M+D    +FAFGS++   
Sbjct  258  PNPFGIFKETIVST-SRMCTPGQSGTCSPVMGGAPIHH-DVQMADGAPDDFAFGSSSNGN  315

Query  381  ----GIVKPWEGERIHEECITD--DLELTLGNSNTR  292
                G+VK WEGERIHEEC +D  +LELTLG+S TR
Sbjct  316  NESPGLVKAWEGERIHEECASDEHELELTLGSSKTR  351



>ref|XP_003565213.1| PREDICTED: protein BZR1 homolog 2 [Brachypodium distachyon]
Length=355

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 63/96 (66%), Gaps = 11/96 (11%)
 Frame = -1

Query  549  NPFG-FKEPLSNGGS---RMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN--  388
            NPF  FKE +   GS   RM TPGQSGTCSP V   + R  DV M D +  EFAFGS+  
Sbjct  260  NPFSVFKEAIPVPGSNSSRMCTPGQSGTCSP-VIPGMARHPDVHMMDVVSDEFAFGSSSN  318

Query  387  ----AMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
                A G+V+ WEGERIHE+  +D+LELTLG+S TR
Sbjct  319  DAQQAPGLVRAWEGERIHEDSGSDELELTLGSSRTR  354



>ref|XP_004965584.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Setaria italica]
Length=356

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 65/96 (68%), Gaps = 11/96 (11%)
 Frame = -1

Query  552  PNPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMG-  379
            PNPFG FKE +++  SRM TPGQSGTCSP V   +    DV M D    +FAFGS++ G 
Sbjct  259  PNPFGIFKETVAST-SRMCTPGQSGTCSP-VMGGVPIHHDVQMVDGTPDDFAFGSSSNGN  316

Query  378  -----IVKPWEGERIHEECITD--DLELTLGNSNTR  292
                 +VK WEGERIHEEC +D  +LELTLG+S TR
Sbjct  317  NQSPGLVKAWEGERIHEECASDEHELELTLGSSKTR  352



>ref|XP_002437132.1| hypothetical protein SORBIDRAFT_10g021750 [Sorghum bicolor]
 gb|EER88499.1| hypothetical protein SORBIDRAFT_10g021750 [Sorghum bicolor]
Length=356

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 65/96 (68%), Gaps = 11/96 (11%)
 Frame = -1

Query  552  PNPFG-FKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMG-  379
            PNPFG FKE +++  SRM TPGQSGTCSP V   +    DV M D    +FAFGS++ G 
Sbjct  259  PNPFGIFKETIAST-SRMCTPGQSGTCSP-VMGGVPIHHDVQMVDGAPDDFAFGSSSNGN  316

Query  378  -----IVKPWEGERIHEECITD--DLELTLGNSNTR  292
                 +VK WEGERIHEEC +D  +LELTLG+S TR
Sbjct  317  NESPGLVKAWEGERIHEECASDEHELELTLGSSKTR  352



>ref|NP_001132634.1| uncharacterized protein LOC100194109 [Zea mays]
 gb|ACF81562.1| unknown [Zea mays]
 gb|ACG40609.1| brassinazole-resistant 1 protein [Zea mays]
Length=345

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 60/91 (66%), Gaps = 12/91 (13%)
 Frame = -1

Query  549  NPFG-FKEPLSNGGS----RMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN-  388
            NPFG FKE +  GG     RM TPGQSG CSPA+   + R +DV M D +  EFAFGS+ 
Sbjct  254  NPFGVFKESIPVGGGDSSMRMCTPGQSGACSPAIPG-MPRHSDVHMMDVVSDEFAFGSST  312

Query  387  -----AMGIVKPWEGERIHEECITDDLELTL  310
                 A G+V+ WEGERIHE+  +DDLELTL
Sbjct  313  NGAQQAAGLVRAWEGERIHEDSGSDDLELTL  343



>gb|ACG41016.1| brassinazole-resistant 1 protein [Zea mays]
Length=346

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 60/92 (65%), Gaps = 13/92 (14%)
 Frame = -1

Query  549  NPFG-FKEPLSNGGS-----RMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSN  388
            NPFG FKE +  GG      RM TPGQSG CSPA+   + R +DV M D +  EFAFGS+
Sbjct  254  NPFGVFKESIPVGGGGDSSMRMCTPGQSGACSPAIPG-MPRHSDVHMMDVVSDEFAFGSS  312

Query  387  ------AMGIVKPWEGERIHEECITDDLELTL  310
                  A G+V+ WEGERIHE+  +DDLELTL
Sbjct  313  TNGAQQAAGLVRAWEGERIHEDSGSDDLELTL  344



>dbj|BAJ97997.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91390.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=357

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 57/95 (60%), Gaps = 12/95 (13%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMS--DAIQAEFAFGSNAM--  382
            NPFG     S   SR  TPGQSGTCSP +        DV M   D    +FAFGSN+   
Sbjct  261  NPFGIALASS---SRACTPGQSGTCSPVMGDHPPVHHDVQMEMVDGAADDFAFGSNSNDN  317

Query  381  -----GIVKPWEGERIHEECITDDLELTLGNSNTR  292
                 G+VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  318  NGSPPGLVKAWEGERIHEECASDELELTLGSSRTR  352



>ref|XP_003571150.2| PREDICTED: protein BZR1 homolog 3-like [Brachypodium distachyon]
Length=378

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 56/87 (64%), Gaps = 9/87 (10%)
 Frame = -1

Query  516  GGSRMWTPGQSGTCSPAVAAA-LDRSADVPMSDAIQAE-FAFGSNAM-------GIVKPW  364
            G SRM+TPGQSG CSP V  A L    D  M+D   AE FAFG+          G++K W
Sbjct  289  GSSRMYTPGQSGACSPVVGGAGLVIRGDTHMADRAAAEDFAFGNGGGGGNGRVPGLLKAW  348

Query  363  EGERIHEECITDDLELTLGNSNTR*GV  283
            EGERIHEE  +D+LELTLGNS+TR G 
Sbjct  349  EGERIHEESASDELELTLGNSSTRAGA  375



>emb|CBI30731.3| unnamed protein product [Vitis vinifera]
Length=169

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -1

Query  549  NPFGFKEP-LSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGS  391
            NPFGFKE  L+ GGSRMWTPGQSGTCSPAVAA  D +ADVPM+D I A+   G+
Sbjct  97   NPFGFKEEVLAGGGSRMWTPGQSGTCSPAVAAGSDHTADVPMADGIAADSPLGA  150



>gb|EMT29878.1| hypothetical protein F775_52316 [Aegilops tauschii]
Length=355

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 59/94 (63%), Gaps = 11/94 (12%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMS--DAIQAEFAFGSNAM--  382
            NPFG     S   SR+ TPGQSGTCSPA+        DV M   +    +FAFGSN+   
Sbjct  260  NPFGIALASS---SRVCTPGQSGTCSPAMGDHAPAHHDVQMEMVEGAADDFAFGSNSNGN  316

Query  381  ----GIVKPWEGERIHEECITDDLELTLGNSNTR  292
                G+VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  317  NGSPGLVKAWEGERIHEECASDELELTLGSSRTR  350



>emb|CDY00299.1| BnaA06g22000D [Brassica napus]
Length=224

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 51/73 (70%), Gaps = 11/73 (15%)
 Frame = -1

Query  549  NPFGFKE-----PLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQ--AEFAFGS  391
            NPFGF+E         GGSRMWTPGQSGTCSPA+     ++ DVPMS+A+    EFAFGS
Sbjct  113  NPFGFREDQLASAGGGGGSRMWTPGQSGTCSPAIT----QTGDVPMSEAVAPPPEFAFGS  168

Query  390  NAMGIVKPWEGER  352
            NA G+ K WEGER
Sbjct  169  NANGLAKAWEGER  181



>gb|EMS63049.1| hypothetical protein TRIUR3_11319 [Triticum urartu]
Length=544

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 58/94 (62%), Gaps = 11/94 (12%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVA--AALDRSADVPMSDAIQAEFAFGSNAM--  382
            NPFG     S   SR  TPGQSGTCSP +   A       + M+D    +FAFGSN+   
Sbjct  449  NPFGIALASS---SRACTPGQSGTCSPVMGDHAPAHHDVQMEMADGAPDDFAFGSNSNGN  505

Query  381  ----GIVKPWEGERIHEECITDDLELTLGNSNTR  292
                G+VK WEGERIHEEC +D+LELTLG+S TR
Sbjct  506  NGSPGLVKAWEGERIHEECASDELELTLGSSRTR  539



>sp|Q6EUF1.2|BZR4_ORYSJ RecName: Full=Protein BZR1 homolog 4; Short=OsBZR4; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 4 [Oryza sativa 
Japonica Group]
Length=351

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 44/68 (65%), Gaps = 9/68 (13%)
 Frame = -1

Query  486  SGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA---MGIVKPWEGERIHEECITDDLEL  316
            SG CSP          DV M+DA + EFAFG       G+VK WEGERIHEEC +DDLEL
Sbjct  287  SGACSPVAGG------DVQMADAARREFAFGGEGGKMTGLVKAWEGERIHEECGSDDLEL  340

Query  315  TLGNSNTR  292
            TLG+S TR
Sbjct  341  TLGSSMTR  348



>ref|NP_001172869.1| Os02g0233200 [Oryza sativa Japonica Group]
 dbj|BAD27718.1| putative mature anther-specific protein LAT61 [Oryza sativa Japonica 
Group]
 dbj|BAH91598.1| Os02g0233200 [Oryza sativa Japonica Group]
Length=376

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 44/68 (65%), Gaps = 9/68 (13%)
 Frame = -1

Query  486  SGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA---MGIVKPWEGERIHEECITDDLEL  316
            SG CSP          DV M+DA + EFAFG       G+VK WEGERIHEEC +DDLEL
Sbjct  312  SGACSPVAGG------DVQMADAARREFAFGGEGGKMTGLVKAWEGERIHEECGSDDLEL  365

Query  315  TLGNSNTR  292
            TLG+S TR
Sbjct  366  TLGSSMTR  373



>gb|EAY85121.1| hypothetical protein OsI_06471 [Oryza sativa Indica Group]
Length=377

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 44/68 (65%), Gaps = 9/68 (13%)
 Frame = -1

Query  486  SGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNA---MGIVKPWEGERIHEECITDDLEL  316
            SG CSP          DV M+DA + EFAFG       G+VK WEGERIHEEC +DDLEL
Sbjct  313  SGACSPVAGG------DVQMADAARREFAFGGEGGKMTGLVKAWEGERIHEECGSDDLEL  366

Query  315  TLGNSNTR  292
            TLG+S TR
Sbjct  367  TLGSSMTR  374



>ref|XP_006833072.1| hypothetical protein AMTR_s00170p00061300 [Amborella trichopoda]
 gb|ERM98350.1| hypothetical protein AMTR_s00170p00061300 [Amborella trichopoda]
Length=293

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 51/86 (59%), Gaps = 20/86 (23%)
 Frame = -1

Query  549  NPFGFKEPLSNGGSRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVK  370
            NPFG           +W P  SGTCSP        S DV M +A   EFAFG     +VK
Sbjct  226  NPFG----------GLWAPAGSGTCSPCNV----ESGDVRMVEA-SDEFAFG-----VVK  265

Query  369  PWEGERIHEECITDDLELTLGNSNTR  292
            PW+GE+IH+EC +DDLELTLG+S TR
Sbjct  266  PWQGEKIHDECGSDDLELTLGSSRTR  291



>gb|EAZ22344.1| hypothetical protein OsJ_05997 [Oryza sativa Japonica Group]
Length=246

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 39/54 (72%), Gaps = 3/54 (6%)
 Frame = -1

Query  444  SADVPMSDAIQAEFAFGSNA---MGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            S   PM+DA + EFAFG       G+VK WEGERIHEEC +DDLELTLG+S TR
Sbjct  190  SISAPMADAARREFAFGGEGGKMTGLVKAWEGERIHEECGSDDLELTLGSSMTR  243



>gb|ABK21940.1| unknown [Picea sitchensis]
Length=367

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 50/80 (63%), Gaps = 10/80 (13%)
 Frame = -1

Query  525  LSNGGSRMWTPGQSGTCSPAVAAALDRSADVP-MSDAIQA--EFAFGSNAMGIVKPWEGE  355
            L+  G R+WTPGQSG  SP    A +    +P   + + A  EFAFGS A   VKPW+GE
Sbjct  270  LATEGGRLWTPGQSGVSSPCNNRAGEEERLLPPFQEGMDASDEFAFGSVA---VKPWQGE  326

Query  354  RIHEEC----ITDDLELTLG  307
            RIHEEC     +DDLELTLG
Sbjct  327  RIHEECGGEIGSDDLELTLG  346



>gb|ABR18463.1| unknown [Picea sitchensis]
Length=407

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 45/79 (57%), Gaps = 12/79 (15%)
 Frame = -1

Query  510  SRMWTPGQSGTCSPAVAAALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEEC--  337
            SR+WTP  S   SP    A    A V ++ A + +F  GS     VKPW+GERIHEEC  
Sbjct  323  SRLWTPVGSAMSSPCRTPATG-GAVVRVAAADEFQFECGS-----VKPWQGERIHEECGG  376

Query  336  ----ITDDLELTLGNSNTR  292
                 +DDLELTLG+S  R
Sbjct  377  DMDIASDDLELTLGSSKRR  395



>ref|XP_002510347.1| BRASSINAZOLE-RESISTANT 1 protein, putative [Ricinus communis]
 gb|EEF52534.1| BRASSINAZOLE-RESISTANT 1 protein, putative [Ricinus communis]
Length=321

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = -1

Query  444  SADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            S++V   +    EF FG N  G VKPWEGERIHE  + DDLELTLGN   R
Sbjct  272  SSNVIKENGRSMEFEFG-NGNGQVKPWEGERIHEVGL-DDLELTLGNGKAR  320



>ref|XP_011074507.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1 isoform X2 [Sesamum 
indicum]
Length=328

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 35/57 (61%), Gaps = 4/57 (7%)
 Frame = -1

Query  462  AAALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             A L  S D P+      EF F + A   VKPWEGERIHE  + DDLELTLG+ NTR
Sbjct  275  VAQLVPSKDAPVDKGKGTEFDFENMA---VKPWEGERIHEVGM-DDLELTLGSGNTR  327



>ref|XP_011074506.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1 isoform X1 [Sesamum 
indicum]
Length=329

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 35/57 (61%), Gaps = 4/57 (7%)
 Frame = -1

Query  462  AAALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
             A L  S D P+      EF F + A   VKPWEGERIHE  + DDLELTLG+ NTR
Sbjct  276  VAQLVPSKDAPVDKGKGTEFDFENMA---VKPWEGERIHEVGM-DDLELTLGSGNTR  328



>gb|EYU45114.1| hypothetical protein MIMGU_mgv1a009718mg [Erythranthe guttata]
Length=333

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = -1

Query  456  ALDRSADVPMSDAIQAEFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            A  +S D  MSD  + +  F   +M  VKPW+GE+IHE  + DDLELTLGN N R
Sbjct  281  AAAKSKDAIMSDKGKGKELFDFESMA-VKPWQGEKIHEMGV-DDLELTLGNGNNR  333



>ref|XP_011083731.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1 [Sesamum indicum]
Length=324

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 10/55 (18%)
 Frame = -1

Query  438  DVPMSDAIQA------EFAFGSNAMGIVKPWEGERIHEECITDDLELTLGNSNTR  292
            +VP  DAI +      EF F + A   VKPWEGERIHE  + DDLELTLG+ NTR
Sbjct  274  EVPPKDAIMSDKGKGTEFDFENMA---VKPWEGERIHEVGM-DDLELTLGSGNTR  324



>gb|EPS60905.1| hypothetical protein M569_13896, partial [Genlisea aurea]
Length=325

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -1

Query  471  PAVAAALDRSADVPM------SDAIQAEFAFGSNAMGI-VKPWEGERIHEECITDDLELT  313
            P     L  S+  PM      S     EF   +N+  + VKPWEGERIH+  + DDLELT
Sbjct  259  PMARVVLPSSSQEPMAIDNDSSKGKGKEFELDNNSSDLAVKPWEGERIHDVGM-DDLELT  317

Query  312  LGNSNTR  292
            LGN NTR
Sbjct  318  LGNGNTR  324



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760