BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF047P16

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFX67027.1|  phospholipase D                                         211   3e-66   Solanum tuberosum [potatoes]
ref|XP_004158777.1|  PREDICTED: phospholipase D alpha 1-like            212   2e-65   
gb|AGH68505.1|  phospholipase D1 alpha                                  205   4e-64   Ipomoea batatas [batate]
gb|ACL54277.1|  unknown                                                 211   1e-63   Zea mays [maize]
emb|CBI36315.3|  unnamed protein product                                203   4e-63   Vitis vinifera
gb|AFK36876.1|  unknown                                                 204   2e-62   Lotus japonicus
emb|CAI53943.1|  phospholipase D                                        203   2e-62   Triticum turgidum subsp. durum
ref|XP_011078373.1|  PREDICTED: phospholipase D alpha 1-like            216   3e-62   Sesamum indicum [beniseed]
ref|XP_010325101.1|  PREDICTED: phospholipase D alpha 1-like isof...    214   7e-62   Solanum lycopersicum
gb|KCW70693.1|  hypothetical protein EUGRSUZ_F03862                     214   7e-62   Eucalyptus grandis [rose gum]
ref|XP_010063458.1|  PREDICTED: phospholipase D alpha 1                 215   8e-62   Eucalyptus grandis [rose gum]
ref|XP_010250112.1|  PREDICTED: phospholipase D alpha 1                 214   9e-62   
ref|XP_004303313.1|  PREDICTED: phospholipase D alpha 1                 214   1e-61   Fragaria vesca subsp. vesca
ref|XP_010325100.1|  PREDICTED: phospholipase D alpha 1-like isof...    214   1e-61   Solanum lycopersicum
ref|NP_001289824.1|  uncharacterized protein LOC101257989               214   1e-61   
emb|CAH58644.1|  phospholipase D                                        202   2e-61   Plantago major [cart-track plant]
ref|XP_008360327.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    212   6e-61   Malus domestica [apple tree]
gb|AAW83125.1|  phospholipase D alpha                                   211   1e-60   Fragaria x ananassa
gb|AIR77173.1|  phospholipase D                                         204   2e-60   Dendrobium hybrid cultivar
gb|ABB82551.1|  phospholipase D-alpha                                   211   2e-60   Cucumis melo var. inodorus [casaba melon]
ref|XP_006367508.1|  PREDICTED: phospholipase D alpha 1-like isof...    211   2e-60   Solanum tuberosum [potatoes]
ref|XP_008461111.1|  PREDICTED: phospholipase D alpha 1                 211   2e-60   
gb|ABN13537.2|  phospholipase D                                         211   2e-60   Cucumis sativus [cucumbers]
ref|XP_007023174.1|  Phospholipase D alpha 2 isoform 1                  211   3e-60   
ref|XP_004135845.1|  PREDICTED: phospholipase D alpha 1-like            211   3e-60   
ref|XP_008654846.1|  PREDICTED: phospholipase D family protein is...    210   4e-60   Zea mays [maize]
ref|NP_001146559.1|  phospholipase D family protein                     209   4e-60   Zea mays [maize]
gb|ADP23922.1|  phospholipase D alpha                                   210   4e-60   Litchi chinensis [litchi]
emb|CBI28204.3|  unnamed protein product                                209   5e-60   Vitis vinifera
ref|XP_009613360.1|  PREDICTED: phospholipase D alpha 1-like            209   9e-60   Nicotiana tomentosiformis
emb|CDY20149.1|  BnaA01g28530D                                          196   1e-59   Brassica napus [oilseed rape]
ref|XP_010254401.1|  PREDICTED: phospholipase D alpha 1-like            209   1e-59   Nelumbo nucifera [Indian lotus]
ref|XP_009365415.1|  PREDICTED: phospholipase D alpha 1-like            208   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_010656428.1|  PREDICTED: phospholipase D alpha 1-like            208   1e-59   Vitis vinifera
ref|XP_009799916.1|  PREDICTED: phospholipase D alpha 1                 208   1e-59   Nicotiana sylvestris
ref|XP_009348321.1|  PREDICTED: phospholipase D alpha 1                 208   1e-59   Pyrus x bretschneideri [bai li]
ref|NP_001105686.1|  phospholipase D alpha 1                            208   2e-59   Zea mays [maize]
gb|ACR35730.1|  unknown                                                 208   2e-59   Zea mays [maize]
ref|XP_008673445.1|  PREDICTED: phospholipase D alpha 1 isoform X1      208   2e-59   Zea mays [maize]
gb|ACL53693.1|  unknown                                                 208   2e-59   Zea mays [maize]
gb|ACL53520.1|  unknown                                                 207   2e-59   Zea mays [maize]
ref|XP_010487411.1|  PREDICTED: phospholipase D alpha 1 isoform X1      205   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_008673447.1|  PREDICTED: phospholipase D alpha 1 isoform X2      207   3e-59   
ref|XP_009625689.1|  PREDICTED: phospholipase D alpha 1                 207   3e-59   Nicotiana tomentosiformis
sp|P93400.2|PLDA1_TOBAC  RecName: Full=Phospholipase D alpha 1; S...    207   3e-59   Nicotiana tabacum [American tobacco]
ref|XP_006367510.1|  PREDICTED: phospholipase D alpha 1-like            207   3e-59   Solanum tuberosum [potatoes]
ref|XP_009760786.1|  PREDICTED: phospholipase D alpha 1-like            207   4e-59   Nicotiana sylvestris
sp|Q41142.1|PLDA1_RICCO  RecName: Full=Phospholipase D alpha 1; S...    207   5e-59   Ricinus communis
gb|AAB37305.1|  phospholipase D                                         207   5e-59   Ricinus communis
dbj|BAJ88431.1|  predicted protein                                      204   5e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002517625.1|  phopholipase d alpha, putative                     207   6e-59   
emb|CDP10414.1|  unnamed protein product                                207   6e-59   Coffea canephora [robusta coffee]
gb|AAL16110.1|AF428278_1  AT3g15730/MSJ11_13                            203   7e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008373955.1|  PREDICTED: phospholipase D alpha 1                 206   7e-59   
ref|XP_009381115.1|  PREDICTED: phospholipase D alpha 1                 206   8e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADY75750.1|  phospholipase D alpha                                   206   8e-59   Dimocarpus longan [longan]
ref|NP_001267764.1|  phospholipase D alpha 1-like                       206   8e-59   Setaria italica
ref|XP_006387081.1|  hypothetical protein POPTR_1923s00200g             194   9e-59   
gb|ACG63795.1|  phospholipase D alpha                                   206   1e-58   Gossypium raimondii
ref|XP_006406921.1|  hypothetical protein EUTSA_v10020083mg             204   2e-58   
gb|ABY50100.1|  phospholipase D                                         202   2e-58   Agropyron mongolicum
ref|XP_011073436.1|  PREDICTED: phospholipase D alpha 1                 205   2e-58   Sesamum indicum [beniseed]
gb|KJB70612.1|  hypothetical protein B456_011G083000                    205   2e-58   Gossypium raimondii
emb|CAN76339.1|  hypothetical protein VITISV_014670                     205   3e-58   Vitis vinifera
gb|ADA72022.1|  phospholipase D                                         205   3e-58   Jatropha curcas
gb|KHG06123.1|  Phospholipase D alpha 1                                 204   3e-58   Gossypium arboreum [tree cotton]
gb|ACG63794.1|  phospholipase D alpha                                   204   3e-58   Gossypium arboreum [tree cotton]
gb|ABK24520.1|  unknown                                                 200   3e-58   Picea sitchensis
ref|XP_010503392.1|  PREDICTED: phospholipase D alpha 1-like            204   3e-58   Camelina sativa [gold-of-pleasure]
gb|ACV70146.1|  phospholipase D                                         204   4e-58   Gossypium arboreum [tree cotton]
ref|XP_010465563.1|  PREDICTED: phospholipase D alpha 1-like            204   4e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010487412.1|  PREDICTED: phospholipase D alpha 1 isoform X2      204   4e-58   Camelina sativa [gold-of-pleasure]
ref|NP_001234102.1|  phospholipase PLDa1                                204   4e-58   
ref|XP_006406922.1|  hypothetical protein EUTSA_v10020083mg             204   4e-58   
ref|XP_011008452.1|  PREDICTED: phospholipase D alpha 1-like            204   5e-58   Populus euphratica
ref|XP_010322318.1|  PREDICTED: phospholipase PLDa1 isoform X1          204   5e-58   Solanum lycopersicum
emb|CBI28205.3|  unnamed protein product                                202   6e-58   Vitis vinifera
gb|AGW22212.1|  phospholipase D alpha                                   204   6e-58   Chorispora bungeana
ref|XP_010545768.1|  PREDICTED: phospholipase D alpha 1                 204   7e-58   Tarenaya hassleriana [spider flower]
ref|XP_009408983.1|  PREDICTED: phospholipase D alpha 1-like            204   8e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007217042.1|  hypothetical protein PRUPE_ppa001519mg             203   8e-58   Prunus persica
ref|XP_008243731.1|  PREDICTED: phospholipase D alpha 1                 203   9e-58   Prunus mume [ume]
gb|ACG80607.1|  phospholipase D alpha                                   203   9e-58   Prunus persica
ref|XP_004506968.1|  PREDICTED: phospholipase D alpha 1-like            203   9e-58   
dbj|BAA11136.1|  phospholipase D                                        203   1e-57   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042153.1|  Os01g0172400                                       203   1e-57   
gb|EEC70024.1|  hypothetical protein OsI_00588                          203   1e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_006356207.1|  PREDICTED: phospholipase D alpha 1-like isof...    202   2e-57   Solanum tuberosum [potatoes]
ref|NP_188194.1|  phospholipase D alpha 1                               202   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008454241.1|  PREDICTED: phospholipase D alpha 1                 202   2e-57   Cucumis melo [Oriental melon]
ref|XP_002882959.1|  PLDALPHA1                                          202   2e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_004287315.1|  PREDICTED: phospholipase D alpha 1-like            202   2e-57   Fragaria vesca subsp. vesca
emb|CDO98145.1|  unnamed protein product                                202   2e-57   Coffea canephora [robusta coffee]
ref|XP_006297003.1|  hypothetical protein CARUB_v10012996mg             202   2e-57   Capsella rubella
ref|XP_002443625.1|  hypothetical protein SORBIDRAFT_08g022520          202   2e-57   Sorghum bicolor [broomcorn]
ref|NP_001275827.1|  phospholipase D alpha                              202   2e-57   Citrus sinensis [apfelsine]
gb|KDO48580.1|  hypothetical protein CISIN_1g004579mg                   202   2e-57   Citrus sinensis [apfelsine]
ref|XP_006427267.1|  hypothetical protein CICLE_v10024917mg             202   3e-57   Citrus clementina [clementine]
ref|XP_006465340.1|  PREDICTED: phospholipase D alpha 1                 202   3e-57   Citrus sinensis [apfelsine]
ref|NP_001267897.1|  phospholipase D alpha                              202   3e-57   Vitis vinifera
ref|XP_009787005.1|  PREDICTED: phospholipase D alpha 1-like isof...    202   3e-57   Nicotiana sylvestris
gb|AES86616.2|  phospholipase D alpha 1                                 202   3e-57   Medicago truncatula
ref|XP_009787006.1|  PREDICTED: phospholipase D alpha 1-like isof...    201   3e-57   Nicotiana sylvestris
gb|AGN71005.1|  phospholipase D1                                        202   4e-57   Brassica napus [oilseed rape]
gb|EMT03624.1|  Phospholipase D alpha 1                                 201   4e-57   
ref|XP_003569355.1|  PREDICTED: phospholipase D alpha 1                 201   5e-57   Brachypodium distachyon [annual false brome]
gb|KHN01336.1|  Phospholipase D alpha 1                                 201   5e-57   Glycine soja [wild soybean]
ref|XP_003528334.1|  PREDICTED: phospholipase D alpha 1-like isof...    201   6e-57   
ref|XP_006385316.1|  phospholipase D family protein                     201   6e-57   
ref|XP_002282187.3|  PREDICTED: phospholipase D alpha 1-like            201   6e-57   Vitis vinifera
ref|XP_003531710.1|  PREDICTED: phospholipase D alpha 1-like isof...    201   6e-57   
gb|ABX83202.2|  phospholipase D                                         201   6e-57   Lolium temulentum
emb|CDM81985.1|  unnamed protein product                                201   6e-57   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003597894.1|  Phospholipase D alpha                              201   6e-57   Medicago truncatula
gb|KHN47766.1|  Phospholipase D alpha 1                                 201   7e-57   Glycine soja [wild soybean]
ref|XP_007013459.1|  Phospholipase D alpha 1                            201   7e-57   
ref|XP_010097235.1|  Phospholipase D alpha 1                            201   1e-56   Morus notabilis
ref|XP_006643814.1|  PREDICTED: phospholipase D alpha 1-like            200   1e-56   Oryza brachyantha
sp|O04883.1|PLDA1_PIMBR  RecName: Full=Phospholipase D alpha 1; S...    200   1e-56   Spuriopimpinella brachycarpa
gb|KJB68102.1|  hypothetical protein B456_010G225600                    200   1e-56   Gossypium raimondii
ref|XP_006842069.1|  hypothetical protein AMTR_s00078p00051300          200   1e-56   Amborella trichopoda
gb|AAL48262.2|AF451980_1  phospholipase D2                              200   1e-56   Papaver somniferum
ref|XP_004152203.1|  PREDICTED: phospholipase D alpha 1-like            200   2e-56   Cucumis sativus [cucumbers]
ref|XP_004156800.1|  PREDICTED: phospholipase D alpha 1-like            200   2e-56   
gb|AAP03643.1|  phopholipase D                                          197   2e-56   Mirabilis jalapa
ref|XP_009364028.1|  PREDICTED: phospholipase D alpha 1-like            200   2e-56   Pyrus x bretschneideri [bai li]
ref|XP_006392903.1|  hypothetical protein EUTSA_v10011246mg             200   2e-56   Eutrema salsugineum [saltwater cress]
ref|XP_007135745.1|  hypothetical protein PHAVU_010G155000g             199   2e-56   Phaseolus vulgaris [French bean]
ref|XP_011012164.1|  PREDICTED: phospholipase D alpha 1                 199   2e-56   Populus euphratica
ref|XP_009123823.1|  PREDICTED: phospholipase D alpha 2-like            199   3e-56   Brassica rapa
emb|CDY47540.1|  BnaC03g69220D                                          199   3e-56   Brassica napus [oilseed rape]
ref|XP_002299756.1|  phospholipase D family protein                     199   4e-56   Populus trichocarpa [western balsam poplar]
sp|O82549.1|PLDA1_BRAOC  RecName: Full=Phospholipase D alpha 1; S...    198   5e-56   Brassica oleracea var. capitata
ref|XP_009619857.1|  PREDICTED: phospholipase D alpha 1                 198   6e-56   
ref|XP_008792036.1|  PREDICTED: phospholipase D alpha 1                 198   7e-56   Phoenix dactylifera
sp|O04865.1|PLDA1_VIGUN  RecName: Full=Phospholipase D alpha 1; S...    198   8e-56   Vigna unguiculata
gb|AGV22363.1|  phospholipase D3                                        198   8e-56   Brassica napus [oilseed rape]
ref|XP_008367859.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    195   9e-56   
ref|XP_003543677.1|  PREDICTED: phospholipase D alpha 1-like isof...    197   1e-55   Glycine max [soybeans]
gb|AGN71006.1|  phospholipase D2                                        197   1e-55   Brassica napus [oilseed rape]
emb|CDY60551.1|  BnaA05g35700D                                          197   1e-55   Brassica napus [oilseed rape]
emb|CAB43063.1|  phospholipase D1                                       197   1e-55   Craterostigma plantagineum
sp|P86387.1|PLDA1_CARPA  RecName: Full=Phospholipase D alpha 1; S...    197   1e-55   Carica papaya [mamon]
emb|CDY21865.1|  BnaC01g35830D                                          197   1e-55   Brassica napus [oilseed rape]
gb|AAL48261.2|AF451979_1  phospholipase D1                              197   2e-55   Papaver somniferum
ref|XP_002524502.1|  phopholipase d alpha, putative                     196   2e-55   
gb|AHN53202.1|  phospholipase D alpha 1-like protein                    197   2e-55   Cocos nucifera
gb|EPS65578.1|  hypothetical protein M569_09194                         197   2e-55   Genlisea aurea
ref|XP_010925209.1|  PREDICTED: phospholipase D alpha 1-like            196   2e-55   Elaeis guineensis
ref|XP_009368855.1|  PREDICTED: phospholipase D alpha 1-like            196   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_004486668.1|  PREDICTED: phospholipase D alpha 1-like isof...    196   2e-55   
ref|XP_009144830.1|  PREDICTED: phospholipase D alpha 2                 196   3e-55   Brassica rapa
ref|XP_010479770.1|  PREDICTED: phospholipase D alpha 2-like            196   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002894388.1|  predicted protein                                  196   3e-55   Arabidopsis lyrata subsp. lyrata
gb|AIE90138.1|  phospholipase D1                                        196   3e-55   Brassica napus [oilseed rape]
ref|XP_010500864.1|  PREDICTED: phospholipase D alpha 2-like isof...    196   3e-55   Camelina sativa [gold-of-pleasure]
emb|CDX97705.1|  BnaA05g23740D                                          196   3e-55   
ref|NP_175666.1|  phospholipase D alpha 2                               196   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306783.1|  hypothetical protein CARUB_v10008323mg             196   3e-55   
ref|XP_010462102.1|  PREDICTED: phospholipase D alpha 2                 196   3e-55   Camelina sativa [gold-of-pleasure]
ref|NP_001234863.1|  phospholipase PLDa2                                196   3e-55   
ref|XP_009146200.1|  PREDICTED: phospholipase D alpha 1                 196   3e-55   Brassica rapa
ref|XP_010500868.1|  PREDICTED: phospholipase D alpha 2-like isof...    196   4e-55   Camelina sativa [gold-of-pleasure]
sp|P55939.2|PLDA2_BRAOC  RecName: Full=Phospholipase D alpha 2; S...    196   4e-55   Brassica oleracea var. capitata
ref|XP_010090252.1|  Phospholipase D alpha 1                            196   4e-55   
gb|AGV22364.1|  phospholipase D4                                        196   4e-55   Brassica napus [oilseed rape]
ref|XP_009115281.1|  PREDICTED: phospholipase D alpha 2                 196   4e-55   Brassica rapa
ref|XP_010907269.1|  PREDICTED: phospholipase D alpha 1                 196   5e-55   Elaeis guineensis
gb|AAC49274.1|  phospholipase D                                         196   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805616.1|  PREDICTED: phospholipase D alpha 1-like            195   7e-55   Phoenix dactylifera
ref|XP_008385550.1|  PREDICTED: phospholipase D alpha 1-like            194   1e-54   
ref|XP_007150746.1|  hypothetical protein PHAVU_005G177300g             194   1e-54   Phaseolus vulgaris [French bean]
ref|XP_010691149.1|  PREDICTED: phospholipase D alpha 1-like            194   2e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010695892.1|  PREDICTED: phospholipase D alpha 1-like            181   4e-54   
ref|XP_011081358.1|  PREDICTED: phospholipase D alpha 1                 193   4e-54   Sesamum indicum [beniseed]
ref|XP_002325225.2|  hypothetical protein POPTR_0018s13110g             193   4e-54   Populus trichocarpa [western balsam poplar]
dbj|BAE79735.1|  phospholipase D alpha 2                                193   5e-54   Arachis hypogaea [goober]
gb|KHN22450.1|  Phospholipase D alpha 1                                 191   5e-54   Glycine soja [wild soybean]
ref|XP_010687988.1|  PREDICTED: phospholipase D alpha 1-like            192   6e-54   
gb|EYU21635.1|  hypothetical protein MIMGU_mgv1a001489mg                192   7e-54   Erythranthe guttata [common monkey flower]
gb|ABU54776.1|  phospholipase D alpha 1 precursor                       192   1e-53   Helianthus annuus
ref|XP_008242775.1|  PREDICTED: phospholipase D alpha 1-like            192   1e-53   Prunus mume [ume]
ref|XP_006364210.1|  PREDICTED: phospholipase D alpha 1-like isof...    191   2e-53   Solanum tuberosum [potatoes]
ref|XP_008777837.1|  PREDICTED: phospholipase D alpha 1-like            191   2e-53   Phoenix dactylifera
ref|XP_006364211.1|  PREDICTED: phospholipase D alpha 1-like isof...    191   3e-53   
dbj|BAJ93878.1|  predicted protein                                      191   3e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004235964.1|  PREDICTED: phospholipase D alpha 1                 191   3e-53   Solanum lycopersicum
ref|XP_007204652.1|  hypothetical protein PRUPE_ppa001528mg             190   4e-53   Prunus persica
ref|XP_003568837.1|  PREDICTED: phospholipase D alpha 1-like            190   4e-53   
ref|XP_006654096.1|  PREDICTED: phospholipase D alpha 1-like            190   7e-53   Oryza brachyantha
sp|Q70EW5.2|PLDA1_CYNCA  RecName: Full=Phospholipase D alpha 1; S...    189   7e-53   Cynara cardunculus [cardoon]
ref|XP_010669918.1|  PREDICTED: phospholipase D alpha 1-like            176   8e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007150745.1|  hypothetical protein PHAVU_005G177200g             189   1e-52   Phaseolus vulgaris [French bean]
gb|KDP33597.1|  hypothetical protein JCGZ_07168                         179   1e-52   Jatropha curcas
ref|XP_002308663.2|  hypothetical protein POPTR_0006s27000g             188   2e-52   
ref|XP_009407292.1|  PREDICTED: phospholipase D alpha 1-like            189   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU23016.1|  hypothetical protein MIMGU_mgv1a001487mg                188   2e-52   Erythranthe guttata [common monkey flower]
gb|AAU44332.1|  hypothetical protein                                    188   2e-52   Oryza sativa Japonica Group [Japonica rice]
emb|CAB43062.1|  phospholipase D2                                       188   3e-52   Craterostigma plantagineum
gb|EMT24153.1|  Phospholipase D alpha 1                                 188   4e-52   
ref|XP_011017763.1|  PREDICTED: phospholipase D alpha 1-like            187   4e-52   Populus euphratica
ref|XP_008650412.1|  PREDICTED: phospholipase D alpha 1-like            185   3e-51   
ref|XP_008649399.1|  PREDICTED: phospholipase D alpha 1-like            184   5e-51   Zea mays [maize]
ref|XP_011039694.1|  PREDICTED: phospholipase D alpha 1-like            184   6e-51   Populus euphratica
gb|AFW77332.1|  phospholipase D family protein                          184   1e-50   
dbj|BAJ85695.1|  predicted protein                                      183   2e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94103.1|  predicted protein                                      183   2e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP32412.1|  hypothetical protein JCGZ_13337                         182   3e-50   Jatropha curcas
ref|XP_008219493.1|  PREDICTED: phospholipase D alpha 1-like            182   5e-50   Prunus mume [ume]
ref|XP_003563661.1|  PREDICTED: phospholipase D alpha 2-like            182   5e-50   Brachypodium distachyon [annual false brome]
ref|XP_006645546.1|  PREDICTED: phospholipase D alpha 1-like            169   7e-50   Oryza brachyantha
gb|EMS46811.1|  Phospholipase D alpha 2                                 181   8e-50   Triticum urartu
ref|XP_010923204.1|  PREDICTED: phospholipase D alpha 1-like            181   9e-50   Elaeis guineensis
gb|KJB55001.1|  hypothetical protein B456_009G057800                    181   1e-49   Gossypium raimondii
gb|EYU24646.1|  hypothetical protein MIMGU_mgv1a001477mg                181   1e-49   Erythranthe guttata [common monkey flower]
ref|XP_008394090.1|  PREDICTED: phospholipase D alpha 1-like isof...    181   1e-49   
ref|XP_009758055.1|  PREDICTED: phospholipase D alpha 1-like            180   2e-49   Nicotiana sylvestris
ref|XP_007225238.1|  hypothetical protein PRUPE_ppa001818mg             180   2e-49   
gb|KDP33596.1|  hypothetical protein JCGZ_07167                         179   6e-49   Jatropha curcas
gb|EMT32202.1|  Phospholipase D alpha 2                                 179   6e-49   
ref|XP_006350007.1|  PREDICTED: phospholipase D alpha 1-like            179   7e-49   Solanum tuberosum [potatoes]
ref|XP_006656220.1|  PREDICTED: phospholipase D alpha 2-like            178   1e-48   Oryza brachyantha
gb|EMT15739.1|  Phospholipase D alpha 2                                 175   6e-48   
ref|XP_009355736.1|  PREDICTED: phospholipase D alpha 1-like            176   8e-48   
gb|EEC80931.1|  hypothetical protein OsI_23625                          175   9e-48   Oryza sativa Indica Group [Indian rice]
ref|NP_001058017.1|  Os06g0604400                                       175   1e-47   
ref|XP_004251821.1|  PREDICTED: phospholipase D alpha 1-like            175   1e-47   Solanum lycopersicum
ref|XP_011070230.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    175   1e-47   Sesamum indicum [beniseed]
gb|AFW87187.1|  phospholipase D family protein                          173   3e-47   
ref|NP_001146242.1|  uncharacterized protein LOC100279815               174   4e-47   Zea mays [maize]
ref|XP_002515518.1|  phopholipase d alpha, putative                     173   8e-47   Ricinus communis
ref|XP_010101275.1|  Phospholipase D alpha 1                            172   1e-46   
ref|XP_002972515.1|  hypothetical protein SELMODRAFT_441825             172   1e-46   Selaginella moellendorffii
gb|KGN62948.1|  hypothetical protein Csa_2G381740                       172   2e-46   Cucumis sativus [cucumbers]
ref|XP_004138856.1|  PREDICTED: phospholipase D alpha 2-like            172   2e-46   
ref|XP_008445210.1|  PREDICTED: phospholipase D alpha 1-like            172   2e-46   Cucumis melo [Oriental melon]
ref|XP_009614730.1|  PREDICTED: phospholipase D alpha 1 {ECO:0000...    172   2e-46   Nicotiana tomentosiformis
ref|XP_009401723.1|  PREDICTED: phospholipase D alpha 1-like isof...    171   2e-46   
ref|XP_009401714.1|  PREDICTED: phospholipase D alpha 1-like isof...    172   2e-46   
ref|XP_004160794.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    171   3e-46   
ref|XP_004965943.1|  PREDICTED: phospholipase D alpha 2-like            171   3e-46   Setaria italica
gb|EPS60466.1|  hypothetical protein M569_14336                         170   5e-46   Genlisea aurea
ref|XP_001762942.1|  predicted protein                                  171   5e-46   
ref|XP_002437251.1|  hypothetical protein SORBIDRAFT_10g023630          170   9e-46   Sorghum bicolor [broomcorn]
ref|XP_002992572.1|  hypothetical protein SELMODRAFT_186850             169   1e-45   Selaginella moellendorffii
emb|CBI21040.3|  unnamed protein product                                169   1e-45   Vitis vinifera
dbj|BAA19466.1|  phospholipase D                                        169   1e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657112.1|  PREDICTED: phospholipase D alpha 2-like            169   2e-45   
gb|EPS71739.1|  hypothetical protein M569_03019                         168   3e-45   Genlisea aurea
ref|XP_010648662.1|  PREDICTED: phospholipase D alpha 1-like            169   3e-45   Vitis vinifera
ref|XP_002967619.1|  hypothetical protein SELMODRAFT_231070             167   8e-45   Selaginella moellendorffii
ref|XP_002964421.1|  hypothetical protein SELMODRAFT_82084              167   9e-45   Selaginella moellendorffii
gb|AAF78755.1|AF271357_1  phospholipase D                               167   1e-44   Oryza sativa Indica Group [Indian rice]
ref|NP_001058016.1|  Os06g0604300                                       167   1e-44   
ref|XP_006450437.1|  hypothetical protein CICLE_v10010712mg             167   1e-44   
gb|KDO61728.1|  hypothetical protein CISIN_1g003523mg                   167   1e-44   Citrus sinensis [apfelsine]
ref|XP_006483709.1|  PREDICTED: phospholipase D alpha 1-like            167   2e-44   Citrus sinensis [apfelsine]
gb|EYU32345.1|  hypothetical protein MIMGU_mgv1a001383mg                166   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_006657113.1|  PREDICTED: phospholipase D alpha 2-like            166   2e-44   Oryza brachyantha
ref|XP_010103106.1|  hypothetical protein L484_000222                   154   2e-44   
gb|KJB07745.1|  hypothetical protein B456_001G042400                    156   3e-44   Gossypium raimondii
ref|XP_010696306.1|  PREDICTED: phospholipase D alpha 1-like            165   8e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW82853.1|  hypothetical protein EUGRSUZ_C04222                     164   9e-44   Eucalyptus grandis [rose gum]
ref|XP_010050012.1|  PREDICTED: phospholipase D alpha 1-like            164   9e-44   
ref|XP_006656219.1|  PREDICTED: phospholipase D alpha 2-like            162   1e-42   Oryza brachyantha
gb|AAF78754.1|AF271356_1  phospholipase D                               161   1e-42   Oryza sativa Indica Group [Indian rice]
ref|NP_001058015.1|  Os06g0604200                                       161   1e-42   
gb|EEE65980.1|  hypothetical protein OsJ_21904                          149   3e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011459180.1|  PREDICTED: phospholipase D alpha 1-like            160   4e-42   Fragaria vesca subsp. vesca
ref|XP_007011869.1|  Phospholipase D alpha 2 isoform 2                  159   5e-42   
emb|CDP13512.1|  unnamed protein product                                160   5e-42   Coffea canephora [robusta coffee]
ref|XP_007011868.1|  Phospholipase D alpha 2 isoform 1                  159   6e-42   
emb|CDP13510.1|  unnamed protein product                                159   1e-41   Coffea canephora [robusta coffee]
ref|XP_002451299.1|  hypothetical protein SORBIDRAFT_05g027210          158   2e-41   Sorghum bicolor [broomcorn]
ref|XP_010048204.1|  PREDICTED: phospholipase D alpha 1-like            157   4e-41   Eucalyptus grandis [rose gum]
ref|XP_004501331.1|  PREDICTED: phospholipase D alpha 1-like isof...    157   4e-41   Cicer arietinum [garbanzo]
ref|XP_004501330.1|  PREDICTED: phospholipase D alpha 1-like isof...    157   5e-41   Cicer arietinum [garbanzo]
ref|XP_007011867.1|  Phospholipase D alpha 1                            157   6e-41   
dbj|BAE79734.1|  phospholipase D alpha 1                                156   1e-40   Arachis hypogaea [goober]
tpg|DAA53240.1|  TPA: phospholipase D family protein                    146   5e-40   
ref|XP_004501328.1|  PREDICTED: phospholipase D alpha 1-like isof...    154   5e-40   
ref|XP_007137028.1|  hypothetical protein PHAVU_009G093500g             154   6e-40   
ref|XP_001767482.1|  predicted protein                                  154   6e-40   
ref|XP_010541603.1|  PREDICTED: phospholipase D zeta                    153   1e-39   
gb|AAP50498.1|  phospholipase D                                         152   2e-39   
ref|XP_002963233.1|  hypothetical protein SELMODRAFT_165923             152   2e-39   
ref|XP_002974536.1|  hypothetical protein SELMODRAFT_267774             152   2e-39   
emb|CDY70643.1|  BnaAnng34490D                                          144   3e-39   
gb|EMT22155.1|  Phospholipase D alpha 2                                 151   4e-39   
ref|XP_003603407.1|  Phospholipase D alpha                              151   6e-39   
ref|XP_010228187.1|  PREDICTED: phospholipase D delta-like isofor...    148   1e-38   
ref|XP_009776941.1|  PREDICTED: phospholipase D delta-like              150   2e-38   
ref|XP_008378989.1|  PREDICTED: phospholipase D gamma 1-like            140   8e-38   
gb|EMS68435.1|  Phospholipase D alpha 2                                 148   9e-38   
ref|XP_003557320.1|  PREDICTED: phospholipase D delta-like isofor...    148   9e-38   
gb|KJB07619.1|  hypothetical protein B456_001G0333002                   148   1e-37   
ref|XP_009601452.1|  PREDICTED: phospholipase D beta 1-like             141   1e-37   
ref|XP_009803791.1|  PREDICTED: phospholipase D beta 1-like             141   1e-37   
ref|XP_004984142.1|  PREDICTED: phospholipase D alpha 1-like isof...    147   1e-37   
ref|XP_010266062.1|  PREDICTED: phospholipase D delta-like              147   1e-37   
ref|XP_004984144.1|  PREDICTED: phospholipase D alpha 1-like isof...    147   1e-37   
ref|XP_004984141.1|  PREDICTED: phospholipase D alpha 1-like isof...    147   1e-37   
ref|XP_004984143.1|  PREDICTED: phospholipase D alpha 1-like isof...    147   1e-37   
emb|CDX88175.1|  BnaA06g27660D                                          147   1e-37   
ref|XP_003603842.1|  Phospholipase D delta                              147   1e-37   
gb|EMS68436.1|  Phospholipase D alpha 2                                 147   1e-37   
ref|XP_009151064.1|  PREDICTED: phospholipase D zeta                    147   2e-37   
ref|XP_008348966.1|  PREDICTED: phospholipase D delta-like              137   2e-37   
ref|XP_010100114.1|  Phospholipase D delta                              145   2e-37   
ref|XP_011034954.1|  PREDICTED: phospholipase D delta-like              147   2e-37   
emb|CAN71413.1|  hypothetical protein VITISV_029215                     145   2e-37   
gb|EMT22156.1|  Phospholipase D alpha 2                                 146   2e-37   
ref|XP_007137026.1|  hypothetical protein PHAVU_009G093400g             146   3e-37   
ref|XP_009620056.1|  PREDICTED: phospholipase D delta-like              146   3e-37   
ref|XP_009796632.1|  PREDICTED: phospholipase D delta-like              146   3e-37   
dbj|BAK05685.1|  predicted protein                                      146   3e-37   
ref|XP_007137027.1|  hypothetical protein PHAVU_009G093400g             146   4e-37   
ref|XP_003603403.1|  Phospholipase D alpha                              146   4e-37   
ref|XP_006858490.1|  hypothetical protein AMTR_s00071p00126030          146   5e-37   
ref|XP_004956882.1|  PREDICTED: phospholipase D delta-like isofor...    144   5e-37   
ref|XP_010068094.1|  PREDICTED: phospholipase D delta-like              138   7e-37   
gb|AFK40898.1|  unknown                                                 138   7e-37   
ref|XP_002301946.1|  hypothetical protein POPTR_0002s01750g             145   7e-37   
ref|XP_006341816.1|  PREDICTED: phospholipase D delta-like isofor...    145   7e-37   
emb|CDX80505.1|  BnaC07g29390D                                          145   8e-37   
ref|XP_006341817.1|  PREDICTED: phospholipase D delta-like isofor...    145   8e-37   
ref|XP_008670093.1|  PREDICTED: phospholipase D delta-like isofor...    143   8e-37   
gb|KHN33827.1|  Phospholipase D delta                                   144   9e-37   
gb|AFK37886.1|  unknown                                                 137   1e-36   
emb|CBI29771.3|  unnamed protein product                                145   1e-36   
ref|XP_006394787.1|  hypothetical protein EUTSA_v10003665mg             144   1e-36   
ref|XP_002266693.2|  PREDICTED: phospholipase D delta-like isofor...    145   1e-36   
ref|XP_008802877.1|  PREDICTED: phospholipase D delta-like              145   1e-36   
ref|XP_010683033.1|  PREDICTED: phospholipase D delta                   145   1e-36   
ref|XP_010658068.1|  PREDICTED: phospholipase D delta-like isofor...    145   1e-36   
ref|XP_006394788.1|  hypothetical protein EUTSA_v10003659mg             144   1e-36   
ref|XP_004500903.1|  PREDICTED: phospholipase D delta-like isofor...    144   2e-36   
dbj|BAK02630.1|  predicted protein                                      144   2e-36   
ref|XP_008221197.1|  PREDICTED: phospholipase D delta-like              144   2e-36   
ref|XP_006387106.1|  hypothetical protein POPTR_1837s00200g             138   2e-36   
ref|XP_010424312.1|  PREDICTED: phospholipase D zeta-like               144   2e-36   
ref|XP_003523254.1|  PREDICTED: phospholipase D delta-like              144   2e-36   
ref|XP_002461794.1|  hypothetical protein SORBIDRAFT_02g008130          144   3e-36   
ref|XP_004979743.1|  PREDICTED: phospholipase D alpha 2-like            144   3e-36   
ref|XP_009600603.1|  PREDICTED: phospholipase D delta-like              144   3e-36   
ref|XP_009129965.1|  PREDICTED: phospholipase D zeta-like               144   3e-36   
ref|XP_010493792.1|  PREDICTED: phospholipase D zeta                    144   3e-36   
gb|EMT19808.1|  Phospholipase D alpha 2                                 144   3e-36   
ref|XP_009410696.1|  PREDICTED: phospholipase D delta-like              144   3e-36   
gb|AAN40512.1|  phospholipase D beta 1 isoform 1b-2                     141   4e-36   
ref|XP_009602808.1|  PREDICTED: phospholipase D delta-like              143   4e-36   
ref|XP_001753756.1|  predicted protein                                  143   4e-36   
ref|XP_004956880.1|  PREDICTED: phospholipase D delta-like isofor...    143   4e-36   
gb|AAC49656.2|  phospholipase D                                         143   6e-36   
ref|XP_010454864.1|  PREDICTED: phospholipase D zeta-like               143   6e-36   
gb|KDO38449.1|  hypothetical protein CISIN_1g002960mg                   140   6e-36   
ref|XP_004300745.1|  PREDICTED: phospholipase D gamma 2-like            134   7e-36   
ref|XP_010520828.1|  PREDICTED: phospholipase D delta-like              142   7e-36   
ref|XP_010244833.1|  PREDICTED: phospholipase D delta-like isofor...    143   7e-36   
ref|XP_010244830.1|  PREDICTED: phospholipase D delta-like isofor...    143   7e-36   
ref|XP_006435265.1|  hypothetical protein CICLE_v10000269mg             142   7e-36   
ref|XP_010244835.1|  PREDICTED: phospholipase D delta-like isofor...    142   7e-36   
emb|CDY05490.1|  BnaA02g32010D                                          142   7e-36   
ref|XP_010244834.1|  PREDICTED: phospholipase D delta-like isofor...    142   8e-36   
gb|AAB63542.2|  phospholipase D                                         142   8e-36   
ref|XP_008670089.1|  PREDICTED: phospholipase D delta-like isofor...    142   8e-36   
ref|XP_009768465.1|  PREDICTED: phospholipase D delta-like              142   9e-36   
ref|XP_008440879.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    142   9e-36   
ref|XP_002872960.1|  PLDBETA2                                           142   1e-35   
gb|KHN07080.1|  Phospholipase D alpha 1                                 142   1e-35   
ref|XP_004238395.1|  PREDICTED: phospholipase D delta-like              142   1e-35   
ref|XP_004158899.1|  PREDICTED: phospholipase D delta-like              140   1e-35   
ref|XP_004248600.1|  PREDICTED: phospholipase D delta-like              142   1e-35   
gb|AAL78825.1|AF414566_2  phospholipase D nu-2                          137   1e-35   
gb|KCW56571.1|  hypothetical protein EUGRSUZ_I02303                     142   1e-35   
ref|XP_010517711.1|  PREDICTED: phospholipase D beta 1-like             142   1e-35   
ref|XP_006581357.1|  PREDICTED: phospholipase D alpha 1-like            142   1e-35   
ref|NP_197919.1|  phospholipase D alpha 3                               142   1e-35   
ref|XP_007227049.1|  hypothetical protein PRUPE_ppa001322mg             142   1e-35   
ref|XP_006384991.1|  putative phospholipase D beta 1 family protein     132   2e-35   
emb|CDY05351.1|  BnaC02g40590D                                          141   2e-35   
ref|NP_192921.1|  phospholipase D gamma 3                               142   2e-35   
gb|EMS67798.1|  Phospholipase D alpha 2                                 140   2e-35   
ref|XP_010029629.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    141   2e-35   
ref|XP_010508627.1|  PREDICTED: phospholipase D beta 1 isoform X1       142   2e-35   
ref|XP_009623492.1|  PREDICTED: phospholipase D delta-like              141   2e-35   
ref|XP_006425355.1|  hypothetical protein CICLE_v10024876mg             141   2e-35   
ref|XP_010508631.1|  PREDICTED: phospholipase D beta 1 isoform X2       142   2e-35   
gb|EPS66999.1|  hypothetical protein M569_07777                         139   2e-35   
ref|XP_007159571.1|  hypothetical protein PHAVU_002G2487001g            132   2e-35   
emb|CDY13283.1|  BnaC09g23730D                                          137   2e-35   
emb|CDP08909.1|  unnamed protein product                                142   3e-35   
ref|XP_001773645.1|  predicted protein                                  141   3e-35   
emb|CDX90066.1|  BnaA10g00160D                                          141   3e-35   
ref|NP_565963.2|  phospholipase D beta 1                                142   3e-35   
gb|AAD43343.1|AF159139_1  phospholipase D                               141   3e-35   
ref|XP_002881817.1|  phospholipase D beta 1                             141   3e-35   
gb|KDO43538.1|  hypothetical protein CISIN_1g0454781mg                  133   3e-35   
ref|XP_009119747.1|  PREDICTED: phospholipase D beta 1                  141   4e-35   
emb|CDY15144.1|  BnaC05g00230D                                          141   4e-35   
ref|XP_010228542.1|  PREDICTED: phospholipase D alpha 1-like isof...    140   4e-35   
ref|XP_010228543.1|  PREDICTED: phospholipase D alpha 1-like isof...    140   4e-35   
ref|XP_006418468.1|  hypothetical protein EUTSA_v10006647mg             141   4e-35   
gb|KCW62953.1|  hypothetical protein EUGRSUZ_G00554                     140   4e-35   
ref|NP_001051849.1|  Os03g0840800                                       138   4e-35   
ref|XP_004292929.1|  PREDICTED: phospholipase D delta-like              140   4e-35   
ref|XP_008218590.1|  PREDICTED: phospholipase D delta-like              140   4e-35   
ref|XP_004134840.1|  PREDICTED: phospholipase D delta-like              140   4e-35   
ref|XP_008232842.1|  PREDICTED: phospholipase D beta 1                  141   4e-35   
ref|XP_010506009.1|  PREDICTED: phospholipase D beta 1 isoform X1       140   5e-35   
ref|XP_010113283.1|  Phospholipase D delta                              140   5e-35   
gb|KHN35993.1|  Phospholipase D delta                                   140   5e-35   
gb|KDO38440.1|  hypothetical protein CISIN_1g002960mg                   140   5e-35   
ref|XP_011099892.1|  PREDICTED: phospholipase D delta                   140   5e-35   
ref|XP_010065450.1|  PREDICTED: phospholipase D delta-like              140   6e-35   
gb|EYU26173.1|  hypothetical protein MIMGU_mgv1a0015421mg               134   6e-35   
ref|XP_006467032.1|  PREDICTED: phospholipase D delta-like              140   6e-35   
ref|XP_006581358.1|  PREDICTED: phospholipase D alpha 1-like            140   6e-35   
ref|XP_011074721.1|  PREDICTED: phospholipase D delta-like              140   6e-35   
gb|KHN06490.1|  Phospholipase D delta                                   140   6e-35   
gb|KDO43387.1|  hypothetical protein CISIN_1g0011261mg                  137   6e-35   
gb|KDO43386.1|  hypothetical protein CISIN_1g0011261mg                  137   7e-35   
gb|KDO43385.1|  hypothetical protein CISIN_1g0011261mg                  137   7e-35   
ref|XP_003524234.1|  PREDICTED: phospholipase D delta-like isofor...    140   7e-35   
gb|KCW62820.1|  hypothetical protein EUGRSUZ_G00410                     138   7e-35   
ref|XP_011463800.1|  PREDICTED: uncharacterized protein LOC101313411    141   7e-35   
ref|XP_003516537.1|  PREDICTED: phospholipase D delta-like isofor...    140   8e-35   
ref|XP_008357632.1|  PREDICTED: phospholipase D delta-like              139   8e-35   
ref|XP_011003096.1|  PREDICTED: phospholipase D delta-like              139   9e-35   
ref|XP_007136128.1|  hypothetical protein PHAVU_009G020200g             139   9e-35   
ref|XP_006295936.1|  hypothetical protein CARUB_v10025073mg             140   9e-35   
gb|KJB41192.1|  hypothetical protein B456_007G094300                    140   9e-35   
ref|XP_010279438.1|  PREDICTED: phospholipase D beta 1-like             137   9e-35   
gb|KJB41196.1|  hypothetical protein B456_007G094300                    140   1e-34   
ref|XP_006349430.1|  PREDICTED: phospholipase D delta-like              139   1e-34   
gb|ADM21349.1|  phospholipase D                                         139   1e-34   
gb|AAN05431.1|  phospholipase D beta 1 isoform 1b                       140   1e-34   
ref|XP_011463799.1|  PREDICTED: phospholipase D gamma 1-like            139   1e-34   
ref|XP_006857964.1|  hypothetical protein AMTR_s00069p00174350          139   1e-34   
ref|XP_010272594.1|  PREDICTED: phospholipase D beta 1-like             139   1e-34   
gb|KHN41861.1|  Phospholipase D delta                                   138   1e-34   
ref|XP_010272588.1|  PREDICTED: phospholipase D gamma 1-like            139   2e-34   
ref|XP_009355262.1|  PREDICTED: phospholipase D delta-like              139   2e-34   
ref|XP_010315479.1|  PREDICTED: phospholipase D delta-like              139   2e-34   
ref|XP_007040091.1|  Phospholipase D beta 1                             139   2e-34   
ref|XP_007218907.1|  hypothetical protein PRUPE_ppa000580mg             139   2e-34   
ref|XP_010523062.1|  PREDICTED: phospholipase D beta 1                  139   2e-34   
ref|XP_007157859.1|  hypothetical protein PHAVU_002G104200g             139   2e-34   
pir||T01547  probable phospholipase D (EC 3.1.4.4) A_IG005I10.13 ...    139   2e-34
gb|KJB17560.1|  hypothetical protein B456_003G005500                    139   2e-34   
gb|KJB17559.1|  hypothetical protein B456_003G005500                    139   2e-34   
ref|XP_006590738.1|  PREDICTED: phospholipase D delta-like              139   2e-34   
ref|XP_002874727.1|  PLDGAMMA1                                          139   2e-34   
ref|XP_001753255.1|  predicted protein                                  138   2e-34   
ref|XP_004298731.1|  PREDICTED: phospholipase D beta 1-like             138   2e-34   
ref|XP_003623811.1|  Phospholipase D                                    139   2e-34   
gb|AAT77001.1|  phospholipase D                                         138   2e-34   
gb|AER41636.1|  phospholipase+D                                         138   2e-34   
ref|XP_008448951.1|  PREDICTED: phospholipase D beta 1-like             138   2e-34   
ref|XP_009594604.1|  PREDICTED: phospholipase D delta isoform X2        138   2e-34   
ref|XP_011463801.1|  PREDICTED: phospholipase D beta 1-like             138   3e-34   
emb|CBI34767.3|  unnamed protein product                                138   3e-34   
gb|KHG21987.1|  Phospholipase D delta -like protein                     138   3e-34   
ref|XP_002275783.1|  PREDICTED: phospholipase D beta 1-like             138   3e-34   
ref|NP_567160.1|  phospholipase D beta 2                                138   3e-34   
ref|XP_007211141.1|  hypothetical protein PRUPE_ppa026639mg             138   3e-34   
ref|XP_007017919.1|  Phospholipase D isoform 1                          138   3e-34   
gb|AAN05433.1|  phospholipase D delta isoform 1a                        138   3e-34   
ref|XP_002874728.1|  PLDGAMMA1                                          138   3e-34   
ref|XP_009337116.1|  PREDICTED: phospholipase D delta-like              136   3e-34   
ref|XP_009594603.1|  PREDICTED: phospholipase D delta isoform X1        138   3e-34   
ref|XP_010692336.1|  PREDICTED: phospholipase D gamma 1                 138   4e-34   
ref|XP_008673230.1|  PREDICTED: phospholipase D family protein is...    138   4e-34   
ref|XP_008445312.1|  PREDICTED: phospholipase D delta-like              138   4e-34   
gb|KHN04601.1|  Phospholipase D beta 1                                  138   4e-34   
ref|XP_003529972.1|  PREDICTED: phospholipase D beta 1-like             138   4e-34   
ref|NP_001234108.1|  phospholipase PLDb2                                138   4e-34   
ref|XP_008673211.1|  PREDICTED: phospholipase D family protein is...    138   4e-34   
tpg|DAA45665.1|  TPA: phospholipase D family protein                    137   4e-34   
gb|EYU30820.1|  hypothetical protein MIMGU_mgv1a001201mg                138   4e-34   
gb|AES95217.2|  phospholipase D alpha 1                                 138   4e-34   
ref|XP_002874254.1|  predicted protein                                  137   4e-34   
emb|CDP07339.1|  unnamed protein product                                135   4e-34   
ref|XP_009334534.1|  PREDICTED: phospholipase D delta-like              137   5e-34   
gb|EPS67301.1|  hypothetical protein M569_07474                         138   5e-34   
ref|XP_008238759.1|  PREDICTED: phospholipase D beta 1-like             137   5e-34   
emb|CDP09827.1|  unnamed protein product                                137   5e-34   
gb|KCW77623.1|  hypothetical protein EUGRSUZ_D01933                     137   5e-34   
gb|AAF78756.1|AF271358_1  phospholipase D                               137   5e-34   
ref|XP_002511773.1|  phospholipase d beta, putative                     138   5e-34   
ref|XP_002510602.1|  phospholipase d delta, putative                    137   5e-34   
gb|KHG08188.1|  Phospholipase D beta 1 -like protein                    137   5e-34   
ref|XP_003612259.1|  Phospholipase D delta isoform                      138   5e-34   
gb|KDP28706.1|  hypothetical protein JCGZ_14477                         138   5e-34   
ref|XP_011461950.1|  PREDICTED: phospholipase D delta-like              137   6e-34   
gb|EEC76498.1|  hypothetical protein OsI_14257                          137   6e-34   
gb|AER41566.1|  phospholipase+D                                         137   6e-34   
ref|XP_010053353.1|  PREDICTED: phospholipase D beta 1-like             137   6e-34   
ref|XP_006396841.1|  hypothetical protein EUTSA_v10028438mg             137   6e-34   
ref|XP_008387895.1|  PREDICTED: phospholipase D delta-like              137   7e-34   



>gb|AFX67027.1| phospholipase D, partial [Solanum tuberosum]
Length=153

 Score =   211 bits (536),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP HL  ++PARGQVHGFRMALWYEHLGMLDN F QPES+E
Sbjct  22   INQRSMDGARDSEIAMGAYQPFHLCVKEPARGQVHGFRMALWYEHLGMLDNSFLQPESVE  81

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I +  W++YS E+L  D+P HLL+YPIG+TENG+VT +PG + FPDTKAPVLG
Sbjct  82   CIRKVNKIGDKYWDMYSSESLIHDLPGHLLTYPIGITENGEVTGIPGVECFPDTKAPVLG  141

Query  155  TKSNF  141
            TKSNF
Sbjct  142  TKSNF  146



>ref|XP_004158777.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
Length=238

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLSA +PARGQVHGFRMALWYEHLGMLD  F +PES E
Sbjct  107  INQRSMDGARDSEIAMGAYQPYHLSAHEPARGQVHGFRMALWYEHLGMLDETFLRPESEE  166

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W++YS E+LERD+P HLL YPIG+T  G+VTELPGF+ FPDTKA +LG
Sbjct  167  CVAKVNRIADKYWDMYSSESLERDLPGHLLRYPIGITSEGEVTELPGFECFPDTKARILG  226

Query  155  TKSNF  141
            TKS++
Sbjct  227  TKSDY  231



>gb|AGH68505.1| phospholipase D1 alpha, partial [Ipomoea batatas]
Length=146

 Score =   205 bits (522),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRS DGARDSEIAMGAYQP+HL+ R+PARGQVHGFRM+LWYEHLGMLD  F  PES E
Sbjct  15   INQRSTDGARDSEIAMGAYQPYHLAGREPARGQVHGFRMSLWYEHLGMLDEAFQHPESEE  74

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN IA+  W+LYS E+LERD+P HLL YPIG++ +G VTELPGF+ FPDT+A VLG
Sbjct  75   CIRKVNDIADKYWDLYSSESLERDLPGHLLRYPIGISSDGDVTELPGFEFFPDTRARVLG  134

Query  155  TKSNF  141
            TKS++
Sbjct  135  TKSDY  139



>gb|ACL54277.1| unknown [Zea mays]
Length=357

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGMLD+ F +PES+E
Sbjct  226  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLDDVFQRPESVE  285

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IAE  W+LYS + LE+D+P HLLSYPIGVT +G VTELPG +NFPDT+A VLG
Sbjct  286  CVQKVNKIAEKYWDLYSSDDLEQDLPGHLLSYPIGVTADGTVTELPGMENFPDTRARVLG  345

Query  155  TKSNF  141
             KS++
Sbjct  346  NKSDY  350



>emb|CBI36315.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   203 bits (516),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL++RQPARGQ+HGFRM+LWYEHLGMLD  F QPES E
Sbjct  23   INQRSMDGARDSEIAMGGYQPYHLASRQPARGQIHGFRMSLWYEHLGMLDESFLQPESKE  82

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIAE  W+LY+ ETLE D+P HLL YPI V+  G +TELPG + FPDTKA VLG
Sbjct  83   CIQKVNQIAEKYWDLYASETLEHDLPGHLLRYPIAVSCGGDITELPGAEFFPDTKARVLG  142

Query  155  TKSNF  141
            TKS +
Sbjct  143  TKSEY  147



>gb|AFK36876.1| unknown [Lotus japonicus]
Length=238

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ARQPARGQ+HGFRM+LWYEHLGMLD+ F  PE+ E
Sbjct  107  INQRSMDGARDSEIAMGAYQPYHLAARQPARGQIHGFRMSLWYEHLGMLDDSFNNPENEE  166

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIA+  W+LYS E+LE D+P HLL YPIGV+  G VTELPGF+ FPDTKA VLG
Sbjct  167  CVRKVNQIADKYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGFEFFPDTKARVLG  226

Query  155  TKSNF  141
             K+++
Sbjct  227  GKADY  231



>emb|CAI53943.1| phospholipase D [Triticum turgidum subsp. durum]
Length=221

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ R+PARGQ+HGFRMALWYEHLGMLD+ F +PES+E
Sbjct  90   INQRSMDGARDSEIAMGAYQPYHLANREPARGQIHGFRMALWYEHLGMLDDVFQRPESVE  149

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IAE  W++YS + LE+D+P HLLSYPIGV  +G VTELPG + FPDT+A +LG
Sbjct  150  CVQKVNRIAEKYWDIYSSDDLEQDLPGHLLSYPIGVASDGVVTELPGMEFFPDTRARILG  209

Query  155  TKSNF  141
             KS++
Sbjct  210  AKSDY  214



>ref|XP_011078373.1| PREDICTED: phospholipase D alpha 1-like [Sesamum indicum]
Length=808

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS +QPARGQ+HGFRMALWYEH+GMLDNCF  PE +E
Sbjct  677  INQRSMDGARDSEIAMGAYQPYHLSCKQPARGQIHGFRMALWYEHMGMLDNCFCHPERLE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIAE NW+LY+ E LERD+P HLLSYPIGV+ +G VTELPG +NFPDTKA VLG
Sbjct  737  CIQKVNQIAETNWDLYTREVLERDLPGHLLSYPIGVSSDGTVTELPGTENFPDTKARVLG  796

Query  155  TKSNF  141
            + + F
Sbjct  797  SVAEF  801



>ref|XP_010325101.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum lycopersicum]
Length=723

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP HL A++PARGQVHGFRMALWYEHLGMLDN F QPES+E
Sbjct  592  INQRSMDGARDSEIAMGAYQPFHLYAKEPARGQVHGFRMALWYEHLGMLDNSFLQPESVE  651

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I +  W++YS E+L  D+P HLL+YPIG+TENG+VTE+PG + FPDTKAP+LG
Sbjct  652  CIRKVNKIGDKYWDMYSSESLVHDLPGHLLTYPIGITENGEVTEIPGVECFPDTKAPILG  711

Query  155  TKSNF  141
            TKSNF
Sbjct  712  TKSNF  716



>gb|KCW70693.1| hypothetical protein EUGRSUZ_F03862 [Eucalyptus grandis]
Length=773

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQ HHL+ R+PARGQ+HGFRMALWYEHLGMLD+ F QPE  E
Sbjct  642  INQRSMDGARDSEIAMGAYQAHHLATREPARGQIHGFRMALWYEHLGMLDDSFLQPEGEE  701

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ +VNQIAE  W+LYS ETLERD+P HLL YP+GV  +G +TELPGF++FPDTKAP+LG
Sbjct  702  CIRRVNQIAEKYWDLYSSETLERDLPGHLLRYPVGVASDGVITELPGFEHFPDTKAPILG  761

Query  155  TKSNF  141
            TKS++
Sbjct  762  TKSDY  766



>ref|XP_010063458.1| PREDICTED: phospholipase D alpha 1 [Eucalyptus grandis]
Length=805

 Score =   215 bits (547),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQ HHL+ R+PARGQ+HGFRMALWYEHLGMLD+ F QPE  E
Sbjct  674  INQRSMDGARDSEIAMGAYQAHHLATREPARGQIHGFRMALWYEHLGMLDDSFLQPEGEE  733

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ +VNQIAE  W+LYS ETLERD+P HLL YP+GV  +G +TELPGF++FPDTKAP+LG
Sbjct  734  CIRRVNQIAEKYWDLYSSETLERDLPGHLLRYPVGVASDGVITELPGFEHFPDTKAPILG  793

Query  155  TKSNF  141
            TKS++
Sbjct  794  TKSDY  798



>ref|XP_010250112.1| PREDICTED: phospholipase D alpha 1 [Nelumbo nucifera]
Length=815

 Score =   214 bits (546),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRMALWYEHLGMLD+CF  PES+ 
Sbjct  684  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMALWYEHLGMLDDCFLHPESVA  743

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIA+  W+LYS ETL+RD+P HLL YPI VTENG+VTELPG Q+FPDT+A VLG
Sbjct  744  CVHKVNQIADKYWDLYSSETLDRDLPGHLLRYPIAVTENGEVTELPGTQHFPDTEALVLG  803

Query  155  TKSNF  141
            TK+ +
Sbjct  804  TKAEY  808



>ref|XP_004303313.1| PREDICTED: phospholipase D alpha 1 [Fragaria vesca subsp. vesca]
Length=810

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQPHHLS R+PARGQ+HGFRMALWYEHLGMLD  F QPES+E
Sbjct  679  INQRSMDGARDSEIAMGAYQPHHLSVREPARGQIHGFRMALWYEHLGMLDETFLQPESVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+  W+LYS ETLE D+P HLL YP+GVT  G+VTELPGF+ FPDTKA VLG
Sbjct  739  CIKKVNQIADKYWDLYSSETLEHDLPGHLLRYPVGVTSEGEVTELPGFEFFPDTKARVLG  798

Query  155  TKSNF  141
             +S++
Sbjct  799  ARSDY  803



>ref|XP_010325100.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum lycopersicum]
Length=807

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP HL A++PARGQVHGFRMALWYEHLGMLDN F QPES+E
Sbjct  676  INQRSMDGARDSEIAMGAYQPFHLYAKEPARGQVHGFRMALWYEHLGMLDNSFLQPESVE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I +  W++YS E+L  D+P HLL+YPIG+TENG+VTE+PG + FPDTKAP+LG
Sbjct  736  CIRKVNKIGDKYWDMYSSESLVHDLPGHLLTYPIGITENGEVTEIPGVECFPDTKAPILG  795

Query  155  TKSNF  141
            TKSNF
Sbjct  796  TKSNF  800



>ref|NP_001289824.1| uncharacterized protein LOC101257989 [Solanum lycopersicum]
 gb|AAG48162.1|AF154425_1 phospholipase D [Solanum lycopersicum]
Length=807

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP HL A++PARGQVHGFRMALWYEHLGMLDN F QPES+E
Sbjct  676  INQRSMDGARDSEIAMGAYQPFHLYAKEPARGQVHGFRMALWYEHLGMLDNSFLQPESVE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I +  W++YS E+L  D+P HLL+YPIG+TENG+VTE+PG + FPDTKAP+LG
Sbjct  736  CIRKVNKIGDKYWDMYSSESLVHDLPGHLLTYPIGITENGEVTEIPGVECFPDTKAPILG  795

Query  155  TKSNF  141
            TKSNF
Sbjct  796  TKSNF  800



>emb|CAH58644.1| phospholipase D [Plantago major]
Length=250

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ARQPARG +HGFRM+LWYEHLGMLD+ F +PES E
Sbjct  119  INQRSMDGARDSEIAMGAYQPYHLAARQPARGDIHGFRMSLWYEHLGMLDDSFVRPESEE  178

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN IA+  W+L++ E LERD+P HLL YP+ V+  G +TELPG + FPDTKA VLG
Sbjct  179  CVQKVNTIADRYWDLFAAEELERDLPGHLLRYPVAVSSEGTITELPGQEFFPDTKARVLG  238

Query  155  TKSNF  141
            TKS+F
Sbjct  239  TKSDF  243



>ref|XP_008360327.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Malus domestica]
Length=810

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+HGFRMALWYEHLGMLD  F QPES+E
Sbjct  679  INQRSMDGARDSEIAMGAYQPYHLSVREPARGQIHGFRMALWYEHLGMLDEVFLQPESIE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+  W+LYS ETLE D+P HLL YPIGVT  G VTELPGF+ FPDTKA +LG
Sbjct  739  CISKVNQIADKYWDLYSSETLEHDLPGHLLRYPIGVTSEGAVTELPGFEFFPDTKARILG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  AKSDY  803



>gb|AAW83125.1| phospholipase D alpha [Fragaria x ananassa]
Length=810

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQPHHLS R+PARGQ+HGFRMALWYE LGMLD  F QPES+E
Sbjct  679  INQRSMDGARDSEIAMGAYQPHHLSVREPARGQIHGFRMALWYEPLGMLDETFLQPESVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+  W+LYS ETLE D+P HLL YP+GVT  G+VTELPGF+ FPDTKA VLG
Sbjct  739  CIKKVNQIADKYWDLYSSETLEHDLPGHLLRYPVGVTSEGEVTELPGFEFFPDTKARVLG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  AKSDY  803



>gb|AIR77173.1| phospholipase D, partial [Dendrobium hybrid cultivar]
Length=411

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP +L  R+PARGQ+HGFRM+LWYEHLGMLD+ F  PES+E
Sbjct  280  INQRSMDGARDSEIAMGAYQPTYLLDREPARGQIHGFRMSLWYEHLGMLDDVFLHPESLE  339

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IAE  W++YS ETLERD+P HLLSYP+GVT  G++ ELPGF+ FPDTKA +LG
Sbjct  340  CVQKVNRIAEKYWDIYSSETLERDLPGHLLSYPVGVTNEGEINELPGFEFFPDTKARILG  399

Query  155  TKSNF  141
            +K+++
Sbjct  400  SKADY  404



>gb|ABB82551.1| phospholipase D-alpha [Cucumis melo var. inodorus]
Length=808

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLSAR+PARGQVHGFRMALWYEHLGMLD  F +PES E
Sbjct  677  INQRSMDGARDSEIAMGAYQPYHLSAREPARGQVHGFRMALWYEHLGMLDETFLRPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IA+  W++YS E+LERD+P HLL YP+G++  G+VTELPGF+ FPDTKA +LG
Sbjct  737  CIAKVNRIADKYWDMYSSESLERDLPGHLLRYPVGISSEGEVTELPGFEFFPDTKARILG  796

Query  155  TKSNF  141
            TKS++
Sbjct  797  TKSDY  801



>ref|XP_006367508.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006367509.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
Length=807

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP HL  ++PARGQVHGFRMALWYEHLGMLDN F QPES+E
Sbjct  676  INQRSMDGARDSEIAMGAYQPFHLCVKEPARGQVHGFRMALWYEHLGMLDNSFLQPESVE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I +  W++YS E+L  D+P HLL+YPIG+TENG+VT +PG + FPDTKAPVLG
Sbjct  736  CIRKVNKIGDKYWDMYSSESLIHDLPGHLLTYPIGITENGEVTGIPGVECFPDTKAPVLG  795

Query  155  TKSNF  141
            TKSNF
Sbjct  796  TKSNF  800



>ref|XP_008461111.1| PREDICTED: phospholipase D alpha 1 [Cucumis melo]
Length=833

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLSAR+PARGQVHGFRMALWYEHLGMLD  F +PES E
Sbjct  702  INQRSMDGARDSEIAMGAYQPYHLSAREPARGQVHGFRMALWYEHLGMLDETFLRPESEE  761

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IA+  W++YS E+LERD+P HLL YP+G++  G+VTELPGF+ FPDTKA +LG
Sbjct  762  CIAKVNRIADKYWDMYSSESLERDLPGHLLRYPVGISSEGEVTELPGFEFFPDTKARILG  821

Query  155  TKSNF  141
            TKS++
Sbjct  822  TKSDY  826



>gb|ABN13537.2| phospholipase D [Cucumis sativus]
Length=808

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLSA +PARGQVHGFRMALWYEHLGMLD  F +PES E
Sbjct  677  INQRSMDGARDSEIAMGAYQPYHLSAHEPARGQVHGFRMALWYEHLGMLDETFLRPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W++YS E+LERD+P HLL YPIG+T  G+VTELPGF+ FPDTKA +LG
Sbjct  737  CVAKVNRIADKYWDMYSSESLERDLPGHLLRYPIGITSEGEVTELPGFECFPDTKARILG  796

Query  155  TKSNF  141
            TKS++
Sbjct  797  TKSDY  801



>ref|XP_007023174.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 ref|XP_007023175.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 gb|EOY25796.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 gb|EOY25797.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
Length=809

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS RQPARGQVHGFRMALWYEHLGMLD+ F  PES E
Sbjct  678  INQRSMDGARDSEIAMGAYQPYHLSVRQPARGQVHGFRMALWYEHLGMLDDTFLFPESEE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIA+  W+LYS E+LERD+P HLL YPIG++  G VTELPGF+ FPDTKA VLG
Sbjct  738  CVRKVNQIADKYWDLYSSESLERDLPGHLLRYPIGISSEGTVTELPGFEFFPDTKARVLG  797

Query  155  TKSNF  141
             KS++
Sbjct  798  AKSDY  802



>ref|XP_004135845.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
 gb|KGN45278.1| hypothetical protein Csa_7G432600 [Cucumis sativus]
Length=808

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLSA +PARGQVHGFRMALWYEHLGMLD  F +PES E
Sbjct  677  INQRSMDGARDSEIAMGAYQPYHLSAHEPARGQVHGFRMALWYEHLGMLDETFLRPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W++YS E+LERD+P HLL YPIG+T  G+VTELPGF+ FPDTKA +LG
Sbjct  737  CVAKVNRIADKYWDMYSSESLERDLPGHLLRYPIGITSEGEVTELPGFECFPDTKARILG  796

Query  155  TKSNF  141
            TKS++
Sbjct  797  TKSDY  801



>ref|XP_008654846.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008654847.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 gb|AFW80165.1| phospholipase D family protein [Zea mays]
Length=812

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGMLD+ F +PES+E
Sbjct  681  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLDDVFQRPESVE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IAE  W+LYS + LE+D+P HLLSYPIGVT +G VTELPG +NFPDT+A VLG
Sbjct  741  CVQKVNKIAEKYWDLYSSDDLEQDLPGHLLSYPIGVTADGTVTELPGMENFPDTRARVLG  800

Query  155  TKSNF  141
             KS++
Sbjct  801  NKSDY  805



>ref|NP_001146559.1| phospholipase D family protein [Zea mays]
 gb|ACN26583.1| unknown [Zea mays]
 gb|AFW80164.1| phospholipase D family protein [Zea mays]
Length=743

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGMLD+ F +PES+E
Sbjct  612  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLDDVFQRPESVE  671

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IAE  W+LYS + LE+D+P HLLSYPIGVT +G VTELPG +NFPDT+A VLG
Sbjct  672  CVQKVNKIAEKYWDLYSSDDLEQDLPGHLLSYPIGVTADGTVTELPGMENFPDTRARVLG  731

Query  155  TKSNF  141
             KS++
Sbjct  732  NKSDY  736



>gb|ADP23922.1| phospholipase D alpha [Litchi chinensis]
Length=800

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARGQ+HGFRMALWYEHLGML+  F QP+S+E
Sbjct  669  INQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMALWYEHLGMLNETFLQPDSLE  728

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIA+  W+LYS E+LERD+P HLL YPIG++ +G VTELPG Q FPDTKA VLG
Sbjct  729  CVQKVNQIADKYWDLYSSESLERDLPGHLLRYPIGISSDGDVTELPGAQFFPDTKARVLG  788

Query  155  TKSNF  141
            TKS++
Sbjct  789  TKSDY  793



>emb|CBI28204.3| unnamed protein product [Vitis vinifera]
Length=703

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+++QPARG +HGFRMALWYEHLG+LDN F QPES++
Sbjct  572  INQRSMDGARDSEIAMGAYQPYHLASKQPARGHIHGFRMALWYEHLGLLDNSFLQPESLD  631

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQ+AE NWNLY+ E ++ D+P HLLSYPI VT++G+VTELPG + FPDTKAPVLG
Sbjct  632  CIQKVNQMAERNWNLYTSERMDHDLPGHLLSYPICVTDSGEVTELPGSEFFPDTKAPVLG  691

Query  155  TKSNF  141
            +KS +
Sbjct  692  SKSEY  696



>ref|XP_009613360.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana tomentosiformis]
Length=807

 Score =   209 bits (532),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP HLS ++PARGQVHGFRMALWYEHLGMLDN F  PES E
Sbjct  676  INQRSMDGARDSEIAMGAYQPFHLSVKEPARGQVHGFRMALWYEHLGMLDNSFLYPESPE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQ+A+  W+LYS E+L  D+P HLL+YPI VTENG+VTELPG Q FPDTKA VLG
Sbjct  736  CIRKVNQVADKYWDLYSSESLVHDLPGHLLTYPIDVTENGEVTELPGTQYFPDTKARVLG  795

Query  155  TKSNF  141
            TKS+F
Sbjct  796  TKSDF  800



>emb|CDY20149.1| BnaA01g28530D [Brassica napus]
Length=213

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQVHGFRM+LWYEHLGMLD  F  P S+E
Sbjct  82   INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRMSLWYEHLGMLDETFLDPSSLE  141

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IA+  W+ YS E+LE D+P HLL YPI V   G ++ELPGF+ FPDTKA +LG
Sbjct  142  CIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPISVDNEGNISELPGFEFFPDTKARILG  201

Query  155  TKSNF  141
             K ++
Sbjct  202  NKVDY  206



>ref|XP_010254401.1| PREDICTED: phospholipase D alpha 1-like [Nelumbo nucifera]
 ref|XP_010254402.1| PREDICTED: phospholipase D alpha 1-like [Nelumbo nucifera]
Length=802

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGA+QP+HL+ RQPARGQ+HGFRMALWYEH+GMLDN F QPES+E
Sbjct  671  INQRSMDGARDSEIAMGAFQPYHLATRQPARGQIHGFRMALWYEHIGMLDNSFLQPESVE  730

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++A+  W LYS + LE+D+P HLL YPI VTENG++TELPG ++FPDTKA VLG
Sbjct  731  CVHKVNRMADKYWELYSSDILEQDLPGHLLRYPIAVTENGEITELPGTEHFPDTKARVLG  790

Query  155  TKSNF  141
            TKS++
Sbjct  791  TKSDY  795



>ref|XP_009365415.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=816

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+HGFRMALWYEH+GMLD  F QPES+E
Sbjct  685  INQRSMDGARDSEIAMGAYQPYHLSVREPARGQIHGFRMALWYEHMGMLDEAFLQPESVE  744

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+  W+LYS ETLE D+P HLL YP+GVT  G V ELPGF+ FPDTKA +LG
Sbjct  745  CISKVNQIADKYWDLYSSETLEHDLPGHLLRYPVGVTSEGVVVELPGFEFFPDTKARILG  804

Query  155  TKSNF  141
             KS++
Sbjct  805  AKSDY  809



>ref|XP_010656428.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=814

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+++QPARG +HGFRMALWYEHLG+LDN F QPES++
Sbjct  683  INQRSMDGARDSEIAMGAYQPYHLASKQPARGHIHGFRMALWYEHLGLLDNSFLQPESLD  742

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQ+AE NWNLY+ E ++ D+P HLLSYPI VT++G+VTELPG + FPDTKAPVLG
Sbjct  743  CIQKVNQMAERNWNLYTSERMDHDLPGHLLSYPICVTDSGEVTELPGSEFFPDTKAPVLG  802

Query  155  TKSNF  141
            +KS +
Sbjct  803  SKSEY  807



>ref|XP_009799916.1| PREDICTED: phospholipase D alpha 1 [Nicotiana sylvestris]
 ref|XP_009799917.1| PREDICTED: phospholipase D alpha 1 [Nicotiana sylvestris]
Length=808

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQPHHL+ R+PARGQ+HGFRMALWYEHLGMLD  F  PES E
Sbjct  677  INQRSMDGARDSEIAMGAYQPHHLATREPARGQIHGFRMALWYEHLGMLDETFLHPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++A+  W+LYS E+LERD+P HLL YPIGV   G VTELPG ++FPDTKA VLG
Sbjct  737  CVTKVNRMADKYWDLYSSESLERDLPGHLLRYPIGVASEGDVTELPGTEHFPDTKARVLG  796

Query  155  TKSNF  141
            TKS++
Sbjct  797  TKSDY  801



>ref|XP_009348321.1| PREDICTED: phospholipase D alpha 1 [Pyrus x bretschneideri]
Length=810

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+HGFRMALWYEH+GMLD  F QPES+E
Sbjct  679  INQRSMDGARDSEIAMGAYQPYHLSVREPARGQIHGFRMALWYEHMGMLDEAFLQPESVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+  W+LYS ETLE D+P HLL YP+GVT  G V ELPGF+ FPDTKA +LG
Sbjct  739  CISKVNQIADKYWDLYSSETLEHDLPGHLLRYPVGVTSEGVVAELPGFEFFPDTKARILG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  AKSDY  803



>ref|NP_001105686.1| phospholipase D alpha 1 [Zea mays]
 sp|Q43270.1|PLDA1_MAIZE RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Zea mays]
 dbj|BAA11135.1| phospholipase D [Zea mays]
Length=812

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGML++ F +PES+E
Sbjct  681  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLEDVFQRPESVE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++AE  W+LYS + LE+D+P HLLSYPIGVT +G VTELPG +NFPDT+A VLG
Sbjct  741  CVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPIGVTADGSVTELPGMENFPDTRARVLG  800

Query  155  TKSNF  141
             KS++
Sbjct  801  NKSDY  805



>gb|ACR35730.1| unknown [Zea mays]
Length=812

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGML++ F +PES+E
Sbjct  681  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLEDVFQRPESVE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++AE  W+LYS + LE+D+P HLLSYPIGVT +G VTELPG +NFPDT+A VLG
Sbjct  741  CVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPIGVTADGSVTELPGMENFPDTRARVLG  800

Query  155  TKSNF  141
             KS++
Sbjct  801  NKSDY  805



>ref|XP_008673445.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Zea mays]
 ref|XP_008673446.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Zea mays]
 gb|ACN25900.1| unknown [Zea mays]
 gb|ACN27927.1| unknown [Zea mays]
 gb|ACN28359.1| unknown [Zea mays]
 gb|ACN29073.1| unknown [Zea mays]
 tpg|DAA53244.1| TPA: phospholipase D family protein [Zea mays]
Length=812

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGML++ F +PES+E
Sbjct  681  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLEDVFQRPESVE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++AE  W+LYS + LE+D+P HLLSYPIGVT +G VTELPG +NFPDT+A VLG
Sbjct  741  CVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPIGVTADGSVTELPGMENFPDTRARVLG  800

Query  155  TKSNF  141
             KS++
Sbjct  801  NKSDY  805



>gb|ACL53693.1| unknown [Zea mays]
Length=812

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGML++ F +PES+E
Sbjct  681  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLEDVFQRPESVE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++AE  W+LYS + LE+D+P HLLSYPIGVT +G VTELPG +NFPDT+A VLG
Sbjct  741  CVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPIGVTADGSVTELPGMENFPDTRARVLG  800

Query  155  TKSNF  141
             KS++
Sbjct  801  NKSDY  805



>gb|ACL53520.1| unknown [Zea mays]
Length=743

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGML++ F +PES+E
Sbjct  612  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLEDVFQRPESVE  671

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++AE  W+LYS + LE+D+P HLLSYPIGVT +G VTELPG +NFPDT+A VLG
Sbjct  672  CVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPIGVTADGSVTELPGMENFPDTRARVLG  731

Query  155  TKSNF  141
             KS++
Sbjct  732  NKSDY  736



>ref|XP_010487411.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Camelina sativa]
Length=559

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQVHGFRM+LWYEHLGMLD  F  P S+E
Sbjct  428  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRMSLWYEHLGMLDETFLDPSSLE  487

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IA+  W+ YS E+LE D+P HLL YPIGV+  G VTELPGF+ FPDTKA +LG
Sbjct  488  CIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGFEFFPDTKARILG  547

Query  155  TKSNF  141
            TKS++
Sbjct  548  TKSDY  552



>ref|XP_008673447.1| PREDICTED: phospholipase D alpha 1 isoform X2 [Zea mays]
Length=810

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGML++ F +PES+E
Sbjct  679  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLEDVFQRPESVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++AE  W+LYS + LE+D+P HLLSYPIGVT +G VTELPG +NFPDT+A VLG
Sbjct  739  CVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPIGVTADGSVTELPGMENFPDTRARVLG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  NKSDY  803



>ref|XP_009625689.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625690.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625691.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625692.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
Length=808

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQPHHL+ R+PARGQ+HGFRMALWYEHLGMLD  F  PES E
Sbjct  677  INQRSMDGARDSEIAMGAYQPHHLATREPARGQIHGFRMALWYEHLGMLDETFLHPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++A+  W+LYS E+LERD+P HLL YPIGV   G VTELPG ++FPDTKA VLG
Sbjct  737  CVSKVNRMADKYWDLYSSESLERDLPGHLLRYPIGVASEGDVTELPGAEHFPDTKARVLG  796

Query  155  TKSNF  141
            TKS++
Sbjct  797  TKSDY  801



>sp|P93400.2|PLDA1_TOBAC RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Nicotiana tabacum]
 emb|CAB06620.1| phospholipase D [Nicotiana tabacum]
Length=808

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQPHHL+ R+PARGQ+HGFRMALWYEHLGMLD  F  PES E
Sbjct  677  INQRSMDGARDSEIAMGAYQPHHLATREPARGQIHGFRMALWYEHLGMLDETFLHPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++A+  W+LYS E+LERD+P HLL YPIGV   G VTELPG ++FPDTKA VLG
Sbjct  737  CVSKVNRMADKYWDLYSSESLERDLPGHLLRYPIGVASEGDVTELPGAEHFPDTKARVLG  796

Query  155  TKSNF  141
            TKS++
Sbjct  797  TKSDY  801



>ref|XP_006367510.1| PREDICTED: phospholipase D alpha 1-like [Solanum tuberosum]
Length=807

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP HL  ++PARGQVHGFRMALWYEHLGMLDN F QPES+E
Sbjct  676  INQRSMDGARDSEIAMGAYQPFHLCVKEPARGQVHGFRMALWYEHLGMLDNRFLQPESVE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I +  W++YS   L  D+P HLL+YPIG+TENG++TELPG + FPDTKAPVLG
Sbjct  736  CIRKVNKIGDKYWDMYSSGNLIHDLPGHLLTYPIGITENGEITELPGVECFPDTKAPVLG  795

Query  155  TKSNF  141
            TKSN+
Sbjct  796  TKSNY  800



>ref|XP_009760786.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
Length=807

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP HLS ++PARGQVHGFRMALWYEHLG+LDN F  PES E
Sbjct  676  INQRSMDGARDSEIAMGAYQPFHLSVKEPARGQVHGFRMALWYEHLGLLDNSFLYPESPE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQ+A+  W+LYS E+L  D+P HLL+YPI VTENG+VTELPG + FPDTKA VLG
Sbjct  736  CIRKVNQVADKYWDLYSSESLVHDLPGHLLTYPIAVTENGEVTELPGTEYFPDTKARVLG  795

Query  155  TKSNF  141
            TKS+F
Sbjct  796  TKSDF  800



>sp|Q41142.1|PLDA1_RICCO RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Ricinus communis]
 gb|AAB04095.1| phospholipase D [Ricinus communis]
Length=808

 Score =   207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  PES E
Sbjct  677  INQRSMDGARDSEIAMGAYQPHHLSTRQPARGQIHGFRMSLWYEHLGMLDESFLNPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQ+AE  W+LYS ETLE D+P HLL YPIGV   G VTELPG + FPDTKA VLG
Sbjct  737  CVRKVNQMAEKYWDLYSSETLEHDLPGHLLRYPIGVASEGDVTELPGTEFFPDTKARVLG  796

Query  155  TKSNF  141
             KS++
Sbjct  797  AKSDY  801



>gb|AAB37305.1| phospholipase D [Ricinus communis]
Length=808

 Score =   207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  PES E
Sbjct  677  INQRSMDGARDSEIAMGAYQPHHLSTRQPARGQIHGFRMSLWYEHLGMLDESFLNPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQ+AE  W+LYS ETLE D+P HLL YPIGV   G VTELPG + FPDTKA VLG
Sbjct  737  CVRKVNQMAEKYWDLYSSETLEHDLPGHLLRYPIGVASEGDVTELPGTEFFPDTKARVLG  796

Query  155  TKSNF  141
             KS++
Sbjct  797  AKSDY  801



>dbj|BAJ88431.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ R+PARGQ+HGFRMALWYEHLGMLD+ F +PES+E
Sbjct  429  INQRSMDGARDSEIAMGAYQPYHLANREPARGQIHGFRMALWYEHLGMLDDVFQRPESVE  488

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W+LYS + LE+D+P HLLSYPIGV  +G VTELPG + FPDT+A +LG
Sbjct  489  CVQKVNRIADKYWDLYSSDDLEQDLPGHLLSYPIGVANDGVVTELPGMEFFPDTRARILG  548

Query  155  TKSNF  141
            TKS++
Sbjct  549  TKSDY  553



>ref|XP_002517625.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF44789.1| phopholipase d alpha, putative [Ricinus communis]
Length=808

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  PES E
Sbjct  677  INQRSMDGARDSEIAMGAYQPHHLSTRQPARGQIHGFRMSLWYEHLGMLDESFLNPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQ+AE  W+LYS ETLE D+P HLL YPIGV   G VTELPG + FPDTKA VLG
Sbjct  737  CVRKVNQMAEKYWDLYSSETLEHDLPGHLLRYPIGVASEGDVTELPGTEFFPDTKARVLG  796

Query  155  TKSNF  141
             KS++
Sbjct  797  AKSDY  801



>emb|CDP10414.1| unnamed protein product [Coffea canephora]
Length=807

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS RQPARGQ+HGFRMALWYEHLGMLDN F  PE++E
Sbjct  676  INQRSMDGARDSEIAMGAYQPYHLSIRQPARGQIHGFRMALWYEHLGMLDNRFLHPENVE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQ+A+  W+LYS ETL  D+P HLL+YPIGVT  G+VT+LPGF+ FPDTK  VLG
Sbjct  736  CIRKVNQMADKYWDLYSSETLGHDLPGHLLTYPIGVTAAGEVTQLPGFEYFPDTKGKVLG  795

Query  155  TKSNF  141
            TK+++
Sbjct  796  TKADY  800



>gb|AAL16110.1|AF428278_1 AT3g15730/MSJ11_13 [Arabidopsis thaliana]
 gb|AAO23591.1| At3g15730/MSJ11_13 [Arabidopsis thaliana]
Length=523

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S+E
Sbjct  392  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSLE  451

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I++  W+ YS E+LE D+P HLL YPIGV   G +TELPGF+ FPDTKA +LG
Sbjct  452  CIEKVNRISDKYWDFYSSESLEHDLPGHLLRYPIGVASEGDITELPGFEFFPDTKARILG  511

Query  155  TKSNF  141
            TKS++
Sbjct  512  TKSDY  516



>ref|XP_008373955.1| PREDICTED: phospholipase D alpha 1 [Malus domestica]
Length=810

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+HGFRMALWYEHLGMLD  F QPE +E
Sbjct  679  INQRSMDGARDSEIAMGAYQPYHLSVREPARGQIHGFRMALWYEHLGMLDEAFLQPERIE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+  W+LYS ETLE D+P HLL YP+G+T  G V ELPGF+ FPDTKA +LG
Sbjct  739  CISKVNQIADKYWDLYSSETLEHDLPGHLLRYPVGITSEGVVDELPGFEFFPDTKARILG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  AKSDY  803



>ref|XP_009381115.1| PREDICTED: phospholipase D alpha 1 [Musa acuminata subsp. malaccensis]
Length=812

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG+RDSEIAMGAYQP+HLS R+PARGQ+HGFR+ALWYEHLGMLD+ F  PES++
Sbjct  681  INQRSMDGSRDSEIAMGAYQPYHLSTREPARGQIHGFRLALWYEHLGMLDDVFLHPESLQ  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W+LYS ETL+RD+P HLL+YPIGVT +G VTELPG + FPDT+A VLG
Sbjct  741  CVQKVNRIADKYWDLYSSETLDRDLPGHLLTYPIGVTSDGMVTELPGMEFFPDTRARVLG  800

Query  155  TKSNF  141
             KS++
Sbjct  801  AKSDY  805



>gb|ADY75750.1| phospholipase D alpha [Dimocarpus longan]
Length=800

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARGQ+HGFRMALWYEHLGM    F QPES+E
Sbjct  669  INQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMALWYEHLGMFSENFLQPESLE  728

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIA+  W+LYS E+LERD+P HLL YPIG++ +G VTELPG + FPDTKA +LG
Sbjct  729  CVRKVNQIADKYWDLYSSESLERDLPGHLLRYPIGISGDGDVTELPGTEFFPDTKARILG  788

Query  155  TKSNF  141
            TKS++
Sbjct  789  TKSDY  793



>ref|NP_001267764.1| phospholipase D alpha 1-like [Setaria italica]
 gb|ADK60917.1| phospholipase D alpha 1 [Setaria italica]
Length=811

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRMALWYEHLGMLD+ F  PESME
Sbjct  680  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMALWYEHLGMLDDVFQHPESME  739

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IAE  W+LYS + LE+D+P HLLSYP+GV   G VTELPG + FPDT+A +LG
Sbjct  740  CVQKVNKIAEKYWDLYSSDDLEQDLPGHLLSYPMGVDSEGNVTELPGMEFFPDTRARILG  799

Query  155  TKSNF  141
            TKS++
Sbjct  800  TKSDY  804



>ref|XP_006387081.1| hypothetical protein POPTR_1923s00200g [Populus trichocarpa]
 gb|ERP45995.1| hypothetical protein POPTR_1923s00200g [Populus trichocarpa]
Length=216

 Score =   194 bits (493),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG RD+EIAMGAYQP+HL+  QPARGQ+HGFRM+LWYEHLG LD+ F  PES+E
Sbjct  85   INQRSMDGGRDTEIAMGAYQPYHLATNQPARGQIHGFRMSLWYEHLGQLDDTFCHPESLE  144

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN IAE NW LYS E L+ D+P HLL+YPIGVT NG++TEL G + FP TKA V G
Sbjct  145  CVRKVNHIAEKNWQLYSSEVLDDDLPGHLLAYPIGVTSNGELTELQGTEFFPGTKARVFG  204

Query  155  TKSNF  141
            +KS  
Sbjct  205  SKSEL  209



>gb|ACG63795.1| phospholipase D alpha [Gossypium raimondii]
 gb|ACG70839.1| phospholipase D alpha [Gossypium raimondii]
 gb|ACV70145.1| phospholipase D [Gossypium raimondii]
 gb|ADD83101.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83102.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83103.1| PLDalpha isoform 1 [Gossypium hirsutum]
 gb|ADD83105.1| PLDalpha isoform 2 [Gossypium hirsutum]
 gb|KJB70610.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70614.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=807

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS R+PARGQVHGFR++LWYEHLGMLD+ F  PES E
Sbjct  676  INQRSMDGARDSEIAMGAYQPYHLSLREPARGQVHGFRLSLWYEHLGMLDDTFLAPESEE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQ+A+  W+LYS E+LERD+P HLL YPIGV+ +G VTELPG + FPDTKA VLG
Sbjct  736  CVRKVNQVADKYWDLYSSESLERDLPGHLLRYPIGVSSDGSVTELPGIEFFPDTKARVLG  795

Query  155  TKSNF  141
             KS++
Sbjct  796  AKSDY  800



>ref|XP_006406921.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48374.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
Length=652

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S+E
Sbjct  521  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSLE  580

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I++  W+LYS E+LE D+P HLL YPIGV   G +TELPGF+ FPDTKA +LG
Sbjct  581  CIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPIGVASEGDITELPGFEFFPDTKARILG  640

Query  155  TKSNF  141
            TKS++
Sbjct  641  TKSDY  645



>gb|ABY50100.1| phospholipase D [Agropyron mongolicum]
Length=570

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ R+PARGQ+HGFRMALWYEHLGMLD+ F +PES+E
Sbjct  439  INQRSMDGARDSEIAMGAYQPYHLANREPARGQIHGFRMALWYEHLGMLDDVFQRPESVE  498

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IAE  W++YS + LE+D+P HLLSYPIGV  +G VTELPG + FPDT+A +LG
Sbjct  499  CVQKVNRIAEKYWDIYSSDDLEQDLPGHLLSYPIGVASDGVVTELPGMEFFPDTRARILG  558

Query  155  TKSNF  141
             KS++
Sbjct  559  AKSDY  563



>ref|XP_011073436.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
 ref|XP_011073437.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
Length=808

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRMALWYEHLGMLDN F +PES E
Sbjct  677  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMALWYEHLGMLDNTFIRPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W+LY+ E LERD+P HLL YP+G+   G++TELPG + FPDTKA +LG
Sbjct  737  CVAKVNEIADRYWDLYASEELERDLPGHLLRYPVGIASEGEITELPGTEFFPDTKARILG  796

Query  155  TKSNF  141
            +KS++
Sbjct  797  SKSDY  801



>gb|KJB70612.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70613.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70615.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=795

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS R+PARGQVHGFR++LWYEHLGMLD+ F  PES E
Sbjct  664  INQRSMDGARDSEIAMGAYQPYHLSLREPARGQVHGFRLSLWYEHLGMLDDTFLAPESEE  723

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQ+A+  W+LYS E+LERD+P HLL YPIGV+ +G VTELPG + FPDTKA VLG
Sbjct  724  CVRKVNQVADKYWDLYSSESLERDLPGHLLRYPIGVSSDGSVTELPGIEFFPDTKARVLG  783

Query  155  TKSNF  141
             KS++
Sbjct  784  AKSDY  788



>emb|CAN76339.1| hypothetical protein VITISV_014670 [Vitis vinifera]
Length=801

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+++QPARG +HGFR ALWYEHLG+LDN F QPES +
Sbjct  670  INQRSMDGARDSEIAMGAYQPYHLASKQPARGHIHGFRXALWYEHLGLLDNSFLQPESXD  729

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQ+AE NWNLY+ E ++ D+P HLLSYPI VT++G+VTELPG + FPDTKAPVLG
Sbjct  730  CIQKVNQMAERNWNLYTSERMDHDLPGHLLSYPICVTDSGEVTELPGSEFFPDTKAPVLG  789

Query  155  TKSNF  141
            +KS +
Sbjct  790  SKSEY  794



>gb|ADA72022.1| phospholipase D [Jatropha curcas]
 gb|KDP37092.1| hypothetical protein JCGZ_06148 [Jatropha curcas]
Length=808

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS RQPARG++HGFRMALWYEHLGMLD+ F  PE+ +
Sbjct  677  INQRSMDGARDSEIAMGAYQPYHLSTRQPARGEIHGFRMALWYEHLGMLDDSFLNPENEQ  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQ+AE  W+LYS ETLE D+P HLL YPIG+T  G VTELPG + FPDTKA VLG
Sbjct  737  CVRKVNQVAEKYWDLYSSETLEHDLPGHLLRYPIGITSEGDVTELPGTEFFPDTKARVLG  796

Query  155  TKSNF  141
             KS++
Sbjct  797  AKSDY  801



>gb|KHG06123.1| Phospholipase D alpha 1 [Gossypium arboreum]
Length=807

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS R+PARGQVHGFR++LWYEHLGMLD+ F  PES E
Sbjct  676  INQRSMDGARDSEIAMGAYQPYHLSLREPARGQVHGFRLSLWYEHLGMLDDTFLAPESEE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQ+A+  W+LYS E+LERD+P HLL YPIGV+ +G VTELPG + FPDTKA VLG
Sbjct  736  CVRKVNQVADKYWDLYSSESLERDLPGHLLRYPIGVSSDGSVTELPGAEFFPDTKARVLG  795

Query  155  TKSNF  141
             KS++
Sbjct  796  AKSDY  800



>gb|ACG63794.1| phospholipase D alpha [Gossypium arboreum]
 gb|ACG70840.1| phospholipase D alpha [Gossypium arboreum]
 gb|ADD83098.1| PLDalpha isoform 2 [Gossypium hirsutum]
 gb|ADD83099.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83100.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83104.1| PLDalpha isoform 1 [Gossypium hirsutum]
Length=807

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS R+PARGQVHGFR++LWYEHLGMLD+ F  PES E
Sbjct  676  INQRSMDGARDSEIAMGAYQPYHLSLREPARGQVHGFRLSLWYEHLGMLDDTFLAPESEE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQ+A+  W+LYS E+LERD+P HLL YPIGV+ +G VTELPG + FPDTKA VLG
Sbjct  736  CVRKVNQVADKYWDLYSSESLERDLPGHLLRYPIGVSSDGSVTELPGAEFFPDTKARVLG  795

Query  155  TKSNF  141
             KS++
Sbjct  796  AKSDY  800



>gb|ABK24520.1| unknown [Picea sitchensis]
Length=482

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP HL+  +PARGQ+HGFRM+LWYEH GMLDN F QPE+++
Sbjct  351  INQRSMDGARDSEIAMGAYQPFHLAVNEPARGQIHGFRMSLWYEHTGMLDNLFLQPENVQ  410

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IAE  W+LYS E+LERD+P HLL YP+G+T  G+VTELPG + FPDTKA + G
Sbjct  411  CIRKVNKIAERYWDLYSSESLERDLPGHLLMYPVGITNEGEVTELPGSEFFPDTKARIFG  470

Query  155  TKSNF  141
            TKS+ 
Sbjct  471  TKSDL  475



>ref|XP_010503392.1| PREDICTED: phospholipase D alpha 1-like [Camelina sativa]
Length=810

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQVHGFRM+LWYEHLGMLD  F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRMSLWYEHLGMLDETFLDPSSLE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IA+  W+ YS E+LE D+P HLL YPIGV+  G VTELPGF+ FPDTKA +LG
Sbjct  739  CIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGFEFFPDTKARILG  798

Query  155  TKSNF  141
            TKS++
Sbjct  799  TKSDY  803



>gb|ACV70146.1| phospholipase D [Gossypium arboreum]
Length=807

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS R+PARGQVHGFR++LWYEHLGMLD+ F  PES E
Sbjct  676  INQRSMDGARDSEIAMGAYQPYHLSLREPARGQVHGFRLSLWYEHLGMLDDTFLAPESEE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQ+A+  W+LYS E+LERD+P HLL YPIGV+ +G VTELPG + FPDTKA VLG
Sbjct  736  CVRKVNQVADKYWDLYSSESLERDLPGHLLRYPIGVSSDGSVTELPGAEFFPDTKARVLG  795

Query  155  TKSNF  141
             KS++
Sbjct  796  AKSDY  800



>ref|XP_010465563.1| PREDICTED: phospholipase D alpha 1-like [Camelina sativa]
Length=810

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQVHGFRM+LWYEHLGMLD  F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRMSLWYEHLGMLDETFLDPSSLE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IA+  W+ YS E+LE D+P HLL YPIGV+  G VTELPGF+ FPDTKA +LG
Sbjct  739  CIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGFEFFPDTKARILG  798

Query  155  TKSNF  141
            TKS++
Sbjct  799  TKSDY  803



>ref|XP_010487412.1| PREDICTED: phospholipase D alpha 1 isoform X2 [Camelina sativa]
Length=810

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQVHGFRM+LWYEHLGMLD  F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRMSLWYEHLGMLDETFLDPSSLE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IA+  W+ YS E+LE D+P HLL YPIGV+  G VTELPGF+ FPDTKA +LG
Sbjct  739  CIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGFEFFPDTKARILG  798

Query  155  TKSNF  141
            TKS++
Sbjct  799  TKSDY  803



>ref|NP_001234102.1| phospholipase PLDa1 [Solanum lycopersicum]
 gb|AAG45485.1| phospholipase PLDa1 [Solanum lycopersicum]
Length=809

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+  +PARGQVHGFRMALWYEHLGMLD  F  PES E
Sbjct  678  INQRSMDGARDSEIAMGAYQPYHLATSKPARGQVHGFRMALWYEHLGMLDETFQHPESEE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIA+  W+LYS E+LERD+P HLL YPIGV   G +TELPG + FPDTKA VLG
Sbjct  738  CVRKVNQIADKYWDLYSSESLERDLPGHLLRYPIGVASEGDITELPGHEFFPDTKARVLG  797

Query  155  TKSNF  141
            TKS++
Sbjct  798  TKSDY  802



>ref|XP_006406922.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 ref|XP_006406923.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48375.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48376.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
Length=810

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSLE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I++  W+LYS E+LE D+P HLL YPIGV   G +TELPGF+ FPDTKA +LG
Sbjct  739  CIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPIGVASEGDITELPGFEFFPDTKARILG  798

Query  155  TKSNF  141
            TKS++
Sbjct  799  TKSDY  803



>ref|XP_011008452.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011008453.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=808

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+HGFR+ LWYEHLGMLD+ F  PES E
Sbjct  677  INQRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRLGLWYEHLGMLDDTFLHPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQI +  W+LYS ETLE D+P HLL YPIGV+  G VTELPG + FPDTKA VLG
Sbjct  737  CVTKVNQITDKYWDLYSSETLEHDLPGHLLRYPIGVSSEGNVTELPGTEFFPDTKARVLG  796

Query  155  TKSNF  141
            TKS+F
Sbjct  797  TKSDF  801



>ref|XP_010322318.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 ref|XP_010322320.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 ref|XP_010322321.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 gb|AAF17557.1|AF201661_1 phospholipase D alpha [Solanum lycopersicum]
Length=809

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+  +PARGQVHGFRMALWYEHLGMLD  F  PES E
Sbjct  678  INQRSMDGARDSEIAMGAYQPYHLATSKPARGQVHGFRMALWYEHLGMLDETFQHPESEE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIA+  W+LYS E+LERD+P HLL YPIGV   G +TELPG + FPDTKA VLG
Sbjct  738  CVRKVNQIADKYWDLYSSESLERDLPGHLLRYPIGVASEGDITELPGHEFFPDTKARVLG  797

Query  155  TKSNF  141
            TKS++
Sbjct  798  TKSDY  802



>emb|CBI28205.3| unnamed protein product [Vitis vinifera]
Length=604

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL+ +QPARGQ+HGFRMALWYEHLG++DN F QPES++
Sbjct  473  INQRSMDGARDSEIAMGGYQPYHLATKQPARGQIHGFRMALWYEHLGLVDNSFLQPESLD  532

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IAE NWNLYS E  + D+P HLLSYPI VT+ G+V E+PG + FPDTKA VLG
Sbjct  533  CIQKVNKIAERNWNLYSSERTDDDLPGHLLSYPICVTDTGEVKEVPGSEFFPDTKAQVLG  592

Query  155  TKSNF  141
            +KS++
Sbjct  593  SKSDY  597



>gb|AGW22212.1| phospholipase D alpha [Chorispora bungeana]
Length=809

 Score =   204 bits (518),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S+E
Sbjct  678  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPPSLE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I++  W+LYS E+LE D+P HLL YPIGV   G VTELPGF+ FPDTKA +LG
Sbjct  738  CIEKVNRISDKYWDLYSSESLENDLPGHLLRYPIGVASEGDVTELPGFEFFPDTKARILG  797

Query  155  TKSNF  141
            TKS++
Sbjct  798  TKSDY  802



>ref|XP_010545768.1| PREDICTED: phospholipase D alpha 1 [Tarenaya hassleriana]
Length=810

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P SME
Sbjct  679  INQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSME  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++A+  W+LYS E LE D+P HLL YPIGV+  G VTELPGF+ FPDTKA VLG
Sbjct  739  CVQKVNRVADKYWDLYSSEALEHDLPGHLLRYPIGVSSEGNVTELPGFEFFPDTKARVLG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  AKSDY  803



>ref|XP_009408983.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408984.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
Length=809

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG+RDSEIAMGAYQP+HLS R+PARGQ+HGFR+ALWYEHLGMLD+ F QPES E
Sbjct  678  INQRSMDGSRDSEIAMGAYQPYHLSTREPARGQIHGFRLALWYEHLGMLDDAFLQPESSE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W+LYS + LE D+P HLLSYPIGV+  G+VTELPG + FPDTKA VLG
Sbjct  738  CVQKVNRIADKYWDLYSSDDLEHDLPGHLLSYPIGVSAEGEVTELPGTEFFPDTKARVLG  797

Query  155  TKSNF  141
             KS++
Sbjct  798  AKSDY  802



>ref|XP_007217042.1| hypothetical protein PRUPE_ppa001519mg [Prunus persica]
 gb|EMJ18241.1| hypothetical protein PRUPE_ppa001519mg [Prunus persica]
Length=810

 Score =   203 bits (517),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+HGFRMALWYEHLGMLD  F QPES+E
Sbjct  679  INQRSMDGARDSEIAMGAYQPYHLSVREPARGQIHGFRMALWYEHLGMLDEKFLQPESVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIA+  W+LYS E+L  D+P HLL YPIG++  G VTELPG + FPDTKA VLG
Sbjct  739  CVTKVNQIADKYWDLYSSESLNHDLPGHLLRYPIGISSEGTVTELPGCEFFPDTKARVLG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  AKSDY  803



>ref|XP_008243731.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
 ref|XP_008243732.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
 ref|XP_008243733.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
Length=810

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+HGFRMALWYEHLGMLD  F QPES+E
Sbjct  679  INQRSMDGARDSEIAMGAYQPYHLSVREPARGQIHGFRMALWYEHLGMLDEKFLQPESVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIA+  W+LYS E+L  D+P HLL YPIG++  G VTELPG + FPDTKA VLG
Sbjct  739  CVTKVNQIADKYWDLYSSESLNHDLPGHLLRYPIGISSEGTVTELPGCEFFPDTKARVLG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  AKSDY  803



>gb|ACG80607.1| phospholipase D alpha [Prunus persica]
Length=810

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+HGFRMALWYEHLGMLD  F QPES+E
Sbjct  679  INQRSMDGARDSEIAMGAYQPYHLSVREPARGQIHGFRMALWYEHLGMLDEKFLQPESVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIA+  W+LYS E+L  D+P HLL YPIG++  G VTELPG + FPDTKA VLG
Sbjct  739  CVTKVNQIADKYWDLYSSESLNHDLPGHLLRYPIGISSEGTVTELPGCEFFPDTKARVLG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  AKSDY  803



>ref|XP_004506968.1| PREDICTED: phospholipase D alpha 1-like [Cicer arietinum]
Length=793

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQVHGFRM+LWYEHLGMLD  F  PES E
Sbjct  662  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQVHGFRMSLWYEHLGMLDESFLHPESEE  721

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+  W+LYS E+LE D+P HLL YP+GV   G VTELPGF+ FPDTKA +LG
Sbjct  722  CIDKVNQIADKYWDLYSNESLEHDLPGHLLRYPVGVASEGDVTELPGFEFFPDTKARILG  781

Query  155  TKSNF  141
             K+++
Sbjct  782  AKADY  786



>dbj|BAA11136.1| phospholipase D [Oryza sativa Japonica Group]
 dbj|BAA19467.1| phospholipase D [Oryza sativa Japonica Group]
Length=812

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+HGFRMALWYEHLGMLD+ F +PES+E
Sbjct  681  INQRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRMALWYEHLGMLDDVFQRPESLE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IAE  W++YS + L++D+P HLLSYPIGV  +G VTELPG + FPDT+A VLG
Sbjct  741  CVQKVNRIAEKYWDMYSSDDLQQDLPGHLLSYPIGVASDGVVTELPGMEYFPDTRARVLG  800

Query  155  TKSNF  141
             KS++
Sbjct  801  AKSDY  805



>ref|NP_001042153.1| Os01g0172400 [Oryza sativa Japonica Group]
 sp|Q43007.2|PLDA1_ORYSJ RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAF04067.1| Os01g0172400 [Oryza sativa Japonica Group]
 gb|EEE53959.1| hypothetical protein OsJ_00559 [Oryza sativa Japonica Group]
Length=812

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+HGFRMALWYEHLGMLD+ F +PES+E
Sbjct  681  INQRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRMALWYEHLGMLDDVFQRPESLE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IAE  W++YS + L++D+P HLLSYPIGV  +G VTELPG + FPDT+A VLG
Sbjct  741  CVQKVNRIAEKYWDMYSSDDLQQDLPGHLLSYPIGVASDGVVTELPGMEYFPDTRARVLG  800

Query  155  TKSNF  141
             KS++
Sbjct  801  AKSDY  805



>gb|EEC70024.1| hypothetical protein OsI_00588 [Oryza sativa Indica Group]
Length=812

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+HGFRMALWYEHLGMLD+ F +PES+E
Sbjct  681  INQRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRMALWYEHLGMLDDVFQRPESLE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IAE  W++YS + L++D+P HLLSYPIGV  +G VTELPG + FPDT+A VLG
Sbjct  741  CVQKVNRIAEKYWDMYSSDDLQQDLPGHLLSYPIGVASDGVVTELPGMEYFPDTRARVLG  800

Query  155  TKSNF  141
             KS++
Sbjct  801  AKSDY  805



>ref|XP_006356207.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006356208.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
 ref|XP_006356209.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Solanum tuberosum]
Length=809

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL   +PARGQVHGFRMALWYEHLGMLD  F  PES E
Sbjct  678  INQRSMDGARDSEIAMGAYQPYHLVTSEPARGQVHGFRMALWYEHLGMLDETFQHPESEE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIA+  W++YS E+LERD+P HLL YPIGV   G +TELPG + FPDTKA VLG
Sbjct  738  CVRKVNQIADKYWDMYSSESLERDLPGHLLRYPIGVASEGDITELPGHEFFPDTKARVLG  797

Query  155  TKSNF  141
            TKS++
Sbjct  798  TKSDY  802



>ref|NP_188194.1| phospholipase D alpha 1 [Arabidopsis thaliana]
 sp|Q38882.2|PLDA1_ARATH RecName: Full=Phospholipase D alpha 1; Short=AtPLDalpha1; Short=PLD 
alpha 1; AltName: Full=Choline phosphatase 1; AltName: 
Full=PLDalpha; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Arabidopsis thaliana]
 dbj|BAB02304.1| phospholipase D [Arabidopsis thaliana]
 dbj|BAE98964.1| phospholipase D [Arabidopsis thaliana]
 gb|AEE75720.1| phospholipase D alpha 1 [Arabidopsis thaliana]
Length=810

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSLE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I++  W+ YS E+LE D+P HLL YPIGV   G +TELPGF+ FPDTKA +LG
Sbjct  739  CIEKVNRISDKYWDFYSSESLEHDLPGHLLRYPIGVASEGDITELPGFEFFPDTKARILG  798

Query  155  TKSNF  141
            TKS++
Sbjct  799  TKSDY  803



>ref|XP_008454241.1| PREDICTED: phospholipase D alpha 1 [Cucumis melo]
 gb|ABS86615.1| phospholipase D alpha [Cucumis melo var. inodorus]
Length=807

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLSAR+PARGQ+HGFR+ALWYEHLG+L   F  PES+E
Sbjct  676  INQRSMDGARDSEIAMGGYQPYHLSAREPARGQIHGFRLALWYEHLGLLHQSFLFPESIE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV  VNQ+A+  W+LYS ET +RD+P HLL YPI V+ +GQVTELPGFQ FPDTKA VLG
Sbjct  736  CVKTVNQLADKYWDLYSSETFDRDLPGHLLRYPIAVSADGQVTELPGFQFFPDTKARVLG  795

Query  155  TKSNF  141
             KSN+
Sbjct  796  NKSNY  800



>ref|XP_002882959.1| PLDALPHA1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59218.1| PLDALPHA1 [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSLE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I++  W+ YS E+LE D+P HLL YPIGV   G +TELPGF+ FPDTKA +LG
Sbjct  739  CIEKVNRISDKYWDFYSSESLEHDLPGHLLRYPIGVASEGDITELPGFEFFPDTKARILG  798

Query  155  TKSNF  141
            TKS++
Sbjct  799  TKSDY  803



>ref|XP_004287315.1| PREDICTED: phospholipase D alpha 1-like [Fragaria vesca subsp. 
vesca]
Length=809

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARD+EIAMGAYQP+HLS   PARGQ+HG RMALWYEHLG+LDN F +PES+E
Sbjct  678  INQRSMDGARDTEIAMGAYQPYHLSTNVPARGQIHGLRMALWYEHLGLLDNTFLEPESVE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIAE  W LY+ ETLE D+P HLL YP+ +TENG VTELPG + FPDTKA VLG
Sbjct  738  CVTKVNQIAEKLWKLYTSETLEGDLPGHLLPYPVKITENGDVTELPGVEFFPDTKAKVLG  797

Query  155  TKSNF  141
            T+S+ 
Sbjct  798  TRSDL  802



>emb|CDO98145.1| unnamed protein product [Coffea canephora]
Length=809

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG+RDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGMLD+ F  PES E
Sbjct  678  INQRSMDGSRDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLDDTFLHPESEE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQ AE  W+LY+ E++ERD+P HLL YPIGV   G VTELPG + FPDTKA +LG
Sbjct  738  CIAKVNQAAEKYWDLYASESVERDLPGHLLRYPIGVAGEGDVTELPGMEFFPDTKARILG  797

Query  155  TKSNF  141
            TKS++
Sbjct  798  TKSDY  802



>ref|XP_006297003.1| hypothetical protein CARUB_v10012996mg [Capsella rubella]
 gb|EOA29901.1| hypothetical protein CARUB_v10012996mg [Capsella rubella]
Length=810

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSLE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I+E  W+ YS ETLE D+P HLL YPIGV   G +TELPG + FPDTKA +LG
Sbjct  739  CIEKVNRISEKYWDFYSSETLEHDLPGHLLRYPIGVASEGDITELPGTEFFPDTKARILG  798

Query  155  TKSNF  141
            TKS++
Sbjct  799  TKSDY  803



>ref|XP_002443625.1| hypothetical protein SORBIDRAFT_08g022520 [Sorghum bicolor]
 gb|EES17463.1| hypothetical protein SORBIDRAFT_08g022520 [Sorghum bicolor]
Length=813

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ +QPARGQ+HGFRM+LWYEHLGMLD+ F  PESME
Sbjct  682  INQRSMDGARDSEIAMGAYQPYHLATKQPARGQIHGFRMSLWYEHLGMLDDVFQHPESME  741

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W+LY+ + LE+D+P HLLSYPIGVT +G VT LPG  NFPDT+A VLG
Sbjct  742  CVQKVNRIADKYWDLYTSDDLEQDLPGHLLSYPIGVTADGTVTALPGMDNFPDTRARVLG  801

Query  155  TKSNF  141
             K+ +
Sbjct  802  NKTIY  806



>ref|NP_001275827.1| phospholipase D alpha [Citrus sinensis]
 gb|ACA49723.1| phospholipase D alpha [Citrus sinensis]
Length=802

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSM+GARD+EIAMG YQP+HLS R PARGQ+HGFRM+LWYEHLGMLD+ F QPES E
Sbjct  671  INQRSMEGARDTEIAMGGYQPYHLSTRVPARGQIHGFRMSLWYEHLGMLDDTFLQPESSE  730

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIAE  W+LYS E+LE D+P HLL YPIGV+  G VTELPG + FPDTKA VLG
Sbjct  731  CVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLG  790

Query  155  TKSNF  141
            TKS++
Sbjct  791  TKSDY  795



>gb|KDO48580.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=744

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSM+GARD+EIAMG YQP+HLS R PARGQ+HGFRM+LWYEHLGMLD+ F QPES E
Sbjct  613  INQRSMEGARDTEIAMGGYQPYHLSTRVPARGQIHGFRMSLWYEHLGMLDDTFLQPESSE  672

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIAE  W+LYS E+LE D+P HLL YPIGV+  G VTELPG + FPDTKA VLG
Sbjct  673  CVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLG  732

Query  155  TKSNF  141
            TKS++
Sbjct  733  TKSDY  737



>ref|XP_006427267.1| hypothetical protein CICLE_v10024917mg [Citrus clementina]
 gb|ESR40507.1| hypothetical protein CICLE_v10024917mg [Citrus clementina]
Length=802

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSM+GARD+EIAMG YQP+HLS R PARGQ+HGFRM+LWYEHLGMLD+ F QPES E
Sbjct  671  INQRSMEGARDTEIAMGGYQPYHLSTRVPARGQIHGFRMSLWYEHLGMLDDTFLQPESSE  730

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIAE  W+LYS E+LE D+P HLL YPIGV+  G VTELPG + FPDTKA VLG
Sbjct  731  CVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLG  790

Query  155  TKSNF  141
            TKS++
Sbjct  791  TKSDY  795



>ref|XP_006465340.1| PREDICTED: phospholipase D alpha 1 [Citrus sinensis]
Length=802

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSM+GARD+EIAMG YQP+HLS R PARGQ+HGFRM+LWYEHLGMLD+ F QPES E
Sbjct  671  INQRSMEGARDTEIAMGGYQPYHLSTRVPARGQIHGFRMSLWYEHLGMLDDTFLQPESSE  730

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIAE  W+LYS E+LE D+P HLL YPIGV+  G VTELPG + FPDTKA VLG
Sbjct  731  CVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLG  790

Query  155  TKSNF  141
            TKS++
Sbjct  791  TKSDY  795



>ref|NP_001267897.1| phospholipase D alpha [Vitis vinifera]
 gb|ABC59316.1| phospholipase D alpha [Vitis vinifera]
Length=809

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL++RQPARGQ+HGFRM+LWYEHLGMLD  F QPES E
Sbjct  678  INQRSMDGARDSEIAMGGYQPYHLASRQPARGQIHGFRMSLWYEHLGMLDESFLQPESKE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIAE  W+LY+ ETLE D+P HLL YPI V+  G +TELPG + FPDTKA VLG
Sbjct  738  CIQKVNQIAEKYWDLYASETLEHDLPGHLLRYPIAVSCGGDITELPGAEFFPDTKARVLG  797

Query  155  TKSNF  141
            TKS +
Sbjct  798  TKSEY  802



>ref|XP_009787005.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Nicotiana 
sylvestris]
Length=790

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 108/127 (85%), Gaps = 2/127 (2%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIA+GAYQPHHL+ RQPARGQVHGFRMALWYEH+GMLD+ F  PES E
Sbjct  657  INQRSMDGARDSEIAIGAYQPHHLTTRQPARGQVHGFRMALWYEHMGMLDDTFQHPESEE  716

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQN--FPDTKAPV  162
            CV KVNQIA+  W+LY+ E+LE D+P HLL YP+G+T NG +T+LPG  N  FPDTKA V
Sbjct  717  CVRKVNQIADKYWDLYTSESLENDLPGHLLRYPVGLTNNGDITDLPGNGNEFFPDTKARV  776

Query  161  LGTKSNF  141
            +GTKS++
Sbjct  777  VGTKSDY  783



>gb|AES86616.2| phospholipase D alpha 1 [Medicago truncatula]
Length=808

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ARQPARGQVHGFRMALWYEHLGML + F  PES E
Sbjct  677  INQRSMDGARDSEIAMGAYQPYHLAARQPARGQVHGFRMALWYEHLGMLHDSFLHPESQE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+  W+LYS ++LE D+P HLL YPIGV   G VT+LPGF+ FPDTKA +LG
Sbjct  737  CIRKVNQIADKYWDLYSNDSLEHDLPGHLLRYPIGVASEGDVTQLPGFEFFPDTKARILG  796

Query  155  TKSNF  141
             K+++
Sbjct  797  GKADY  801



>ref|XP_009787006.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Nicotiana 
sylvestris]
Length=762

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 108/127 (85%), Gaps = 2/127 (2%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIA+GAYQPHHL+ RQPARGQVHGFRMALWYEH+GMLD+ F  PES E
Sbjct  629  INQRSMDGARDSEIAIGAYQPHHLTTRQPARGQVHGFRMALWYEHMGMLDDTFQHPESEE  688

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQN--FPDTKAPV  162
            CV KVNQIA+  W+LY+ E+LE D+P HLL YP+G+T NG +T+LPG  N  FPDTKA V
Sbjct  689  CVRKVNQIADKYWDLYTSESLENDLPGHLLRYPVGLTNNGDITDLPGNGNEFFPDTKARV  748

Query  161  LGTKSNF  141
            +GTKS++
Sbjct  749  VGTKSDY  755



>gb|AGN71005.1| phospholipase D1 [Brassica napus]
Length=810

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I++  W+LYS E+LE D+P HLL YP+GV   G VTE PGF+ FPDTKA +LG
Sbjct  739  CIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPVGVDAEGDVTEFPGFEFFPDTKARILG  798

Query  155  TKSNF  141
            TKS++
Sbjct  799  TKSDY  803



>gb|EMT03624.1| Phospholipase D alpha 1 [Aegilops tauschii]
Length=812

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ R+PARGQ+HGFRMALWYEHLGMLD+ F +PES++
Sbjct  681  INQRSMDGARDSEIAMGAYQPYHLANREPARGQIHGFRMALWYEHLGMLDDVFQRPESVD  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W++YS + LE+D+P HLLSYPIGV  +G VTELPG + FPDT+A +LG
Sbjct  741  CVQKVNRIADKYWDMYSSDDLEQDLPGHLLSYPIGVASDGVVTELPGMEFFPDTRARILG  800

Query  155  TKSNF  141
            TKS++
Sbjct  801  TKSDY  805



>ref|XP_003569355.1| PREDICTED: phospholipase D alpha 1 [Brachypodium distachyon]
Length=811

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRMALWYEHLGMLD+ F  PES E
Sbjct  680  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMALWYEHLGMLDDVFQHPESPE  739

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W++YS + L++D+P HLLSYPIGV+ +G VTELPG + FPDT+A VLG
Sbjct  740  CVQKVNKIADKYWDIYSSDDLQQDLPGHLLSYPIGVSSDGVVTELPGMEFFPDTRARVLG  799

Query  155  TKSNF  141
             KS++
Sbjct  800  AKSDY  804



>gb|KHN01336.1| Phospholipase D alpha 1 [Glycine soja]
Length=809

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGML + F QPES E
Sbjct  678  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLHDSFLQPESEE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQ+A+  W+LYS E+LE D+P HLL YPIG+   G VTELPGF+ FPDTKA +LG
Sbjct  738  CINKVNQVADKYWDLYSSESLEHDLPGHLLRYPIGIASEGDVTELPGFEFFPDTKARILG  797

Query  155  TKSNF  141
             K+++
Sbjct  798  GKADY  802



>ref|XP_003528334.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006583126.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
Length=809

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGML + F QPES E
Sbjct  678  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLHDSFLQPESEE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQ+A+  W+LYS E+LE D+P HLL YPIG+   G VTELPGF+ FPDTKA +LG
Sbjct  738  CINKVNQVADKYWDLYSSESLEHDLPGHLLRYPIGIASEGDVTELPGFEFFPDTKARILG  797

Query  155  TKSNF  141
             K+++
Sbjct  798  GKADY  802



>ref|XP_006385316.1| phospholipase D family protein [Populus trichocarpa]
 gb|ERP63113.1| phospholipase D family protein [Populus trichocarpa]
Length=808

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+HGFR+ LWYEHLGMLD+ F  PES E
Sbjct  677  INQRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRLGLWYEHLGMLDDTFLHPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQI +  W+LYS ETLE D+P HLL YPIGV+  G VTELPG + FPDTKA VLG
Sbjct  737  CVTKVNQITDKYWDLYSSETLEHDLPGHLLRYPIGVSSEGNVTELPGTEFFPDTKARVLG  796

Query  155  TKSNF  141
             KS++
Sbjct  797  AKSDY  801



>ref|XP_002282187.3| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
 ref|XP_010656427.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=814

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL+ +QPARGQ+HGFRMALWYEHLG++DN F QPES++
Sbjct  683  INQRSMDGARDSEIAMGGYQPYHLATKQPARGQIHGFRMALWYEHLGLVDNSFLQPESLD  742

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IAE NWNLYS E  + D+P HLLSYPI VT+ G+V E+PG + FPDTKA VLG
Sbjct  743  CIQKVNKIAERNWNLYSSERTDDDLPGHLLSYPICVTDTGEVKEVPGSEFFPDTKAQVLG  802

Query  155  TKSNF  141
            +KS++
Sbjct  803  SKSDY  807



>ref|XP_003531710.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006585630.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
Length=809

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGML + F QPES E
Sbjct  678  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLHDSFLQPESDE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQ+A+  W+LYS E+LE D+P HLL YPIGV   G VTELPGF+ FPDTKA +LG
Sbjct  738  CINKVNQVADKYWDLYSNESLEHDLPGHLLRYPIGVASEGDVTELPGFEFFPDTKARILG  797

Query  155  TKSNF  141
             K+++
Sbjct  798  GKADY  802



>gb|ABX83202.2| phospholipase D [Lolium temulentum]
Length=811

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGA+QP+HL+ RQPARGQ+HGFRMALWYEHLGMLD+ F  PES E
Sbjct  680  INQRSMDGARDSEIAMGAFQPYHLATRQPARGQIHGFRMALWYEHLGMLDDLFQHPESPE  739

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IAE  W++YS + LE+D+P HLLSYPIGV  +G VTELPG + FPDT+A +LG
Sbjct  740  CIQKVNKIAEKYWDIYSSDDLEQDLPGHLLSYPIGVASDGLVTELPGMEFFPDTRARILG  799

Query  155  TKSNF  141
             KS++
Sbjct  800  AKSDY  804



>emb|CDM81985.1| unnamed protein product [Triticum aestivum]
Length=812

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ R+PARGQ+HGFRMALWYEHLGMLD+ F +PES+E
Sbjct  681  INQRSMDGARDSEIAMGAYQPYHLANREPARGQIHGFRMALWYEHLGMLDDVFQRPESVE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W++YS + LE+D+P HLLSYPIGV  +G VTELPG + FPDT+A +LG
Sbjct  741  CVQKVNRIADKYWDIYSSDDLEQDLPGHLLSYPIGVASDGVVTELPGMEFFPDTRARILG  800

Query  155  TKSNF  141
             KS++
Sbjct  801  AKSDY  805



>ref|XP_003597894.1| Phospholipase D alpha [Medicago truncatula]
 gb|ABD28731.1| C2; Peptidase, cysteine peptidase active site [Medicago truncatula]
 gb|AES68145.1| phospholipase D alpha 1 [Medicago truncatula]
Length=809

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGML   F  PES E
Sbjct  678  INQRSMDGARDSEIAMGAYQPYHLANRQPARGQIHGFRMSLWYEHLGMLQETFLHPESEE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+  W+LYS ETLE D+P HLL YPIGV+  G VTELPGF+ FPDTKA VLG
Sbjct  738  CIRKVNQIADKYWDLYSSETLEHDLPGHLLRYPIGVSSEGNVTELPGFEFFPDTKARVLG  797

Query  155  TKSNF  141
             K ++
Sbjct  798  GKVDY  802



>gb|KHN47766.1| Phospholipase D alpha 1 [Glycine soja]
Length=809

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGML + F QPES E
Sbjct  678  INQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLHDSFLQPESDE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQ+A+  W+LYS E+LE D+P HLL YPIGV   G VTELPGF+ FPDTKA +LG
Sbjct  738  CINKVNQVADKYWDLYSNESLEHDLPGHLLRYPIGVASEGDVTELPGFEFFPDTKARILG  797

Query  155  TKSNF  141
             K+++
Sbjct  798  GKADY  802



>ref|XP_007013459.1| Phospholipase D alpha 1 [Theobroma cacao]
 gb|EOY31078.1| Phospholipase D alpha 1 [Theobroma cacao]
Length=806

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARD+EIAMGAYQP+HL+ R+PARGQ+HG RMALWYEHLG LDNCF QPES+E
Sbjct  675  INQRSMDGARDTEIAMGAYQPYHLATREPARGQIHGLRMALWYEHLGKLDNCFLQPESLE  734

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQ A++ W+LYS +T + ++P HLLSYPI VT NG+VTE+PG ++FPDTKA VLG
Sbjct  735  CVRKVNQTADDYWDLYSCDTSDHELPGHLLSYPIRVTHNGEVTEIPGLEHFPDTKARVLG  794

Query  155  TKS  147
            +K+
Sbjct  795  SKN  797



>ref|XP_010097235.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB67302.1| Phospholipase D alpha 1 [Morus notabilis]
Length=808

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSM+GARD+EIAMGAYQP HLS R+ ARGQVHGFR+ALWYEHLGMLD  F +PES E
Sbjct  677  INQRSMEGARDTEIAMGAYQPCHLSTRESARGQVHGFRLALWYEHLGMLDESFLEPESKE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W+LYS ETLE D+P HLL YPIGV   G +TELPGF+ FPDTKA VLG
Sbjct  737  CVQKVNRIADKYWDLYSNETLEHDLPGHLLRYPIGVASEGDITELPGFEFFPDTKARVLG  796

Query  155  TKSNF  141
            TKS++
Sbjct  797  TKSDY  801



>ref|XP_006643814.1| PREDICTED: phospholipase D alpha 1-like [Oryza brachyantha]
Length=812

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+HGFRMALWYEHLGMLD+ F +PES+E
Sbjct  681  INQRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRMALWYEHLGMLDDVFQRPESLE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV +VN IA+  W++YS + L++D+P HLLSYP+G+  +G VTELPG + FPDT+A VLG
Sbjct  741  CVQRVNAIADKYWDMYSSDDLQQDLPGHLLSYPVGIASDGVVTELPGMEFFPDTRARVLG  800

Query  155  TKSNF  141
            TKS++
Sbjct  801  TKSDY  805



>sp|O04883.1|PLDA1_PIMBR RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Spuriopimpinella brachycarpa]
 gb|AAB70463.1| phospholipase D [Spuriopimpinella brachycarpa]
Length=808

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGA+DSEIAMGAYQPHHL+ R+PARGQ+HGFRM+LWYEHLGMLD+  A PES++
Sbjct  677  INQRSMDGAKDSEIAMGAYQPHHLATREPARGQIHGFRMSLWYEHLGMLDDTLALPESVD  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN +A+  W+LYS ETLE D+P HLL YPI V   G VTELPG + FPDTKA VLG
Sbjct  737  CVQKVNTVADKYWDLYSSETLENDLPGHLLRYPIAVASEGNVTELPGTEFFPDTKARVLG  796

Query  155  TKSNF  141
             KS+F
Sbjct  797  AKSDF  801



>gb|KJB68102.1| hypothetical protein B456_010G225600 [Gossypium raimondii]
Length=805

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS RQPARGQVHGFR+ALWYEHLGML N F  PES E
Sbjct  674  INQRSMDGARDSEIAMGAYQPYHLSIRQPARGQVHGFRLALWYEHLGMLHNSFLTPESKE  733

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQ+A+  W+L+S + L++D+P HLLSYPI ++ +G V+ELP F+NFPDTKA +LG
Sbjct  734  CVKKVNQLADKYWDLFSKDDLDQDLPGHLLSYPIAISNDGNVSELPNFENFPDTKARILG  793

Query  155  TKSNF  141
             KS++
Sbjct  794  AKSDY  798



>ref|XP_006842069.1| hypothetical protein AMTR_s00078p00051300 [Amborella trichopoda]
 gb|ERN03744.1| hypothetical protein AMTR_s00078p00051300 [Amborella trichopoda]
Length=815

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 112/126 (89%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDSEIAMGA+QP+HL+ R QPARGQ+HGFRMALWYEH+GMLDN F  P+S+
Sbjct  683  INQRSMDGARDSEIAMGAFQPYHLATRGQPARGQIHGFRMALWYEHMGMLDNVFLDPKSV  742

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            +C+ K+N++A+  W+LYS ++L+RD+P HLL+YP+G+T +G VTELPGF+ FPDTKA +L
Sbjct  743  DCIRKLNKVADKYWDLYSSDSLDRDLPGHLLTYPVGITNDGYVTELPGFEFFPDTKARIL  802

Query  158  GTKSNF  141
            GTKS++
Sbjct  803  GTKSDY  808



>gb|AAL48262.2|AF451980_1 phospholipase D2 [Papaver somniferum]
 gb|AAL48264.2|AF451982_1 phospholipase D2 [Papaver somniferum]
Length=813

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            IN+RSM+GARDSEIAMG YQPHHL+ R+PA GQ+HGFRMALWYEHLGMLD  F  P S E
Sbjct  682  INERSMNGARDSEIAMGGYQPHHLAHREPATGQIHGFRMALWYEHLGMLDEVFLHPNSEE  741

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W+LYS ++LERD+P HLL YPIG+TENG VTELPG + FPDTKA VLG
Sbjct  742  CVQKVNRIADKYWDLYSSDSLERDLPGHLLRYPIGITENGDVTELPGHEFFPDTKARVLG  801

Query  155  TKSNF  141
             KS++
Sbjct  802  AKSDY  806



>ref|XP_004152203.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
 gb|KGN52888.1| hypothetical protein Csa_4G004970 [Cucumis sativus]
Length=807

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS R+PARGQ+HGFR+ALWYEHLG+L   F  PES+E
Sbjct  676  INQRSMDGARDSEIAMGGYQPYHLSTREPARGQIHGFRLALWYEHLGLLHQSFLFPESIE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV  VNQ+AE  W+LYS ET + D+P HLL YPI V+ +GQVTELPGFQ FPDTKA VLG
Sbjct  736  CVKSVNQLAEKYWDLYSSETFDHDLPGHLLRYPIAVSADGQVTELPGFQFFPDTKARVLG  795

Query  155  TKSNF  141
             KSN+
Sbjct  796  NKSNY  800



>ref|XP_004156800.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
Length=807

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS R+PARGQ+HGFR+ALWYEHLG+L   F  PES+E
Sbjct  676  INQRSMDGARDSEIAMGGYQPYHLSTREPARGQIHGFRLALWYEHLGLLHQSFLFPESIE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV  VNQ+AE  W+LYS ET + D+P HLL YPI V+ +GQVTELPGFQ FPDTKA VLG
Sbjct  736  CVKSVNQLAEKYWDLYSSETFDHDLPGHLLRYPIAVSADGQVTELPGFQFFPDTKARVLG  795

Query  155  TKSNF  141
             KSN+
Sbjct  796  NKSNY  800



>gb|AAP03643.1| phopholipase D [Mirabilis jalapa]
Length=578

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDSEIAMGAYQP+HL+ R QPA+GQ+HGFRMALWYEHLGMLD  F QP S+
Sbjct  446  INQRSMDGARDSEIAMGAYQPYHLATRNQPAQGQIHGFRMALWYEHLGMLDELFNQPASV  505

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV KVN  A+  W+LYS E+LE D+P HLL YPIGV+  G++TELPGF+ FPDT A VL
Sbjct  506  ECVEKVNHAADRYWDLYSSESLEEDLPGHLLRYPIGVSSEGEITELPGFECFPDTNAKVL  565

Query  158  GTKSNF  141
            GTKS++
Sbjct  566  GTKSDY  571



>ref|XP_009364028.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=807

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS  +PARGQ+HG RM+LWYEHLG+LD+ F +PES+E
Sbjct  676  INQRSMDGARDSEIAMGAYQPYHLSTGKPARGQIHGLRMSLWYEHLGLLDDTFLEPESVE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C  KVNQIAE +W+LYS +TL+ D+P HLLSYPI VTE+G+VTELPG + FPDTKA +LG
Sbjct  736  CFRKVNQIAEQHWDLYSCDTLDGDLPGHLLSYPIAVTEDGEVTELPGTEFFPDTKARILG  795

Query  155  TKSNF  141
            +KS+ 
Sbjct  796  SKSDL  800



>ref|XP_006392903.1| hypothetical protein EUTSA_v10011246mg [Eutrema salsugineum]
 gb|ESQ30189.1| hypothetical protein EUTSA_v10011246mg [Eutrema salsugineum]
Length=813

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S E
Sbjct  682  INQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMSLWYEHLGMLDETFLNPSSQE  741

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN++A+  W+LYS E+LE D+P HLL YPIGV+  G +TELPGF+ FPDTKA +LG
Sbjct  742  CIKKVNRVADMYWDLYSSESLEHDLPGHLLRYPIGVSSQGDITELPGFEFFPDTKARILG  801

Query  155  TKSNF  141
             KS++
Sbjct  802  AKSDY  806



>ref|XP_007135745.1| hypothetical protein PHAVU_010G155000g [Phaseolus vulgaris]
 gb|ESW07739.1| hypothetical protein PHAVU_010G155000g [Phaseolus vulgaris]
Length=809

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG+RDSEIAMGAYQP+HL+ +QPARGQVHGFR++LWYEHLGML + F +PES E
Sbjct  678  INQRSMDGSRDSEIAMGAYQPYHLATQQPARGQVHGFRLSLWYEHLGMLHDSFLKPESEE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQ+A+  W+LYS E+LERD+P HLL YPIGV   G VT+LPGF+ FPDTKA +LG
Sbjct  738  CITKVNQVADKYWDLYSSESLERDLPGHLLRYPIGVASEGDVTQLPGFEFFPDTKARILG  797

Query  155  TKSNF  141
             K+++
Sbjct  798  AKADY  802



>ref|XP_011012164.1| PREDICTED: phospholipase D alpha 1 [Populus euphratica]
Length=808

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+HGFR+ LWYEHLGMLD+ F +PE+ +
Sbjct  677  INQRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRLGLWYEHLGMLDDTFLKPENED  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIA+  W+LYS ETLE D+P HLL YPIG++ +G VTELPG + FPDTKA VLG
Sbjct  737  CVRKVNQIADKYWDLYSSETLEGDLPGHLLRYPIGISSDGNVTELPGTEFFPDTKARVLG  796

Query  155  TKSNF  141
             KS++
Sbjct  797  AKSDY  801



>ref|XP_009123823.1| PREDICTED: phospholipase D alpha 2-like [Brassica rapa]
Length=812

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S E
Sbjct  681  INQRSMDGARDSEIAMGGYQPYHLSVRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSQE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++A+  W+LYS E+LE D+P HLL YPIG+   G +TELPG + FPDTKA +LG
Sbjct  741  CVKKVNRVADKYWDLYSSESLEHDLPGHLLRYPIGIASQGDITELPGCECFPDTKARILG  800

Query  155  TKSNF  141
            TKS++
Sbjct  801  TKSDY  805



>emb|CDY47540.1| BnaC03g69220D [Brassica napus]
Length=812

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S E
Sbjct  681  INQRSMDGARDSEIAMGGYQPYHLSVRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSQE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++A+  W+LYS E+LE D+P HLL YPIG+   G +TELPG + FPDTKA +LG
Sbjct  741  CVKKVNRVADKYWDLYSSESLEHDLPGHLLRYPIGIASQGDITELPGCECFPDTKARILG  800

Query  155  TKSNF  141
            TKS++
Sbjct  801  TKSDY  805



>ref|XP_002299756.1| phospholipase D family protein [Populus trichocarpa]
 gb|EEE84561.1| phospholipase D family protein [Populus trichocarpa]
Length=808

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+HGFR+ LWYEHLGMLD+ F +PE+ +
Sbjct  677  INQRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRLGLWYEHLGMLDDTFLKPENED  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+  W+LYS ETLE D+P HLL YPIG++  G VTELPG + FPDTKA VLG
Sbjct  737  CIRKVNQIADKYWDLYSSETLEGDLPGHLLRYPIGISSEGNVTELPGTEYFPDTKARVLG  796

Query  155  TKSNF  141
             KS++
Sbjct  797  AKSDY  801



>sp|O82549.1|PLDA1_BRAOC RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Brassica 
oleracea var. capitata]
 gb|AAC78487.1| phospholipase D1 [Brassica oleracea var. capitata]
 gb|AAD17208.1| phospholipase D1 [Brassica oleracea var. capitata]
 emb|CDY30108.1| BnaC05g37540D [Brassica napus]
Length=810

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I++  W+LYS E+LE D+P HLL YP+ V   G VTE PGF+ FPDTKA +LG
Sbjct  739  CIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPVDVDGEGDVTEFPGFEFFPDTKARILG  798

Query  155  TKSNF  141
            TKS++
Sbjct  799  TKSDY  803



>ref|XP_009619857.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
Length=810

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 2/127 (2%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIA+GAYQPHHL+  QPARGQVHGFRMALWYEH+GMLD+ F  PES E
Sbjct  677  INQRSMDGARDSEIAIGAYQPHHLTTSQPARGQVHGFRMALWYEHMGMLDDTFQHPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQN--FPDTKAPV  162
            CV KVNQIA+  W+LY+ E+L+ D+P HLL YP+G+T NG +T+LPG  N  FPDTKA V
Sbjct  737  CVKKVNQIADKYWDLYTSESLDSDLPGHLLRYPVGLTNNGDITDLPGDGNEFFPDTKAKV  796

Query  161  LGTKSNF  141
            +GTKS++
Sbjct  797  VGTKSDY  803



>ref|XP_008792036.1| PREDICTED: phospholipase D alpha 1 [Phoenix dactylifera]
 ref|XP_008792037.1| PREDICTED: phospholipase D alpha 1 [Phoenix dactylifera]
Length=813

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP +LS R+PARG++HGFR+ALWYEHLGMLD+ F  PES+E
Sbjct  682  INQRSMDGARDSEIAMGAYQPCYLSTREPARGRIHGFRLALWYEHLGMLDDVFRHPESVE  741

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+ A+  W+LYS + L+RD+P HLLSYPIGV+ +G +TELPG + FPDT+A VLG
Sbjct  742  CVQKVNRTADKYWDLYSSDNLDRDLPGHLLSYPIGVSSDGAITELPGMEYFPDTRARVLG  801

Query  155  TKSNF  141
            TK+++
Sbjct  802  TKTDY  806



>sp|O04865.1|PLDA1_VIGUN RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Vigna unguiculata]
 gb|AAB51392.1| phospholipase D [Vigna unguiculata]
Length=809

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL+  QPARGQV+GFRM+LWYEHLGML + F +PES E
Sbjct  678  INQRSMDGARDSEIAMGGYQPYHLANTQPARGQVYGFRMSLWYEHLGMLHDTFQRPESEE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+  W+LYS E+LERD+P HLL YPIGV   G+VTELPGF+ FPDTKA +LG
Sbjct  738  CINKVNQIADKYWDLYSSESLERDLPGHLLRYPIGVASEGEVTELPGFEFFPDTKARILG  797

Query  155  TKSNF  141
             K+++
Sbjct  798  AKADY  802



>gb|AGV22363.1| phospholipase D3 [Brassica napus]
Length=810

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I++  W+LYS E+LE D+P HLL YP+ V   G VTE PGF+ FPDTKA +LG
Sbjct  739  CIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPVDVDCEGDVTEFPGFEFFPDTKARILG  798

Query  155  TKSNF  141
            TKS++
Sbjct  799  TKSDY  803



>ref|XP_008367859.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Malus domestica]
Length=530

 Score =   195 bits (495),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGA QP+HLS  +PARGQ+HG RM+LWYEHLG+LD+ F +P ++E
Sbjct  399  INQRSMDGARDSEIAMGACQPYHLSTGKPARGQIHGLRMSLWYEHLGLLDDIFLEPXNVE  458

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+ +W+LYS +TL+ D+P HLLSYPI VTENG+VTELPG + FPDTKA +LG
Sbjct  459  CIRKVNQIADQHWDLYSCDTLDGDLPGHLLSYPIAVTENGEVTELPGTEFFPDTKARILG  518

Query  155  TKSNF  141
            +KS+ 
Sbjct  519  SKSDL  523



>ref|XP_003543677.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006595164.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
 gb|KHN44174.1| Phospholipase D alpha 1 [Glycine soja]
Length=807

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP HL+ARQPARGQ+HGFRM+LWYEHLG+L + F  PE+ E
Sbjct  676  INQRSMDGARDSEIAMGAYQPFHLAARQPARGQIHGFRMSLWYEHLGLLHDSFLHPENEE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+  W++YS E+LE D+P HLL YPIGV+  G VTELPGF+ FPDTKA VLG
Sbjct  736  CIKKVNQIADKYWDIYSSESLEHDLPGHLLRYPIGVSNEGVVTELPGFEFFPDTKARVLG  795

Query  155  TKSNF  141
             K ++
Sbjct  796  DKVDY  800



>gb|AGN71006.1| phospholipase D2 [Brassica napus]
Length=812

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQVHGFRM+LWYEHLGMLD  F  P S+E
Sbjct  681  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRMSLWYEHLGMLDETFLDPSSLE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IA+  WN YS E+LE D+P HLL YPI V   G ++ELPGF+ FPDTKA +LG
Sbjct  741  CIEKVNRIADKYWNFYSSESLEHDLPGHLLRYPISVDNEGNISELPGFEFFPDTKARILG  800

Query  155  TKSNF  141
             K ++
Sbjct  801  NKVDY  805



>emb|CDY60551.1| BnaA05g35700D [Brassica napus]
Length=812

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARG +HGFRM+LWYEHLGMLD  F  P S E
Sbjct  681  INQRSMDGARDSEIAMGGYQPYHLSIRQPARGHIHGFRMSLWYEHLGMLDETFLDPSSQE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W+LYS E+LE D+P HLL YPIG+   G +TELPG + FPDTKA +LG
Sbjct  741  CVQKVNRIADKYWDLYSSESLEHDLPGHLLRYPIGIASQGDITELPGCECFPDTKARILG  800

Query  155  TKSNF  141
            TKS++
Sbjct  801  TKSDY  805



>emb|CAB43063.1| phospholipase D1 [Craterostigma plantagineum]
Length=807

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ R  ARGQ+HGFRMALWYEHLGMLD  F +P+S E
Sbjct  676  INQRSMDGARDSEIAMGAYQPYHLNTRNRARGQIHGFRMALWYEHLGMLDETFLEPDSEE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN +A+  W+LY+ E LE+D+P HLL YPIG++ +G+VTELPG + FPDTKA VLG
Sbjct  736  CVRKVNHVADKYWDLYASEELEKDLPGHLLRYPIGISSDGEVTELPGTEFFPDTKARVLG  795

Query  155  TKSNF  141
            TKS++
Sbjct  796  TKSDY  800



>sp|P86387.1|PLDA1_CARPA RecName: Full=Phospholipase D alpha 1; Short=CpPLD1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Carica papaya]
Length=808

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+  QPARGQ+HGFRMALWYEHLGMLD+ F +PE++E
Sbjct  677  INQRSMDGARDSEIAMGAYQPYHLTINQPARGQIHGFRMALWYEHLGMLDDTFLEPENIE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++A   W+LY+ E LE D+P HLL YPIGV+  G VTELPG + FPDTKA VLG
Sbjct  737  CVQKVNRVAGKYWDLYASELLEHDLPGHLLRYPIGVSSEGDVTELPGTEFFPDTKARVLG  796

Query  155  TKSNF  141
             KS++
Sbjct  797  AKSDY  801



>emb|CDY21865.1| BnaC01g35830D [Brassica napus]
Length=812

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQVHGFRM+LWYEHLGMLD  F  P S+E
Sbjct  681  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRMSLWYEHLGMLDQTFLDPSSLE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IA+  W+ YS E+LE D+P HLL YPI V   G +TELPGF+ FPDTKA +LG
Sbjct  741  CIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPISVDNEGNITELPGFEFFPDTKARILG  800

Query  155  TKSNF  141
             K ++
Sbjct  801  NKVDY  805



>gb|AAL48261.2|AF451979_1 phospholipase D1 [Papaver somniferum]
 gb|AAL48263.2|AF451981_1 phospholipase D1 [Papaver somniferum]
Length=813

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            IN+RSM+GARDSEIAMG YQPHHL+ R+PA GQ+HGFRMALWYEHLGMLD  F  P S E
Sbjct  682  INERSMNGARDSEIAMGGYQPHHLAHREPATGQIHGFRMALWYEHLGMLDEVFLHPNSEE  741

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W+LYS ++LERD+P HLL YPIG+TENG VT LPG + FPDTKA VLG
Sbjct  742  CVQKVNRIADKYWDLYSSDSLERDLPGHLLRYPIGITENGDVTALPGHEFFPDTKARVLG  801

Query  155  TKSNF  141
             KS++
Sbjct  802  GKSDY  806



>ref|XP_002524502.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF37942.1| phopholipase d alpha, putative [Ricinus communis]
Length=725

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS RQ ARGQ+HG RM+LWYEHLG LD+ F  PE++E
Sbjct  594  INQRSMDGARDSEIAMGAYQPYHLSTRQAARGQIHGLRMSLWYEHLGKLDDSFYHPETLE  653

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIA   W+LY+ E LE D+P HLL+YPIGV  NG++TELPG + FPDTKA + G
Sbjct  654  CVRKVNQIATKYWDLYASENLEHDLPGHLLTYPIGVDSNGKITELPGIEFFPDTKAKIFG  713

Query  155  TKSNF  141
            +KS  
Sbjct  714  SKSEL  718



>gb|AHN53202.1| phospholipase D alpha 1-like protein [Cocos nucifera]
Length=813

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP +LS R PARG++HGFRMALWYEHLGMLD+ F  PES+E
Sbjct  682  INQRSMDGARDSEIAMGAYQPFYLSTRGPARGRIHGFRMALWYEHLGMLDDAFLHPESVE  741

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W+LYS + L+RD+P HLLSYPIGV+ +G +TELPG + FPDT+A  LG
Sbjct  742  CVQKVNRIADKYWDLYSSDNLDRDLPGHLLSYPIGVSSDGVITELPGMEFFPDTRARPLG  801

Query  155  TKSNF  141
            TK+++
Sbjct  802  TKTDY  806



>gb|EPS65578.1| hypothetical protein M569_09194 [Genlisea aurea]
Length=808

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDSEIAMGAYQPHHLS R  PARG +HGFR+ALWYEHLGMLD  FA+PES 
Sbjct  676  INQRSMDGARDSEIAMGAYQPHHLSTRSHPARGHIHGFRLALWYEHLGMLDGSFARPESE  735

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV KVN++A+  W+LY+ + LERD+P HLL YP+ V   G VTELPG + FPDTKA VL
Sbjct  736  ECVRKVNEMADKYWDLYASDELERDLPGHLLRYPVAVASEGDVTELPGMEFFPDTKARVL  795

Query  158  GTKSNF  141
            GTKS++
Sbjct  796  GTKSDY  801



>ref|XP_010925209.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
 ref|XP_010925210.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
 ref|XP_010925211.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
Length=810

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP +LS R+P RGQ+HGFR+ALWYEHLGM+D+ F +PES+E
Sbjct  679  INQRSMDGARDSEIAMGAYQPCYLSTREPPRGQIHGFRLALWYEHLGMVDDVFLRPESVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++A+  W LYSG++ +RD+P HLLSYPIGV+  G +TELPG + FPDT+A VLG
Sbjct  739  CVRKVNKVADQYWGLYSGDSPDRDLPGHLLSYPIGVSSAGAITELPGTEYFPDTRARVLG  798

Query  155  TKSNF  141
            TK+++
Sbjct  799  TKTDY  803



>ref|XP_009368855.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=808

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS  +PARGQ+HG RM+LWYEHLG+L++ F +P+++E
Sbjct  677  INQRSMDGARDSEIAMGAYQPYHLSTGKPARGQIHGLRMSLWYEHLGLLNDIFLEPQNVE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+ +W+LYS +TL+ D+P HLLSYPI VTENG+VTELPG + FPDTKA +LG
Sbjct  737  CIRKVNQIADQHWDLYSCDTLDGDLPGHLLSYPIAVTENGEVTELPGTEFFPDTKARILG  796

Query  155  TKSNF  141
            +KS+ 
Sbjct  797  SKSDL  801



>ref|XP_004486668.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Cicer arietinum]
 ref|XP_004486669.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Cicer arietinum]
 ref|XP_004486670.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Cicer arietinum]
Length=809

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+HGFRM+LWYEHLGML + F  PE+ +
Sbjct  678  INQRSMDGARDSEIAMGAYQPYHLANRQPARGQIHGFRMSLWYEHLGMLHDSFLHPETED  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQI +  W+LYS ETLE D+P HLL YPIG++  G VTELPGF+ FPDTKA VLG
Sbjct  738  CIRKVNQIGDKYWDLYSSETLEHDLPGHLLRYPIGISGEGNVTELPGFEFFPDTKARVLG  797

Query  155  TKSNF  141
             K ++
Sbjct  798  EKVDY  802



>ref|XP_009144830.1| PREDICTED: phospholipase D alpha 2 [Brassica rapa]
Length=812

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARG +HGFRM+LWYEHLGMLD  F  P S E
Sbjct  681  INQRSMDGARDSEIAMGGYQPYHLSIRQPARGHIHGFRMSLWYEHLGMLDETFLDPSSQE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W+LY+ E+LE D+P HLL YPIG+   G +TELPG + FPDTKA +LG
Sbjct  741  CVQKVNRIADKYWDLYASESLEHDLPGHLLRYPIGIASQGDITELPGCECFPDTKARILG  800

Query  155  TKSNF  141
            TKS++
Sbjct  801  TKSDY  805



>ref|XP_010479770.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
 ref|XP_010479771.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
 ref|XP_010479772.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
Length=810

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARGQ+HGFRM+LWYEHLGMLD  F +P S E
Sbjct  679  INQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMSLWYEHLGMLDETFLEPSSQE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN++A+  W+LY+ E+LE D+P HLL YPIG+   G +TELPG + FPDTKA +LG
Sbjct  739  CIQKVNRVADKYWDLYASESLEHDLPGHLLRYPIGIASEGNITELPGCEFFPDTKARILG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  VKSDY  803



>ref|XP_002894388.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70647.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S E
Sbjct  679  INQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSQE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN++A+  W+LYS E+LE D+P HLL YPIG+   G +TELPG + FPDTKA +LG
Sbjct  739  CIQKVNRVADKYWDLYSSESLEHDLPGHLLRYPIGIASEGNITELPGCEFFPDTKARILG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  AKSDY  803



>gb|AIE90138.1| phospholipase D1, partial [Brassica napus]
Length=810

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I++  W+LYS E+LE D+P HLL YP+ V     VTE PGF+ FPDTKA +LG
Sbjct  739  CIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPVDVDGESDVTEFPGFEFFPDTKARILG  798

Query  155  TKSNF  141
            TKS++
Sbjct  799  TKSDY  803



>ref|XP_010500864.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010500866.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010500867.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
Length=811

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARGQ+HGFRM+LWYEHLGMLD  F +P S E
Sbjct  680  INQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMSLWYEHLGMLDETFLEPSSQE  739

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN++A+  W+LY+ E+LE D+P HLL YPIG+   G +TELPG + FPDTKA +LG
Sbjct  740  CIQKVNRVADKYWDLYASESLEHDLPGHLLRYPIGIASEGNITELPGCEFFPDTKARILG  799

Query  155  TKSNF  141
             KS++
Sbjct  800  VKSDY  804



>emb|CDX97705.1| BnaA05g23740D [Brassica napus]
Length=810

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPH LS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGGYQPHQLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I++  W+LYS E+LE D+P HLL YP+ V   G VTE PGF+ FPDTKA +LG
Sbjct  739  CIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPVDVDAEGDVTEFPGFEFFPDTKARILG  798

Query  155  TKSNF  141
            TKS++
Sbjct  799  TKSDY  803



>ref|NP_175666.1| phospholipase D alpha 2 [Arabidopsis thaliana]
 sp|Q9SSQ9.1|PLDA2_ARATH RecName: Full=Phospholipase D alpha 2; Short=AtPLDalpha2; Short=PLD 
alpha 2; AltName: Full=Choline phosphatase 2; AltName: 
Full=Phosphatidylcholine-hydrolyzing phospholipase D 2 [Arabidopsis 
thaliana]
 gb|AAD55607.1|AC008016_17 Similar to gb|AF090445 phospholipase D1 from Brassica oleacea 
[Arabidopsis thaliana]
 gb|AEE32825.1| phospholipase D alpha 2 [Arabidopsis thaliana]
Length=810

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S E
Sbjct  679  INQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSQE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN++A+  W+LYS E+LE D+P HLL YPIG+   G +TELPG + FPDTKA +LG
Sbjct  739  CIQKVNRVADKYWDLYSSESLEHDLPGHLLRYPIGIASEGNITELPGCEFFPDTKARILG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  VKSDY  803



>ref|XP_006306783.1| hypothetical protein CARUB_v10008323mg, partial [Capsella rubella]
 gb|EOA39681.1| hypothetical protein CARUB_v10008323mg, partial [Capsella rubella]
Length=813

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S E
Sbjct  682  INQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSQE  741

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN++A+  W+LYS E+LE D+P HLL YPIG+   G +TELPG + FPDTKA +LG
Sbjct  742  CIQKVNRVADKYWDLYSSESLEHDLPGHLLRYPIGIASEGNITELPGCEFFPDTKARILG  801

Query  155  TKSNF  141
             KS++
Sbjct  802  VKSDY  806



>ref|XP_010462102.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
 ref|XP_010462103.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
 ref|XP_010462104.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
Length=810

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARGQ+HGFRM+LWYEHLGMLD  F +P S E
Sbjct  679  INQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMSLWYEHLGMLDETFLEPSSQE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN++A+  W+LY+ E+LE D+P HLL YPIG+   G +TELPG + FPDTKA +LG
Sbjct  739  CIQKVNRVADKYWDLYASESLEHDLPGHLLRYPIGIASEGNITELPGCEFFPDTKARILG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  VKSDY  803



>ref|NP_001234863.1| phospholipase PLDa2 [Solanum lycopersicum]
 gb|AAG45486.1| phospholipase PLDa2 [Solanum lycopersicum]
Length=806

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP HL  ++PARGQVHGFRMALWYEHLGMLD+ F QPES+E
Sbjct  676  INQRSMDGARDSEIAMGAYQPFHLCVKEPARGQVHGFRMALWYEHLGMLDDRFLQPESVE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I    W++YS E L  D+P HLL+YPIG+TE G++TELPG + FPDT APVLG
Sbjct  736  CIRKVNKIGAKYWDMYSSERLIHDLPGHLLTYPIGITEIGEITELPG-RMFPDTMAPVLG  794

Query  155  TKSNF  141
            T SNF
Sbjct  795  TISNF  799



>ref|XP_009146200.1| PREDICTED: phospholipase D alpha 1 [Brassica rapa]
Length=810

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPH LS RQPARGQ+HGFRM+LWYEHLGMLD  F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGGYQPHQLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+I++  W+LYS E+LE D+P HLL YP+ V   G VTE PGF+ FPDTKA +LG
Sbjct  739  CIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPVDVDAEGDVTEFPGFEFFPDTKARILG  798

Query  155  TKSNF  141
            TKS++
Sbjct  799  TKSDY  803



>ref|XP_010500868.1| PREDICTED: phospholipase D alpha 2-like isoform X2 [Camelina 
sativa]
Length=811

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HLS RQPARGQ+HGFRM+LWYEHLGMLD  F +P S E
Sbjct  680  INQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMSLWYEHLGMLDETFLEPSSRE  739

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN++A+  W+LY+ E+LE D+P HLL YPIG+   G +TELPG + FPDTKA +LG
Sbjct  740  CIQKVNRVADKYWDLYASESLEHDLPGHLLRYPIGIASEGNITELPGCEFFPDTKARILG  799

Query  155  TKSNF  141
             KS++
Sbjct  800  VKSDY  804



>sp|P55939.2|PLDA2_BRAOC RecName: Full=Phospholipase D alpha 2; Short=PLD 2; AltName: 
Full=Choline phosphatase 2; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 2; Flags: Precursor [Brassica 
oleracea var. capitata]
 gb|AAC78486.1| phospholipase D2 [Brassica oleracea var. capitata]
 gb|AAC79125.1| phospholipase D [Brassica oleracea var. capitata]
 gb|AAD17209.1| phospholipase D2 [Brassica oleracea var. capitata]
Length=812

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQVHGFRM+LWYEHLGMLD  F  P S+E
Sbjct  681  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRMSLWYEHLGMLDETFLDPSSLE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IA+  W+ YS E+LE D+P HLL YPI V   G +TELPGF+ FPD+KA +LG
Sbjct  741  CIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPISVDNEGNITELPGFEFFPDSKARILG  800

Query  155  TKSNF  141
             K ++
Sbjct  801  NKVDY  805



>ref|XP_010090252.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB39153.1| Phospholipase D alpha 1 [Morus notabilis]
Length=788

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARD+EIAMGAYQPH LS  +PARGQ+HG R+ALWYEH+G LD  F +PES+E
Sbjct  657  INQRSMDGARDTEIAMGAYQPHRLSTTEPARGQIHGHRLALWYEHMGKLDGIFLKPESVE  716

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVNQIAENNW+LYS ET + D+P+HLLSYPI V ENG+VT LP  + FPDTKA VLG
Sbjct  717  CVRKVNQIAENNWDLYSCETFDDDLPSHLLSYPIRVNENGEVTTLPNTEYFPDTKARVLG  776

Query  155  TKSNF  141
            +KS  
Sbjct  777  SKSEI  781



>gb|AGV22364.1| phospholipase D4 [Brassica napus]
Length=812

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQVHGFRM+LWYEHLGMLD  F  P S+E
Sbjct  681  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRMSLWYEHLGMLDETFLDPSSLE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IA+  W+ YS E+LE D+P HLL YPI V   G ++ELPGF+ FPDTKA +LG
Sbjct  741  CIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPISVDNEGNISELPGFEFFPDTKARILG  800

Query  155  TKSNF  141
             K ++
Sbjct  801  NKVDY  805



>ref|XP_009115281.1| PREDICTED: phospholipase D alpha 2 [Brassica rapa]
Length=812

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQVHGFRM+LWYEHLGMLD  F  P S+E
Sbjct  681  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRMSLWYEHLGMLDETFLDPSSLE  740

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IA+  W+ YS E+LE D+P HLL YPI V   G ++ELPGF+ FPDTKA +LG
Sbjct  741  CIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPISVDNEGNISELPGFEFFPDTKARILG  800

Query  155  TKSNF  141
             K ++
Sbjct  801  NKVDY  805



>ref|XP_010907269.1| PREDICTED: phospholipase D alpha 1 [Elaeis guineensis]
 ref|XP_010907270.1| PREDICTED: phospholipase D alpha 1 [Elaeis guineensis]
Length=813

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP +LS R  ARG++HGFRMALWYEHLGMLD+ F  PES+E
Sbjct  682  INQRSMDGARDSEIAMGAYQPFYLSTRGLARGRIHGFRMALWYEHLGMLDDAFLHPESVE  741

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W+LYS + L+RD+P HLLSYPIGV+ +G +TELPG + FPDT+A VLG
Sbjct  742  CVQKVNRIADKYWDLYSSDNLDRDLPGHLLSYPIGVSSDGVITELPGMEFFPDTRARVLG  801

Query  155  TKSNF  141
            TK+++
Sbjct  802  TKADY  806



>gb|AAC49274.1| phospholipase D [Arabidopsis thaliana]
Length=809

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQPHHLS RQPARGQ+HGFRM+LWYEHLGMLD  F  P+  E
Sbjct  678  INQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPKLSE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
             + KVN+I++  W+ YS E+LE D+P HLL YPIGV   G +TELPGF+ FPDTKA +LG
Sbjct  738  SIEKVNRISDKYWDFYSSESLEHDLPGHLLRYPIGVASEGDITELPGFEFFPDTKARILG  797

Query  155  TKSNF  141
            TKS++
Sbjct  798  TKSDY  802



>ref|XP_008805616.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
 ref|XP_008805617.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
Length=810

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP +LSAR+PARGQ+HGFR+ALWYEHLGMLD+ F  PES+E
Sbjct  679  INQRSMDGARDSEIAMGAYQPCYLSAREPARGQIHGFRLALWYEHLGMLDDVFLHPESVE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++A+  W LYS +  +RD+P HLL+YPIGV+ +G +TELPG + FPDT+A VLG
Sbjct  739  CVRKVNKVADQYWALYSSDNPDRDLPGHLLAYPIGVSSDGAITELPGMEFFPDTRARVLG  798

Query  155  TKSNF  141
            T +++
Sbjct  799  TNTDY  803



>ref|XP_008385550.1| PREDICTED: phospholipase D alpha 1-like [Malus domestica]
Length=809

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS  +PARGQ+HG RM+LWYEHLG+LD+ F +PE++E
Sbjct  678  INQRSMDGARDSEIAMGAYQPYHLSTGKPARGQIHGLRMSLWYEHLGLLDDTFLEPENVE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C  KVNQIA+ +W+LYS +TL+ D+P HLLSYPI  TE+G+VTELPG + FPDTKA +LG
Sbjct  738  CFRKVNQIADQHWDLYSCDTLDGDLPGHLLSYPIAXTEDGEVTELPGTEFFPDTKARILG  797

Query  155  TKSNF  141
            +KS+ 
Sbjct  798  SKSDL  802



>ref|XP_007150746.1| hypothetical protein PHAVU_005G177300g [Phaseolus vulgaris]
 gb|ESW22740.1| hypothetical protein PHAVU_005G177300g [Phaseolus vulgaris]
Length=807

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL   QPARGQ+HGFRM+LWYEHLGML + F  PES E
Sbjct  676  INQRSMDGARDSEIAMGAYQPYHLITSQPARGQIHGFRMSLWYEHLGMLHDSFLYPESTE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA   W+LYS E+LE D+P HLL YP+GV+  G VTELPGF+ FPDTKA VLG
Sbjct  736  CIGKVNQIANKYWDLYSSESLEHDLPGHLLRYPVGVSSEGIVTELPGFEFFPDTKARVLG  795

Query  155  TKSNF  141
             K ++
Sbjct  796  DKVDY  800



>ref|XP_010691149.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=809

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDSEIAMGAYQPHHL  R Q A+GQ+HGFRMALWYEHLGMLD+ F +PES 
Sbjct  677  INQRSMDGARDSEIAMGAYQPHHLVTRNQRAQGQIHGFRMALWYEHLGMLDDSFKRPESS  736

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            +C  KVN+ A+  W+LYS E+LERD+P HLL YPIGV+  G V+ELPGF+ FPDTKA VL
Sbjct  737  DCAEKVNRSADKYWDLYSSESLERDLPGHLLRYPIGVSSEGDVSELPGFEFFPDTKARVL  796

Query  158  GTKSNF  141
            G KS++
Sbjct  797  GVKSDY  802



>ref|XP_010695892.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=183

 Score =   181 bits (459),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDS+IA+GAYQPHHL  R Q A+GQ+HGFRMALWYEHLGMLD+   +PES 
Sbjct  51   INQRSMDGARDSKIAIGAYQPHHLVTRNQRAQGQIHGFRMALWYEHLGMLDDSLKRPESS  110

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            EC  KVN+ A+  W+LYS ++ ERD+P HLL YPIGV+  G V+ELPGF+ F +TKA VL
Sbjct  111  ECAEKVNRSADKYWDLYSSKSPERDLPGHLLHYPIGVSSEGYVSELPGFEFFSNTKARVL  170

Query  158  GTKSNF  141
            G KS++
Sbjct  171  GVKSDY  176



>ref|XP_011081358.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
Length=807

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL+ R+PARGQVHGFRMALWYEHLGMLD+ F QP+S +
Sbjct  676  INQRSMDGARDSEIAMGGYQPYHLATRRPARGQVHGFRMALWYEHLGMLDDSFVQPQSEQ  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++A+  W+LY+ + L+ D+P HLL YPIG+  +G VTELPG + FPDTKA +LG
Sbjct  736  CVRKVNEMADKYWDLYASDQLQSDLPGHLLRYPIGIASSGAVTELPGQEFFPDTKARILG  795

Query  155  TKSNF  141
             KS++
Sbjct  796  AKSDY  800



>ref|XP_002325225.2| hypothetical protein POPTR_0018s13110g [Populus trichocarpa]
 gb|EEF03790.2| hypothetical protein POPTR_0018s13110g [Populus trichocarpa]
Length=808

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG RD+EIAMGAYQP+HL+  QPARGQ+HGFRM+LWYEHLG LD+ F  PES+E
Sbjct  677  INQRSMDGGRDTEIAMGAYQPYHLATNQPARGQIHGFRMSLWYEHLGQLDDTFCHPESLE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN IAE NW+LYS E L+ D+P HLL+YPIGVT NG++TEL G + FP TKA V G
Sbjct  737  CVRKVNHIAEKNWHLYSSEVLDDDLPGHLLAYPIGVTSNGELTELQGTEFFPGTKARVFG  796

Query  155  TKSNF  141
            +KS  
Sbjct  797  SKSEL  801



>dbj|BAE79735.1| phospholipase D alpha 2 [Arachis hypogaea]
 dbj|BAE79737.1| phospholipase D alpha 2 [Arachis hypogaea]
Length=807

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP++LSAR+ ARGQ+HGFR+ALWYEHLGM+   F QPES E
Sbjct  676  INQRSMDGARDSEIAMGAYQPYYLSARELARGQIHGFRLALWYEHLGMIRESFLQPESEE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+  VNQ+A+  W+LYS E+L+ D+P HLL YP+G++ +G VTELPGF+ FPDTK  VLG
Sbjct  736  CIKMVNQVADKYWDLYSSESLDHDLPGHLLRYPVGISGDGTVTELPGFEFFPDTKGRVLG  795

Query  155  TKSNF  141
            TK+++
Sbjct  796  TKTDY  800



>gb|KHN22450.1| Phospholipase D alpha 1 [Glycine soja]
Length=608

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSE+AMGAYQP+HL+ +QPARGQ+HGFRM+LWYEHLG+L + F  PES E
Sbjct  477  INQRSMDGARDSEVAMGAYQPYHLATKQPARGQIHGFRMSLWYEHLGLLHDSFLHPESEE  536

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVNQIA+  W+LY+ E LE+D+P HLL YP+ ++  G VT+L  F+ FPDTKAP+LG
Sbjct  537  CIEKVNQIADKYWDLYTTEPLEQDLPGHLLRYPVAISSQGNVTQLQAFEFFPDTKAPILG  596

Query  155  TKSNF  141
             KS++
Sbjct  597  AKSDY  601



>ref|XP_010687988.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687989.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=806

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            IN+RSM+GARDSEIAMGAYQP+H+ +R +PARGQVHGFRM+LWYEHLGMLDN F +PES+
Sbjct  674  INERSMNGARDSEIAMGAYQPYHICSRNEPARGQVHGFRMSLWYEHLGMLDNAFLEPESL  733

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV KVNQ A   W+LY+ E LE D+P HLL YPI +TE G+V ELPG+  FPDTKA V+
Sbjct  734  ECVRKVNQTATKYWDLYTSEALEYDLPGHLLKYPISITEEGEVVELPGWDCFPDTKARVI  793

Query  158  GTKS  147
            GTKS
Sbjct  794  GTKS  797



>gb|EYU21635.1| hypothetical protein MIMGU_mgv1a001489mg [Erythranthe guttata]
 gb|EYU21636.1| hypothetical protein MIMGU_mgv1a001489mg [Erythranthe guttata]
Length=809

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRS+DGARDSEIAMGAYQPHHL+  +PA GQVHGFRMALWYEHLGMLD+ F  PES E
Sbjct  678  INQRSLDGARDSEIAMGAYQPHHLATHEPAMGQVHGFRMALWYEHLGMLDDTFLHPESEE  737

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN IA+  W+LY+ + LERD+P HLL YP+ ++  G +TELPG + FPDTKA VLG
Sbjct  738  CVSKVNGIADKYWDLYASDELERDLPGHLLRYPVALSSEGVITELPGMEFFPDTKARVLG  797

Query  155  TKSNF  141
             KS++
Sbjct  798  AKSDY  802



>gb|ABU54776.1| phospholipase D alpha 1 precursor [Helianthus annuus]
Length=810

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDSEIAMGAYQP+HLS R +PARGQ+HGFRMALWYEHLGMLD+ F  PES 
Sbjct  678  INQRSMDGARDSEIAMGAYQPYHLSTRSEPARGQIHGFRMALWYEHLGMLDDTFQNPEST  737

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV KVN +A+  W+L++ E LE+D+P HLL YPIGV   G VTELPG + FPDTKA VL
Sbjct  738  ECVKKVNHMADKYWDLFASENLEQDLPGHLLRYPIGVASEGNVTELPGTEFFPDTKARVL  797

Query  158  GTKSNF  141
            G K ++
Sbjct  798  GGKVDY  803



>ref|XP_008242775.1| PREDICTED: phospholipase D alpha 1-like [Prunus mume]
Length=807

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARD+EIAMGAYQPHHLS R  ARGQ+HG R+ALWYEHLG+LD+ F +PES++
Sbjct  675  INQRSMDGARDTEIAMGAYQPHHLSTRGAARGQIHGLRLALWYEHLGLLDDTFLEPESVK  734

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGV-TENGQVTELPGFQNFPDTKAPVL  159
            C+ KVNQIAE +W+L+S ETL+ D+P HLLSYPI V   NG++TELPG + FPDTKA VL
Sbjct  735  CIRKVNQIAEKHWDLFSCETLDGDLPGHLLSYPIRVAAANGEITELPGTEFFPDTKARVL  794

Query  158  GTKSNF  141
            G+KS  
Sbjct  795  GSKSEL  800



>ref|XP_006364210.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
Length=811

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 108/128 (84%), Gaps = 3/128 (2%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLS-ARQPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDSEIA+GAYQPH+L+ +RQPARGQVHGFRMALWYEH+GMLD+ F  PES 
Sbjct  677  INQRSMDGARDSEIAIGAYQPHNLTTSRQPARGQVHGFRMALWYEHMGMLDDTFQHPESE  736

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQN--FPDTKAP  165
            +CV KVN+IA+  W+LY+ E LE D+P HLL YPIG+T +G++T+LPG  N  FPDTKA 
Sbjct  737  DCVRKVNEIADKYWDLYTSERLETDLPGHLLRYPIGLTNDGEITDLPGNGNEYFPDTKAK  796

Query  164  VLGTKSNF  141
            V+GTKS+ 
Sbjct  797  VVGTKSDL  804



>ref|XP_008777837.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
Length=859

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG RDSEIAMGAYQP++L+ RQP +GQ+HGFR+ALWYEHLGMLD+ F +P+S+E
Sbjct  728  INQRSMDGGRDSEIAMGAYQPNYLATRQPVKGQIHGFRLALWYEHLGMLDDTFLRPQSIE  787

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IAE NW LY+ + L  D+P+HLLSYP+GVTE+G++ EL G + FPDT+A VLG
Sbjct  788  CMRKVNKIAERNWGLYTSDMLVSDLPSHLLSYPLGVTEDGEMMELHGMEFFPDTRARVLG  847

Query  155  TKSNF  141
            TKS++
Sbjct  848  TKSDY  852



>ref|XP_006364211.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
Length=805

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 108/128 (84%), Gaps = 3/128 (2%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLS-ARQPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDSEIA+GAYQPH+L+ +RQPARGQVHGFRMALWYEH+GMLD+ F  PES 
Sbjct  671  INQRSMDGARDSEIAIGAYQPHNLTTSRQPARGQVHGFRMALWYEHMGMLDDTFQHPESE  730

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQN--FPDTKAP  165
            +CV KVN+IA+  W+LY+ E LE D+P HLL YPIG+T +G++T+LPG  N  FPDTKA 
Sbjct  731  DCVRKVNEIADKYWDLYTSERLETDLPGHLLRYPIGLTNDGEITDLPGNGNEYFPDTKAK  790

Query  164  VLGTKSNF  141
            V+GTKS+ 
Sbjct  791  VVGTKSDL  798



>dbj|BAJ93878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=783

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP HL+  +PARGQVHGFRMALWYEHLGM+D  F +PES+E
Sbjct  652  INQRSMDGARDSEIAMGAYQPCHLATSRPARGQVHGFRMALWYEHLGMVDEAFQRPESLE  711

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN +A+  W+LY+G+  ERD+P HLL+YP+ VT +G VT+LPG + FPDT+A +LG
Sbjct  712  CVHKVNAMADRYWDLYAGDGPERDLPGHLLTYPVSVTGDGSVTQLPGVEFFPDTEARILG  771

Query  155  TKSNF  141
             KS++
Sbjct  772  AKSDY  776



>ref|XP_004235964.1| PREDICTED: phospholipase D alpha 1 [Solanum lycopersicum]
Length=811

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSA-RQPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDSEIA+GAYQPH+LS  RQPARGQ+HGFRMALWYEH+GMLD+ F  PES 
Sbjct  677  INQRSMDGARDSEIAIGAYQPHNLSTNRQPARGQIHGFRMALWYEHMGMLDDTFQHPESE  736

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQN--FPDTKAP  165
            +CV KVN IA+  W+LY+ E+LE D+P HLL YP+G+T +G++T+LPG  N  FPDTKA 
Sbjct  737  DCVRKVNGIADKYWDLYTSESLETDLPGHLLRYPVGLTNDGEITDLPGNGNEYFPDTKAK  796

Query  164  VLGTKSNF  141
            V+GTKS+ 
Sbjct  797  VIGTKSDL  804



>ref|XP_007204652.1| hypothetical protein PRUPE_ppa001528mg [Prunus persica]
 gb|EMJ05851.1| hypothetical protein PRUPE_ppa001528mg [Prunus persica]
Length=807

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARD+EIAMGAYQP+HLS R+ ARGQ+HG R+ALWYEHLG+LD+ F +PES++
Sbjct  675  INQRSMDGARDTEIAMGAYQPYHLSTREAARGQIHGLRLALWYEHLGLLDDTFLEPESVK  734

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGV-TENGQVTELPGFQNFPDTKAPVL  159
            C+ KVNQIAE +W+L+S ETL+ D+P HLLSYPI V   NG++TELPG + FPDTKA VL
Sbjct  735  CIRKVNQIAEKHWDLFSCETLDGDLPGHLLSYPIRVAAANGEITELPGTEFFPDTKARVL  794

Query  158  GTKSNF  141
            G+KS  
Sbjct  795  GSKSEL  800



>ref|XP_003568837.1| PREDICTED: phospholipase D alpha 1-like [Brachypodium distachyon]
Length=822

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP HL+A +PARGQVHGFRMALWYEHLGM+D  F +PES+E
Sbjct  690  INQRSMDGARDSEIAMGAYQPGHLAATRPARGQVHGFRMALWYEHLGMVDEAFQRPESLE  749

Query  335  CVLKVNQIAENNWNLYSGET-LERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            CV KVN +A+  W+LY+G+   +RD+P HLL+YP+GVT +G VT+LPG + FPDT+A +L
Sbjct  750  CVHKVNAMADRYWDLYAGDDGADRDLPGHLLTYPVGVTADGAVTQLPGVEFFPDTQARIL  809

Query  158  GTKSNF  141
            G KS++
Sbjct  810  GAKSDY  815



>ref|XP_006654096.1| PREDICTED: phospholipase D alpha 1-like [Oryza brachyantha]
Length=818

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDSEIAMGAYQPHHL+A  +PARGQVHGFRMALWYEHLG +D+ F +PES+
Sbjct  686  INQRSMDGARDSEIAMGAYQPHHLAAAGRPARGQVHGFRMALWYEHLGTVDDAFQRPESV  745

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            +CV KVN +A+  W+LY+G+  ERD+P HLL+YP+GV  +G +T+LPG + FPDT+A VL
Sbjct  746  DCVRKVNAMAKRCWDLYAGDGPERDLPGHLLTYPVGVASDGTITQLPGVEFFPDTEARVL  805

Query  158  GTKSNF  141
            G KS++
Sbjct  806  GAKSDY  811



>sp|Q70EW5.2|PLDA1_CYNCA RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Cynara cardunculus]
 emb|CAE47482.2| phospholipase D alpha [Cynara cardunculus]
Length=808

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ + PARG VHGFRMALWYEHLGMLD+ F +PE+ +
Sbjct  677  INQRSMDGARDSEIAMGAYQPYHLATQTPARGHVHGFRMALWYEHLGMLDDSFERPENKD  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV K N++A+  W+LY+ E L+RD+P HLL YP+GVT  G +TELPG + FPDT A +LG
Sbjct  737  CVNKANEMADKCWDLYASEDLDRDLPGHLLRYPVGVTRKGDITELPGTECFPDTSARILG  796

Query  155  TKSNF  141
             KS++
Sbjct  797  AKSDY  801



>ref|XP_010669918.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=128

 Score =   176 bits (446),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = -2

Query  500  MDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESMECVLK  324
            MDGARDSEI MGAYQ HHL  R Q  +GQ+HGFRMALWYEHLGMLD+ F +P+S EC  K
Sbjct  1    MDGARDSEITMGAYQSHHLVTRNQREQGQIHGFRMALWYEHLGMLDDSFKRPKSSECAEK  60

Query  323  VNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLGTKSN  144
            VN+ A+  W+LYS E+LERD+  HLL YPIGV+  G V+ELPGF+ FPDTKA VLG KS+
Sbjct  61   VNRSADKYWDLYSSESLERDLSGHLLRYPIGVSSEGDVSELPGFEFFPDTKARVLGVKSD  120

Query  143  F  141
            +
Sbjct  121  Y  121



>ref|XP_007150745.1| hypothetical protein PHAVU_005G177200g [Phaseolus vulgaris]
 gb|ESW22739.1| hypothetical protein PHAVU_005G177200g [Phaseolus vulgaris]
Length=808

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG RD+EIAMGAYQP+HL  R+PARG++HGFRM+LWYEH+GMLD  F  PES E
Sbjct  677  INQRSMDGGRDTEIAMGAYQPYHLGGRKPARGEIHGFRMSLWYEHVGMLDESFLHPESEE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV K+N++ +  W+LY+ E LE+D+P HLL YPI V+  G VT+L GF+ FPDTKAPVLG
Sbjct  737  CVKKINEMGDKYWDLYTTEPLEQDLPGHLLRYPIAVSGEGSVTQLKGFEFFPDTKAPVLG  796

Query  155  TKSNF  141
             KS++
Sbjct  797  VKSDY  801



>gb|KDP33597.1| hypothetical protein JCGZ_07168 [Jatropha curcas]
Length=238

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGA+QPHHL+  QPARGQ++GFR+ALWYEHLG+L+  F  PES E
Sbjct  107  INQRSMDGARDSEIAMGAFQPHHLATAQPARGQIYGFRLALWYEHLGLLEPSFQYPESEE  166

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+  VN+IA+  W  YS E  ++D+  HLL YPI +T NG VT LPGF++FPDTKA +LG
Sbjct  167  CIQLVNKIADELWESYSSEVFDQDLIGHLLRYPIEITNNGTVTTLPGFEHFPDTKARILG  226

Query  155  TKSNF  141
              S F
Sbjct  227  NISEF  231



>ref|XP_002308663.2| hypothetical protein POPTR_0006s27000g [Populus trichocarpa]
 gb|EEE92186.2| hypothetical protein POPTR_0006s27000g [Populus trichocarpa]
Length=771

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG+RDSEIAMG YQPHHL+  QPARGQ++GFRMALWYEHLGMLD  F  PES++
Sbjct  640  INQRSMDGSRDSEIAMGGYQPHHLATSQPARGQIYGFRMALWYEHLGMLDPSFQHPESVQ  699

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+  VNQ+A  NW  Y+ ETLE+D+ +HLL YPI V  NG VT LPG  +FPDTKA VLG
Sbjct  700  CIQLVNQVANENWEKYASETLEQDLMSHLLRYPIQVGNNGIVTTLPGVNHFPDTKANVLG  759

Query  155  TKSNF  141
            TKS++
Sbjct  760  TKSDY  764



>ref|XP_009407292.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
Length=815

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG RDSEI MGAYQP+HLS  +PARGQ+HGFRMALWYEHLG+LD+ F  PES+ 
Sbjct  684  INQRSMDGGRDSEIVMGAYQPYHLSTTEPARGQIHGFRMALWYEHLGVLDDDFLHPESLH  743

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN IAE  W+L++GE  + D+P HLL YPIGVT +G +T+LPGF+ FPDT+  VLG
Sbjct  744  CVQKVNNIAELYWDLFTGERQDGDLPGHLLPYPIGVTYDGSITQLPGFEFFPDTRGRVLG  803

Query  155  TKSNF  141
            TKS +
Sbjct  804  TKSAY  808



>gb|EYU23016.1| hypothetical protein MIMGU_mgv1a001487mg [Erythranthe guttata]
Length=810

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HLS   PARG+++G RMALWYEH+G+LD+ F  P S+E
Sbjct  679  INQRSMDGARDSEIAMGAYQPYHLSFTSPARGEIYGLRMALWYEHMGLLDDSFCHPHSIE  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ +VN+I + NW+LY+ E LE+D+P HLLSYPIGV+  G VTELPG + FPDTKA VLG
Sbjct  739  CIQRVNKIGQKNWDLYTKEDLEKDLPGHLLSYPIGVSSEGTVTELPGMEYFPDTKARVLG  798

Query  155  TKSNF  141
            + + +
Sbjct  799  SVAEY  803



>gb|AAU44332.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAY96710.1| hypothetical protein OsI_18631 [Oryza sativa Indica Group]
 dbj|BAH00843.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62492.1| hypothetical protein OsJ_17289 [Oryza sativa Japonica Group]
Length=824

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDSEIAMGAYQPHHL+A  +PARGQVHGFRMALWYEHLG +D  F +PES+
Sbjct  692  INQRSMDGARDSEIAMGAYQPHHLAAAGRPARGQVHGFRMALWYEHLGTVDEAFQRPESL  751

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            +CV KVN +A+  W+LY+G+  ERD+P HLL+YP+GV  +G +T+LPG + FPDT+A +L
Sbjct  752  DCVRKVNAMADRCWDLYAGDGPERDLPGHLLTYPVGVAGDGTITQLPGVEFFPDTQARIL  811

Query  158  GTKSNF  141
            G KS++
Sbjct  812  GAKSDY  817



>emb|CAB43062.1| phospholipase D2 [Craterostigma plantagineum]
Length=807

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGAYQP+HL+ R  ARGQ+HGFRMALWYEHLGMLD  F +PE+ E
Sbjct  676  INQRSMDGARDSEIAMGAYQPYHLNTRNRARGQIHGFRMALWYEHLGMLDEAFLEPENEE  735

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN+IA+  W LY+ E LE D+P HLL YP+ +  +G VTELPG + FPDTKA VLG
Sbjct  736  CVRKVNEIADRYWELYASEELENDLPGHLLRYPVEIAGDGGVTELPGAEFFPDTKARVLG  795

Query  155  TKSNF  141
             KS++
Sbjct  796  AKSDY  800



>gb|EMT24153.1| Phospholipase D alpha 1 [Aegilops tauschii]
Length=906

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP HL+  +PARGQVHGFRMALWYEHLGM+D  F +PES+E
Sbjct  630  INQRSMDGARDSEIAMGGYQPGHLATSRPARGQVHGFRMALWYEHLGMMDEAFQRPESLE  689

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN +AE  W+LY+ +  ERD+P HLL+YP+ VT +G VT+LPG + FPDT+A +LG
Sbjct  690  CVHKVNAMAERYWDLYAADGPERDLPGHLLTYPVSVTGDGSVTQLPGVEFFPDTEARILG  749

Query  155  TKSNF  141
             KS++
Sbjct  750  GKSDY  754



>ref|XP_011017763.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011017764.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=831

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG RD+EIA GAYQP+HL+  QPARGQ+HGFRM+LW+EHLG LD+ F  PES+E
Sbjct  700  INQRSMDGGRDTEIATGAYQPYHLATNQPARGQIHGFRMSLWHEHLGQLDDTFCHPESLE  759

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN +AE NW+LYS E L+ D+P HLL+YPIGVT NG++TEL G + FP TKA V G
Sbjct  760  CVRKVNHMAEKNWHLYSSEVLDDDLPGHLLAYPIGVTSNGELTELQGTEFFPGTKARVFG  819

Query  155  TKSNF  141
            +KS  
Sbjct  820  SKSEL  824



>ref|XP_008650412.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
Length=733

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSA-RQPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDSEIAMGAYQPHHL+A  +PARGQVHGFRM+LWYEHLG +D+ F +P+S+
Sbjct  601  INQRSMDGARDSEIAMGAYQPHHLAAASRPARGQVHGFRMSLWYEHLGAVDDAFTRPDSV  660

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            EC+ KVN +A+  W+LY+G+  ERD+P HLL+YP+ V  +G V +LPG + FPDT+A VL
Sbjct  661  ECIRKVNAMADRYWDLYAGDGPERDLPGHLLTYPVAVGTDGSVNQLPGMEFFPDTQARVL  720

Query  158  GTKSNF  141
            G KS++
Sbjct  721  GAKSDY  726



>ref|XP_008649399.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
 ref|XP_008649400.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
Length=821

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSA-RQPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDSEIAMGAYQPHHL+A  +PARGQVHGFRM+LWYEHLG +D+ F +P+S+
Sbjct  689  INQRSMDGARDSEIAMGAYQPHHLAAASRPARGQVHGFRMSLWYEHLGAVDDAFTRPDSV  748

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            EC+ KVN +A+  W+LY+G+  ERD+P HLL+YP+ V  +G V +LPG + FPDT+A VL
Sbjct  749  ECIRKVNAMADRYWDLYAGDGPERDLPGHLLTYPVAVGTDGSVNQLPGMEFFPDTQARVL  808

Query  158  GTKSNF  141
            G KS++
Sbjct  809  GAKSDY  814



>ref|XP_011039694.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011039695.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=820

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG+RDSEIAMG YQP HL+  QPARGQ++GFRMALW+EHLGMLD+ F  PES++
Sbjct  688  INQRSMDGSRDSEIAMGGYQPRHLATSQPARGQIYGFRMALWHEHLGMLDSSFEHPESVQ  747

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQN-FPDTKAPVL  159
            C+ KVNQ+A +NW  Y+ ETLE+D+ +HLL YPI V  NG VT LPG  N FPDTKA VL
Sbjct  748  CIQKVNQVANDNWEKYTSETLEQDLMSHLLRYPIQVGNNGIVTTLPGAVNHFPDTKANVL  807

Query  158  GTKSNF  141
            GTKS++
Sbjct  808  GTKSDY  813



>gb|AFW77332.1| phospholipase D family protein [Zea mays]
Length=925

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSA-RQPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARDSEIAMGAYQPHHL+A  +PARGQVHGFRM+LWYEHLG +D+ F +P+S+
Sbjct  793  INQRSMDGARDSEIAMGAYQPHHLAAASRPARGQVHGFRMSLWYEHLGAVDDAFTRPDSV  852

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            EC+ KVN +A+  W+LY+G+  ERD+P HLL+YP+ V  +G V +LPG + FPDT+A VL
Sbjct  853  ECIRKVNAMADRYWDLYAGDGPERDLPGHLLTYPVAVGTDGSVNQLPGMEFFPDTQARVL  912

Query  158  GTKSNF  141
            G KS++
Sbjct  913  GAKSDY  918



>dbj|BAJ85695.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96017.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=820

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGA+QPHHL+A+ Q ARGQVHGFRM+LWYEHLGML N F  P S+
Sbjct  688  INQRSMDGGRDSEIAMGAFQPHHLNAKGQVARGQVHGFRMSLWYEHLGMLHNDFVSPGSL  747

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VN++A+  W+LY+ + L  D+P HLL+YP+ VT++G VTELPG + FPDT+APVL
Sbjct  748  ECVQRVNKMADKYWDLYASDELNDDLPGHLLTYPVAVTKDGTVTELPGARCFPDTQAPVL  807

Query  158  GTKSN  144
            G KS 
Sbjct  808  GIKSK  812



>dbj|BAJ94103.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=820

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGA+QPHHL+A+ Q ARGQVHGFRM+LWYEHLGML N F  P S+
Sbjct  688  INQRSMDGGRDSEIAMGAFQPHHLNAKGQVARGQVHGFRMSLWYEHLGMLHNDFVSPGSL  747

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VN++A+  W+LY+ + L  D+P HLL+YP+ VT++G VTELPG + FPDT+APVL
Sbjct  748  ECVQRVNKMADKYWDLYASDELNDDLPGHLLTYPVAVTKDGTVTELPGARCFPDTQAPVL  807

Query  158  GTKSN  144
            G KS 
Sbjct  808  GIKSK  812



>gb|KDP32412.1| hypothetical protein JCGZ_13337 [Jatropha curcas]
Length=810

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 102/127 (80%), Gaps = 2/127 (2%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQ--PARGQVHGFRMALWYEHLGMLDNCFAQPES  342
            INQRSMDGARD+EIAMGAYQPH+L+  +   ARGQVHG RM+LWYEHLGMLD+ F+QPE+
Sbjct  677  INQRSMDGARDTEIAMGAYQPHYLATNEQAAARGQVHGLRMSLWYEHLGMLDDSFSQPET  736

Query  341  MECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPV  162
            +ECV KVN IA   W+LY+ + L  D+P HLL+YPIGVT NG++ E+PG + FPDTKA V
Sbjct  737  LECVRKVNLIASKYWDLYTSDNLVHDLPGHLLTYPIGVTHNGELIEIPGAEFFPDTKAHV  796

Query  161  LGTKSNF  141
             G+KS  
Sbjct  797  FGSKSEL  803



>ref|XP_008219493.1| PREDICTED: phospholipase D alpha 1-like [Prunus mume]
Length=806

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG+RDSEIAMGA+QP HL+   PARGQ++ FR++LW+EHL + DN FA PES+E
Sbjct  675  INQRSMDGSRDSEIAMGAFQPEHLATTDPARGQIYAFRLSLWFEHLRVPDNSFAHPESLE  734

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV +VNQIA+ NW+LYS  TL +D+P HLL YP+ V++ G +T LPGF++FPDTKA + G
Sbjct  735  CVRRVNQIAQKNWDLYSSATLHQDLPGHLLRYPVEVSKTGDLTTLPGFEHFPDTKARIFG  794

Query  155  TKSNF  141
             KS +
Sbjct  795  NKSEY  799



>ref|XP_003563661.1| PREDICTED: phospholipase D alpha 2-like [Brachypodium distachyon]
Length=823

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGA+QPHHL+   Q ARGQ+HGFRM+LWYEHLGML + F +P S+
Sbjct  691  INQRSMDGGRDSEIAMGAFQPHHLNTEDQVARGQIHGFRMSLWYEHLGMLHDDFLKPGSL  750

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VN++A+  W+LY+ + L  D+P HLL+YP+ VT++G VTELPG + FPDT+APVL
Sbjct  751  ECVQRVNKMADKYWDLYASDELNDDLPGHLLTYPVAVTKDGIVTELPGMKCFPDTQAPVL  810

Query  158  GTKSNF  141
            G KSN+
Sbjct  811  GMKSNY  816



>ref|XP_006645546.1| PREDICTED: phospholipase D alpha 1-like [Oryza brachyantha]
Length=147

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 102/140 (73%), Gaps = 20/140 (14%)
 Frame = -2

Query  500  MDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESMECVLKV  321
            M G+RDSEIAMG YQP+HL+ RQPA+GQ+HGFRMALWYEHLGMLD+ F +PES+ECV KV
Sbjct  1    MAGSRDSEIAMGGYQPYHLATRQPAQGQIHGFRMALWYEHLGMLDDVFWRPESLECVQKV  60

Query  320  NQIAENNWNLYSGETLERDMPAHLL--------------------SYPIGVTENGQVTEL  201
            N++AE  W++YS + L++D+P HLL                    SYPI +  +G V EL
Sbjct  61   NRMAEKYWDMYSSDDLQQDLPGHLLIKGPQLAFRTGAPNFWRRSCSYPIDIARDGVVMEL  120

Query  200  PGFQNFPDTKAPVLGTKSNF  141
            PG ++FPDT+A VLGTKS++
Sbjct  121  PGMKHFPDTQARVLGTKSDY  140



>gb|EMS46811.1| Phospholipase D alpha 2 [Triticum urartu]
Length=684

 Score =   181 bits (458),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGA+QPHHL+A+ Q ARGQVHGFRM+LWYEHLGML N F  P S 
Sbjct  552  INQRSMDGGRDSEIAMGAFQPHHLNAKGQVARGQVHGFRMSLWYEHLGMLHNDFVNPGSR  611

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VN++A+  W+LY+ + L  D+P HLL+YP+ VT++G VTELPG + FPDT APVL
Sbjct  612  ECVQRVNKMADKYWDLYASDELNDDLPGHLLTYPVAVTKDGTVTELPGARCFPDTAAPVL  671

Query  158  GTKSN  144
            G KS 
Sbjct  672  GIKSK  676



>ref|XP_010923204.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
Length=859

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG RDSEIAMGAYQP++L++RQ A+GQ+HGFR+ALW+EHLG+ D+ F QP+++ 
Sbjct  728  INQRSMDGGRDSEIAMGAYQPYYLASRQLAKGQIHGFRLALWHEHLGVFDDTFLQPQNVG  787

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IAE NW LY+ + L  D+P+HLLSYP+ VTE+G++ EL G + FPDTKA VLG
Sbjct  788  CMQKVNKIAERNWRLYTSDMLVSDLPSHLLSYPLEVTEDGEIMELDGMEFFPDTKARVLG  847

Query  155  TKSNF  141
            TKS++
Sbjct  848  TKSDY  852



>gb|KJB55001.1| hypothetical protein B456_009G057800 [Gossypium raimondii]
Length=817

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            IN+RSM G+RDSEIAMGA+QP+HL+ +QP RGQ++G RMALW EHLG   + FA PE+ +
Sbjct  686  INERSMAGSRDSEIAMGAFQPYHLATKQPVRGQIYGLRMALWKEHLGQRHDSFATPETEK  745

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ +VN IAE NW LYS ETLE D+P HLL YPI V E+G V+ LPG +NFPDT APVLG
Sbjct  746  CIQEVNSIAERNWVLYSSETLEEDLPGHLLRYPINVGEDGSVSSLPGAENFPDTNAPVLG  805

Query  155  TKSNF  141
            +KSN 
Sbjct  806  SKSNI  810



>gb|EYU24646.1| hypothetical protein MIMGU_mgv1a001477mg [Erythranthe guttata]
Length=812

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 103/127 (81%), Gaps = 2/127 (2%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSA-RQPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG+RDSEIAMG YQP+HL+  R PARG VHGFRMALWYEH+GMLD+ F  P+S 
Sbjct  679  INQRSMDGSRDSEIAMGGYQPYHLAGPRGPARGGVHGFRMALWYEHMGMLDDSFLHPQSE  738

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVT-ENGQVTELPGFQNFPDTKAPV  162
            +C  KVN I +  W+LYSG+ LERD+P HLL YPIG++  +G+V+ELPG + FPDTKA V
Sbjct  739  KCARKVNDIGDKYWDLYSGDELERDLPGHLLRYPIGISGASGEVSELPGHEFFPDTKARV  798

Query  161  LGTKSNF  141
            LG KS++
Sbjct  799  LGAKSDY  805



>ref|XP_008394090.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Malus domestica]
Length=810

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIA+GA+QP+HL+++ PA+GQ+H FR+ALWYEHL + D+ F  PES+E
Sbjct  680  INQRSMDGARDSEIAIGAFQPNHLASKIPAKGQIHAFRLALWYEHLKVPDDSFVHPESLE  739

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ +VNQIAE NW  YS +T++ D+P HLL YPI V+ NG +T LPGF+ FPDTKA V G
Sbjct  740  CIRRVNQIAERNWEFYSSDTID-DIPGHLLHYPIAVSNNGALTTLPGFEYFPDTKARVFG  798

Query  155  TKSNF  141
             KS++
Sbjct  799  AKSDY  803



>ref|XP_009758055.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
 ref|XP_009758056.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
Length=820

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL+A QP RG+++GFRMALW EHL   D+ F  P S+E
Sbjct  689  INQRSMDGARDSEIAMGGYQPYHLAANQPPRGKIYGFRMALWCEHLNYADDSFVDPTSLE  748

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN +A+ +W LYS +T + D+P HLLSYPI ++  GQ+T +PGF+ FPDTKA VLG
Sbjct  749  CVRKVNGMADESWKLYSSDTFDLDLPGHLLSYPINISNTGQITAIPGFKFFPDTKASVLG  808

Query  155  TKSNF  141
            TKS  
Sbjct  809  TKSQL  813



>ref|XP_007225238.1| hypothetical protein PRUPE_ppa001818mg [Prunus persica]
 gb|EMJ26437.1| hypothetical protein PRUPE_ppa001818mg [Prunus persica]
Length=761

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG+RDSEIAMGA+QP HL+   PARGQ++ FR++LW+EHL + DN F  PES+E
Sbjct  630  INQRSMDGSRDSEIAMGAFQPEHLATTDPARGQIYAFRLSLWFEHLRVPDNSFLHPESLE  689

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV +VNQIAE +W+LYS +TL +D+P HLL YP+ V++ G +T LPGF++FPDTKA + G
Sbjct  690  CVRRVNQIAEKHWDLYSSDTLHQDLPGHLLRYPVEVSKTGDLTTLPGFEHFPDTKARIFG  749

Query  155  TKSNF  141
             KS +
Sbjct  750  NKSEY  754



>gb|KDP33596.1| hypothetical protein JCGZ_07167 [Jatropha curcas]
Length=816

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMGA+QPHHL+  QPARGQ++GFR+ALWYEHLG+L+  F  PES E
Sbjct  685  INQRSMDGARDSEIAMGAFQPHHLATAQPARGQIYGFRLALWYEHLGLLEPSFQYPESEE  744

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+  VN+IA+  W  YS E  ++D+  HLL YPI +T NG VT LPGF++FPDTKA +LG
Sbjct  745  CIQLVNKIADELWESYSSEVFDQDLIGHLLRYPIEITNNGTVTTLPGFEHFPDTKARILG  804

Query  155  TKSNF  141
              S F
Sbjct  805  NISEF  809



>gb|EMT32202.1| Phospholipase D alpha 2 [Aegilops tauschii]
Length=820

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGA+QPHHL+ + Q ARGQVHGFRM+LWYEHLGML N F  P S 
Sbjct  688  INQRSMDGGRDSEIAMGAFQPHHLNTKGQVARGQVHGFRMSLWYEHLGMLHNDFLNPGSR  747

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VN++A+  W+LY+ + L  D+P HLL+YP+ VT++G VTELPG + FPDT APVL
Sbjct  748  ECVQRVNKMADKYWDLYASDELNDDLPGHLLTYPVAVTKDGTVTELPGARCFPDTAAPVL  807

Query  158  GTKSN  144
            G KS 
Sbjct  808  GIKSK  812



>ref|XP_006350007.1| PREDICTED: phospholipase D alpha 1-like [Solanum tuberosum]
Length=819

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL++ QP RG+++GFRM+LW EHL   D+ FA P S+E
Sbjct  688  INQRSMDGARDSEIAMGGYQPYHLASNQPPRGKIYGFRMSLWCEHLNYADDSFADPSSLE  747

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN +AE +W LYS +T + D+P HLL YPI ++  GQ+T LPGF+ FPDTKA +LG
Sbjct  748  CVRKVNGMAEESWKLYSSDTFDLDLPGHLLRYPIDISNTGQITTLPGFKFFPDTKAAILG  807

Query  155  TKSNF  141
             KS +
Sbjct  808  NKSQY  812



>ref|XP_006656220.1| PREDICTED: phospholipase D alpha 2-like [Oryza brachyantha]
Length=820

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHL-SARQPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGA+QP HL ++ Q ARGQVHGFRM+LWYEHLGML + F  PES+
Sbjct  689  INQRSMDGGRDSEIAMGAFQPCHLNTSGQVARGQVHGFRMSLWYEHLGMLHDEFLSPESL  748

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VN++A+  W+LY+G+ L+ D+P HLL+YP+ VT  G VTELPG + FPDT+AP +
Sbjct  749  ECVQRVNRMADKYWDLYTGDELDGDLPGHLLAYPVCVTREGTVTELPGARFFPDTQAPAI  808

Query  158  GTKSNF  141
            GTK N 
Sbjct  809  GTKGNL  814



>gb|EMT15739.1| Phospholipase D alpha 2 [Aegilops tauschii]
Length=755

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGA+QPHHL+A+ Q ARGQVHGFRM+LWYEHLGML + F  P S+
Sbjct  623  INQRSMDGGRDSEIAMGAFQPHHLNAKGQVARGQVHGFRMSLWYEHLGMLHDDFLNPGSL  682

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VN++A+  W+LY+ + L  D+P HLL+YP+ VT+ G VTELP  + FPDT+ PVL
Sbjct  683  ECVQRVNKMADKYWDLYASDELNDDLPGHLLTYPVAVTKEGAVTELPRAKYFPDTETPVL  742

Query  158  GTKSNF  141
            G K+  
Sbjct  743  GVKAKL  748



>ref|XP_009355736.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=807

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIA+GA+QP+HL++  PARGQ++ FR+ALWYEHL ++D+ F  PES+E
Sbjct  677  INQRSMDGARDSEIAIGAFQPNHLASTIPARGQIYAFRLALWYEHLKVVDDSFLHPESLE  736

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ +VNQIAE NW  YS +T+  D+  HLL YPI V+ NG +T LPGF+ FPDTKA V G
Sbjct  737  CIRRVNQIAEGNWEFYSSDTI-YDITGHLLHYPIVVSNNGALTTLPGFEYFPDTKARVFG  795

Query  155  TKSNF  141
            TKS++
Sbjct  796  TKSDY  800



>gb|EEC80931.1| hypothetical protein OsI_23625 [Oryza sativa Indica Group]
Length=802

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQ-PARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGA+QP HL+ +   ARGQ+HGFRM+LWYEHLGML + F  PES+
Sbjct  671  INQRSMDGGRDSEIAMGAFQPCHLNTKGLVARGQIHGFRMSLWYEHLGMLHDNFLNPESL  730

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VN++A+  W+LY+ + L  D+P HLL+YP+ VT+ G VTELPG + FPDT+APV+
Sbjct  731  ECVQRVNKMADKYWDLYASDELNDDLPGHLLTYPVRVTKEGTVTELPGAKFFPDTQAPVI  790

Query  158  GTKSNF  141
            GTK N 
Sbjct  791  GTKGNL  796



>ref|NP_001058017.1| Os06g0604400 [Oryza sativa Japonica Group]
 sp|P93844.2|PLDA2_ORYSJ RecName: Full=Phospholipase D alpha 2; Short=PLD alpha 2; AltName: 
Full=Choline phosphatase 2; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 2 [Oryza sativa Japonica 
Group]
 dbj|BAD35531.1| Phospholipase D alpha 2 [Oryza sativa Japonica Group]
 dbj|BAF19931.1| Os06g0604400 [Oryza sativa Japonica Group]
 gb|EEE65982.1| hypothetical protein OsJ_21907 [Oryza sativa Japonica Group]
Length=817

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQ-PARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGA+QP HL+ +   ARGQ+HGFRM+LWYEHLGML + F  PES+
Sbjct  686  INQRSMDGGRDSEIAMGAFQPCHLNTKGLVARGQIHGFRMSLWYEHLGMLHDNFLNPESL  745

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VN++A+  W+LY+ + L  D+P HLL+YP+ VT+ G VTELPG + FPDT+APV+
Sbjct  746  ECVQRVNKMADKYWDLYASDELNDDLPGHLLTYPVRVTKEGTVTELPGAKFFPDTQAPVI  805

Query  158  GTKSNF  141
            GTK N 
Sbjct  806  GTKGNL  811



>ref|XP_004251821.1| PREDICTED: phospholipase D alpha 1-like [Solanum lycopersicum]
Length=820

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 98/126 (78%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIAMG YQP+HL++ QP RG+++GFRM+LW EHL   D+ FA P S+E
Sbjct  688  INQRSMDGARDSEIAMGGYQPYHLASNQPPRGKIYGFRMSLWCEHLNYADDSFADPSSLE  747

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTEN-GQVTELPGFQNFPDTKAPVL  159
            CV KVN +A+ +W LYS +T + D+P HLL YPI +  N GQ+T LPGF+ FPDTKA +L
Sbjct  748  CVRKVNGMADESWKLYSNDTFDIDLPGHLLRYPIDINSNTGQITTLPGFKFFPDTKAAIL  807

Query  158  GTKSNF  141
            G KS F
Sbjct  808  GNKSQF  813



>ref|XP_011070230.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Sesamum indicum]
Length=819

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLS-ARQPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMG +QPHHL+ +  PARGQ+ G RMALW EHL   ++ F QPES+
Sbjct  687  INQRSMDGGRDSEIAMGGFQPHHLANSGAPARGQIFGLRMALWCEHLLREEDVFLQPESL  746

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV  VN IA+ NW +YS ET + D+P HLLSYPI ++ NG ++ LPGF+ FPDTKA VL
Sbjct  747  ECVRTVNTIADENWKIYSSETFKEDLPGHLLSYPIRISNNGDISALPGFEFFPDTKARVL  806

Query  158  GTKSN  144
            GTKSN
Sbjct  807  GTKSN  811



>gb|AFW87187.1| phospholipase D family protein [Zea mays]
Length=729

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGAYQP HL+ + Q ARGQVHGFRM+LWYEHLGML + F  P S+
Sbjct  598  INQRSMDGGRDSEIAMGAYQPCHLNTKGQVARGQVHGFRMSLWYEHLGMLHDDFLNPGSL  657

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VNQ+A+  W+LY+G++L+ D+P HLL YP+ VT+ G VTELPG + FPDT+A VL
Sbjct  658  ECVRRVNQMADRYWDLYAGDSLDADLPGHLLRYPVTVTKEGTVTELPGAKFFPDTQALVL  717

Query  158  GTKSNF  141
            G  S  
Sbjct  718  GALSKL  723



>ref|NP_001146242.1| uncharacterized protein LOC100279815 [Zea mays]
 gb|ACL53544.1| unknown [Zea mays]
 gb|AFW87188.1| phospholipase D family protein [Zea mays]
Length=816

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGAYQP HL+ + Q ARGQVHGFRM+LWYEHLGML + F  P S+
Sbjct  685  INQRSMDGGRDSEIAMGAYQPCHLNTKGQVARGQVHGFRMSLWYEHLGMLHDDFLNPGSL  744

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VNQ+A+  W+LY+G++L+ D+P HLL YP+ VT+ G VTELPG + FPDT+A VL
Sbjct  745  ECVRRVNQMADRYWDLYAGDSLDADLPGHLLRYPVTVTKEGTVTELPGAKFFPDTQALVL  804

Query  158  GTKSNF  141
            G  S  
Sbjct  805  GALSKL  810



>ref|XP_002515518.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF46967.1| phopholipase d alpha, putative [Ricinus communis]
Length=817

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQ-PARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARD+EIAMGA+QPHHL+ +Q PARGQ+ GFR+ALWYEHLG L+  F  PES 
Sbjct  685  INQRSMDGARDTEIAMGAFQPHHLATQQNPARGQICGFRLALWYEHLGFLELSFQHPESS  744

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
             C+ ++NQIA++ W  Y+ ETL++D   HLL YPI V  NG VT LPG ++FPDTKA +L
Sbjct  745  NCIKRLNQIADDLWESYASETLDQDFVGHLLRYPIEVDSNGTVTTLPGTEHFPDTKARIL  804

Query  158  GTKSNF  141
            G KS+F
Sbjct  805  GAKSDF  810



>ref|XP_010101275.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB88210.1| Phospholipase D alpha 1 [Morus notabilis]
Length=794

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 99/127 (78%), Gaps = 2/127 (2%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGML--DNCFAQPES  342
            INQRSMDGARDSEIAMGA+QPHH+++++PARGQ++GFRMALW EHL +    + F  PE+
Sbjct  661  INQRSMDGARDSEIAMGAFQPHHVASKEPARGQIYGFRMALWREHLSVFLEKSTFNHPET  720

Query  341  MECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPV  162
            +EC+ +VNQIA+ NW  Y  +T   D+P HLL YPI V++ G +T LPGF+ FPD KA V
Sbjct  721  VECIQRVNQIAQRNWERYCSDTFNGDLPGHLLRYPIEVSKTGAITTLPGFEFFPDNKAKV  780

Query  161  LGTKSNF  141
            LG KS++
Sbjct  781  LGEKSDY  787



>ref|XP_002972515.1| hypothetical protein SELMODRAFT_441825 [Selaginella moellendorffii]
 gb|EFJ26601.1| hypothetical protein SELMODRAFT_441825 [Selaginella moellendorffii]
Length=801

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG RDSEIAMGAYQP H S     RG VHGFRM+LWYEHLG LDN +  P S+E
Sbjct  671  INQRSMDGGRDSEIAMGAYQPFHTSHHHAPRGDVHGFRMSLWYEHLGKLDNAYLHPSSLE  730

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++A+  W +++GE +  D+P HLLSYPIG+T  G+V ELPG   FPDTKA +LG
Sbjct  731  CVRKVNELADEYWAMFAGEEV-VDLPGHLLSYPIGITTTGEVCELPGRSQFPDTKANILG  789

Query  155  TKSN  144
             KS+
Sbjct  790  AKSD  793



>gb|KGN62948.1| hypothetical protein Csa_2G381740 [Cucumis sativus]
Length=814

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG RDSEIAMGA+QP HL++ +PARGQ++GFR+ALWYEHLG+ D  F  PES +
Sbjct  683  INQRSMDGGRDSEIAMGAFQPRHLASSEPARGQIYGFRVALWYEHLGLFDKVFHNPESED  742

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+  VN++A+ NW  YS +T + D+P HLLSYPI V  NG V+ LP F+ FPDTKA VLG
Sbjct  743  CIQFVNKLAQENWQFYSDDTYDGDLPGHLLSYPIQVGPNGSVSALPKFEFFPDTKARVLG  802

Query  155  TKSNF  141
              S +
Sbjct  803  QLSEY  807



>ref|XP_004138856.1| PREDICTED: phospholipase D alpha 2-like [Cucumis sativus]
Length=810

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG RDSEIAMGA+QP HL++ +PARGQ++GFR+ALWYEHLG+ D  F  PES +
Sbjct  679  INQRSMDGGRDSEIAMGAFQPRHLASSEPARGQIYGFRVALWYEHLGLFDKVFHNPESED  738

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+  VN++A+ NW  YS +T + D+P HLLSYPI V  NG V+ LP F+ FPDTKA VLG
Sbjct  739  CIQFVNKLAQENWQFYSDDTYDGDLPGHLLSYPIQVGPNGSVSALPKFEFFPDTKARVLG  798

Query  155  TKSNF  141
              S +
Sbjct  799  QLSEY  803



>ref|XP_008445210.1| PREDICTED: phospholipase D alpha 1-like [Cucumis melo]
Length=814

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG RDSEIAMGA+QP HL++ +PARGQ++GFR+ALWYEHLG+ D  F  PES +
Sbjct  683  INQRSMDGGRDSEIAMGAFQPRHLASSEPARGQIYGFRVALWYEHLGLFDKVFHNPESED  742

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+  VN++A+ NW  YS +T + D+P HLLSYPI V  NG V+ LP F+ FPDTKA VLG
Sbjct  743  CIQFVNKLAQENWQFYSDDTYDGDLPGHLLSYPIQVGPNGSVSALPKFEFFPDTKARVLG  802

Query  155  TKSNF  141
              S +
Sbjct  803  QLSEY  807



>ref|XP_009614730.1| PREDICTED: phospholipase D alpha 1 {ECO:0000250|UniProtKB:Q41142}-like 
[Nicotiana tomentosiformis]
Length=820

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDGARDSEIA+G YQP+HL+A Q  RG+++GFRMALW EHL   D+ F  P S+E
Sbjct  689  INQRSMDGARDSEIAIGGYQPYHLAANQLPRGKIYGFRMALWCEHLNYADDSFVDPTSLE  748

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN +A+ +W +YS +T + D+P HLL YP+ ++  GQ+T +PGF+ FPDTKA VLG
Sbjct  749  CVRKVNGMADESWRIYSSDTFDFDLPGHLLRYPVNISNTGQITAIPGFKFFPDTKASVLG  808

Query  155  TKSNF  141
            TKS  
Sbjct  809  TKSQL  813



>ref|XP_009401723.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=781

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGAYQP HL++  Q ARGQVHGFR+ALW+EH+G +D+ F +P+S 
Sbjct  649  INQRSMDGGRDSEIAMGAYQPSHLASEWQAARGQVHGFRLALWFEHMGTVDDVFLRPQSA  708

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV  VN +A+ NW+LY+ E L  D+P HLL+YPI + ++G +T LPG + FPDTKA VL
Sbjct  709  ECVRMVNMVAKRNWDLYASEALFDDLPGHLLNYPIDIADDGNITALPGSEVFPDTKARVL  768

Query  158  GTKSNF  141
            G +S +
Sbjct  769  GRRSEY  774



>ref|XP_009401714.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=821

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGAYQP HL++  Q ARGQVHGFR+ALW+EH+G +D+ F +P+S 
Sbjct  689  INQRSMDGGRDSEIAMGAYQPSHLASEWQAARGQVHGFRLALWFEHMGTVDDVFLRPQSA  748

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV  VN +A+ NW+LY+ E L  D+P HLL+YPI + ++G +T LPG + FPDTKA VL
Sbjct  749  ECVRMVNMVAKRNWDLYASEALFDDLPGHLLNYPIDIADDGNITALPGSEVFPDTKARVL  808

Query  158  GTKSNF  141
            G +S +
Sbjct  809  GRRSEY  814



>ref|XP_004160794.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 2-like 
[Cucumis sativus]
Length=820

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG RDSEIAMGA+QP HL++ +PARGQ++GFR+ALWYEHLG+ D  F  PES +
Sbjct  689  INQRSMDGGRDSEIAMGAFQPRHLASSEPARGQIYGFRVALWYEHLGLFDKVFHNPESED  748

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+  VN++A+ NW  YS +T + D+P HLLSYPI V  NG V+ LP F+ FPDTKA VLG
Sbjct  749  CIQFVNKLAQENWQFYSDDTYDGDLPGHLLSYPIQVGPNGSVSALPKFEFFPDTKARVLG  808

Query  155  TKSNF  141
              S +
Sbjct  809  QLSEY  813



>ref|XP_004965943.1| PREDICTED: phospholipase D alpha 2-like [Setaria italica]
Length=818

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGA+QP HL+ + Q ARGQVHGFRM+LWYEHLGML + F  P ++
Sbjct  686  INQRSMDGGRDSEIAMGAFQPCHLNTKGQVARGQVHGFRMSLWYEHLGMLHDDFLNPGNL  745

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VN++A+  W+LY+ + L+ D+P HLL YPI VT+ G VTELPG + FPDT+A VL
Sbjct  746  ECVQRVNKMADKYWDLYASDYLDADLPGHLLRYPINVTKEGTVTELPGAKYFPDTQATVL  805

Query  158  GTKSN  144
            G KSN
Sbjct  806  GMKSN  810



>gb|EPS60466.1| hypothetical protein M569_14336, partial [Genlisea aurea]
Length=770

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSA-RQPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGAYQP  LS+ RQPARGQVHGFRM+LWYEH G + + + +PES+
Sbjct  638  INQRSMDGGRDSEIAMGAYQPFRLSSHRQPARGQVHGFRMSLWYEHTGAVYDSYLRPESL  697

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            E + K+N+I   NW L+S E+LE D+P+ LLSYPIGV  +G VT LPG + FPDTKA V 
Sbjct  698  EAIRKLNEIGGRNWELFSQESLEEDLPSQLLSYPIGVDYDGTVTHLPGAEFFPDTKAAVT  757

Query  158  GTKSNF  141
            G  S F
Sbjct  758  GAVSEF  763



>ref|XP_001762942.1| predicted protein [Physcomitrella patens]
 gb|EDQ72147.1| predicted protein [Physcomitrella patens]
Length=804

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG+RDSEIA+GAYQP+HLS  +P R  +HGFRM+ WYEH+G LDN F +P  +E
Sbjct  674  INQRSMDGSRDSEIAIGAYQPYHLSRDRPPRSHIHGFRMSCWYEHIGKLDNAFLKPWDLE  733

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            C+ KVN+IA+ +W +++G+ +  DMP HL SYPI V ++G +T +PG ++FPDT+AP+LG
Sbjct  734  CIRKVNRIADQHWEMFAGDEI-VDMPGHLCSYPIVVNDDGTITNIPGLEHFPDTQAPILG  792

Query  155  TKS  147
            TKS
Sbjct  793  TKS  795



>ref|XP_002437251.1| hypothetical protein SORBIDRAFT_10g023630 [Sorghum bicolor]
 gb|EER88618.1| hypothetical protein SORBIDRAFT_10g023630 [Sorghum bicolor]
Length=816

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RDSEIAMGAYQP HL+ + Q ARGQVHGFRM+LWYEHLG+L + F  P S+
Sbjct  685  INQRSMDGGRDSEIAMGAYQPCHLNTKGQVARGQVHGFRMSLWYEHLGVLHDDFLNPGSL  744

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VNQ+A+  W+LY+ ++L+ D+P HLL YP+ VT+ G VTELPG + FPDT+A VL
Sbjct  745  ECVQRVNQMADKYWDLYASDSLDADLPGHLLRYPVTVTKEGTVTELPGAKFFPDTQALVL  804

Query  158  GTKSNF  141
            G    F
Sbjct  805  GALGKF  810



>ref|XP_002992572.1| hypothetical protein SELMODRAFT_186850 [Selaginella moellendorffii]
 gb|EFJ06378.1| hypothetical protein SELMODRAFT_186850 [Selaginella moellendorffii]
Length=801

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRMALWYEHLGMLDNCFAQPESME  336
            INQRSMDG RD+EIAMGAYQP H       RG VHGFRM+LWYEHLG LDN +  P S+E
Sbjct  671  INQRSMDGGRDTEIAMGAYQPFHTCHHHAPRGDVHGFRMSLWYEHLGKLDNAYLHPSSLE  730

Query  335  CVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVLG  156
            CV KVN++A+  W +++GE +  D+P HLLSYPIG+T  G+V ELPG   FPDTKA +LG
Sbjct  731  CVRKVNELADEYWAMFAGEEV-VDLPGHLLSYPIGITTTGEVCELPGRSQFPDTKANILG  789

Query  155  TKSN  144
             KS+
Sbjct  790  AKSD  793



>emb|CBI21040.3| unnamed protein product [Vitis vinifera]
Length=752

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 93/126 (74%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPA-RGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RD+EIAMG YQPHHL+A +   RG +HGFR+ALWYEHLG  D  F  PES+
Sbjct  620  INQRSMDGGRDTEIAMGGYQPHHLAATEEGGRGAIHGFRLALWYEHLGGHDASFLHPESV  679

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV  VN+ AE NW  YS +TL  D+P HLLSYP+ V +NG VT LP  + FPDTKA VL
Sbjct  680  ECVRVVNESAERNWRAYSSDTLVADLPGHLLSYPVQVNQNGTVTALPETEFFPDTKARVL  739

Query  158  GTKSNF  141
            GT S F
Sbjct  740  GTVSEF  745



>dbj|BAA19466.1| phospholipase D [Oryza sativa Japonica Group]
Length=818

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQ-PARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQR MDG  DSEIAMGA+QP HL+ +   ARGQ+HGFRM+LWYEHLGML + F  PES+
Sbjct  687  INQRPMDGEGDSEIAMGAFQPCHLNTKGLVARGQIHGFRMSLWYEHLGMLHDNFLNPESL  746

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VN++A+  W+LY+ + L  D+P HLL+YP+ VT+ G VTELPG + FPDT+APV+
Sbjct  747  ECVQRVNKMADKYWDLYASDELNDDLPGHLLTYPVRVTKEGTVTELPGAKFFPDTQAPVI  806

Query  158  GTKSNF  141
            GTK N 
Sbjct  807  GTKGNL  812



>ref|XP_006657112.1| PREDICTED: phospholipase D alpha 2-like [Oryza brachyantha]
Length=768

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RD+EIAMGA+QP HL+   Q ARGQVHGFRM+LWYEHLGML + F +PES+
Sbjct  634  INQRSMDGGRDTEIAMGAFQPRHLNIDGQAARGQVHGFRMSLWYEHLGMLHDDFLRPESL  693

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV +VN +A  +W LY+ E L  D+  HLL+YPI V ++G V+ LPG + FPDT+APVL
Sbjct  694  ECVRRVNGMAATHWELYAREELHEDLEGHLLTYPIAVAKDGAVSSLPGVKFFPDTEAPVL  753

Query  158  GTKSNF  141
            G K+  
Sbjct  754  GKKATL  759



>gb|EPS71739.1| hypothetical protein M569_03019, partial [Genlisea aurea]
Length=782

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSA-RQPARGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDGARD+EIAMG +QPHHL+   +PA GQV GFRMALW EHL + D+ F +PES+
Sbjct  650  INQRSMDGARDTEIAMGGFQPHHLNVDTRPATGQVFGFRMALWTEHLMLEDDVFLRPESL  709

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV  +  + + NW++YS E    D+P HL+SYPI V+ NG +  +PG + FPDTKAPVL
Sbjct  710  ECVRIMKAVGDRNWDMYSREEFNEDLPGHLMSYPIKVSSNGDIGTIPGIEFFPDTKAPVL  769

Query  158  GTKSNF  141
            GTKS F
Sbjct  770  GTKSEF  775



>ref|XP_010648662.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=825

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 93/126 (74%), Gaps = 1/126 (1%)
 Frame = -2

Query  515  INQRSMDGARDSEIAMGAYQPHHLSARQPA-RGQVHGFRMALWYEHLGMLDNCFAQPESM  339
            INQRSMDG RD+EIAMG YQPHHL+A +   RG +HGFR+ALWYEHLG  D  F  PES+
Sbjct  693  INQRSMDGGRDTEIAMGGYQPHHLAATEEGGRGAIHGFRLALWYEHLGGHDASFLHPESV  752

Query  338  ECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTENGQVTELPGFQNFPDTKAPVL  159
            ECV  VN+ AE NW  YS +TL  D+P HLLSYP+ V +NG VT LP  + FPDTKA VL
Sbjct  753  ECVRVVNESAERNWRAYSSDTLVADLPGHLLSYPVQVNQNGTVTALPETEFFPDTKARVL  812

Query  158  GTKSNF  141
            GT S F
Sbjct  813  GTVSEF  818



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325