BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF047L05

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798650.1|  PREDICTED: serine carboxypeptidase-like 42 i...    112   1e-41   Nicotiana sylvestris
ref|XP_006356286.1|  PREDICTED: serine carboxypeptidase-like 42-like    112   1e-41   Solanum tuberosum [potatoes]
ref|XP_004237734.1|  PREDICTED: serine carboxypeptidase-like 42         112   1e-41   Solanum lycopersicum
ref|XP_009600050.1|  PREDICTED: serine carboxypeptidase-like 42         112   2e-41   Nicotiana tomentosiformis
ref|XP_011101717.1|  PREDICTED: serine carboxypeptidase-like 42         109   9e-41   Sesamum indicum [beniseed]
gb|EYU17411.1|  hypothetical protein MIMGU_mgv1a005783mg                109   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_010062160.1|  PREDICTED: serine carboxypeptidase-like 42         107   2e-40   Eucalyptus grandis [rose gum]
ref|XP_004139740.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    109   3e-40   
ref|XP_007161488.1|  hypothetical protein PHAVU_001G0732000g            106   3e-40   Phaseolus vulgaris [French bean]
ref|XP_010664883.1|  PREDICTED: serine carboxypeptidase-like 42 i...    106   4e-40   Vitis vinifera
ref|XP_002278193.1|  PREDICTED: serine carboxypeptidase-like 42 i...    105   9e-40   Vitis vinifera
ref|XP_006581614.1|  PREDICTED: serine carboxypeptidase-like 42-l...    108   1e-39   
ref|XP_003544740.2|  PREDICTED: serine carboxypeptidase-like 42-l...    105   2e-39   Glycine max [soybeans]
gb|KHN05260.1|  Serine carboxypeptidase-like 42                         105   2e-39   Glycine soja [wild soybean]
ref|XP_006596272.1|  PREDICTED: serine carboxypeptidase-like 42-l...    105   2e-39   Glycine max [soybeans]
ref|XP_004173353.1|  PREDICTED: serine carboxypeptidase-like 42-like    102   2e-39   
ref|XP_004490637.1|  PREDICTED: serine carboxypeptidase-like 42-l...    107   2e-39   
ref|XP_003527966.2|  PREDICTED: serine carboxypeptidase-like 42-l...    107   3e-39   Glycine max [soybeans]
gb|KHN23425.1|  Serine carboxypeptidase-like 42                         107   3e-39   Glycine soja [wild soybean]
ref|XP_004490638.1|  PREDICTED: serine carboxypeptidase-like 42-l...    107   3e-39   Cicer arietinum [garbanzo]
ref|XP_007019398.1|  Serine carboxypeptidase-like 42 isoform 2          108   4e-39   
ref|XP_007019397.1|  Serine carboxypeptidase-like 42 isoform 1          108   4e-39   
gb|KDP43043.1|  hypothetical protein JCGZ_25229                         109   4e-39   Jatropha curcas
ref|XP_010244030.1|  PREDICTED: serine carboxypeptidase-like 42 i...    108   4e-39   Nelumbo nucifera [Indian lotus]
ref|XP_004148827.1|  PREDICTED: serine carboxypeptidase-like 42-like    102   5e-39   Cucumis sativus [cucumbers]
ref|XP_010244029.1|  PREDICTED: serine carboxypeptidase-like 42 i...    108   5e-39   
ref|XP_011074776.1|  PREDICTED: serine carboxypeptidase-like 42         110   9e-39   Sesamum indicum [beniseed]
ref|XP_004290564.1|  PREDICTED: serine carboxypeptidase-like 42         106   2e-38   Fragaria vesca subsp. vesca
ref|XP_003615811.1|  Serine carboxypeptidase-like protein               107   2e-38   Medicago truncatula
ref|XP_010245825.1|  PREDICTED: serine carboxypeptidase-like 42         107   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_006578942.1|  PREDICTED: serine carboxypeptidase-like 42-l...    108   3e-38   Glycine max [soybeans]
ref|XP_008441654.1|  PREDICTED: serine carboxypeptidase-like 42       99.8    3e-38   
ref|XP_008461496.1|  PREDICTED: serine carboxypeptidase-like 42 i...    104   3e-38   Cucumis melo [Oriental melon]
ref|XP_008461495.1|  PREDICTED: serine carboxypeptidase-like 42 i...    104   4e-38   Cucumis melo [Oriental melon]
ref|XP_009360732.1|  PREDICTED: serine carboxypeptidase-like 42         106   5e-38   Pyrus x bretschneideri [bai li]
ref|XP_004167283.1|  PREDICTED: serine carboxypeptidase-like 42-like    105   5e-38   
ref|XP_006434388.1|  hypothetical protein CICLE_v10000998mg             107   7e-38   Citrus clementina [clementine]
ref|XP_003522555.2|  PREDICTED: serine carboxypeptidase-like 42-l...    107   9e-38   Glycine max [soybeans]
ref|XP_007137531.1|  hypothetical protein PHAVU_009G134900g             105   9e-38   Phaseolus vulgaris [French bean]
gb|KGN44500.1|  hypothetical protein Csa_7G319000                       104   1e-37   Cucumis sativus [cucumbers]
ref|XP_008373913.1|  PREDICTED: serine carboxypeptidase-like 42         103   1e-37   
ref|XP_006472927.1|  PREDICTED: serine carboxypeptidase-like 42-like    105   2e-37   
ref|XP_006280410.1|  hypothetical protein CARUB_v10026343mg             108   3e-37   Capsella rubella
ref|XP_010519388.1|  PREDICTED: serine carboxypeptidase-like 42         100   4e-37   Tarenaya hassleriana [spider flower]
ref|XP_008237677.1|  PREDICTED: serine carboxypeptidase-like 42         104   6e-37   Prunus mume [ume]
ref|XP_010679983.1|  PREDICTED: serine carboxypeptidase-like 42         108   8e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002526159.1|  serine carboxypeptidase, putative                  105   8e-37   
ref|XP_009377698.1|  PREDICTED: serine carboxypeptidase-like 42         105   8e-37   Pyrus x bretschneideri [bai li]
ref|XP_009377699.1|  PREDICTED: serine carboxypeptidase-like 42         103   1e-36   Pyrus x bretschneideri [bai li]
gb|KJB59375.1|  hypothetical protein B456_009G252300                    109   2e-36   Gossypium raimondii
gb|KJB59374.1|  hypothetical protein B456_009G252300                    109   2e-36   Gossypium raimondii
gb|KJB59377.1|  hypothetical protein B456_009G252300                    109   2e-36   Gossypium raimondii
ref|XP_008373914.1|  PREDICTED: serine carboxypeptidase-like 42         103   2e-36   
emb|CDP12019.1|  unnamed protein product                                104   2e-36   Coffea canephora [robusta coffee]
ref|XP_009377728.1|  PREDICTED: serine carboxypeptidase-like 42         106   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_002865546.1|  hypothetical protein ARALYDRAFT_494806             103   3e-36   
ref|XP_011027377.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    104   4e-36   Populus euphratica
ref|XP_002300939.1|  serine carboxypeptidase S10 family protein         104   4e-36   Populus trichocarpa [western balsam poplar]
gb|KHF97371.1|  Serine carboxypeptidase-like 42                         106   4e-36   Gossypium arboreum [tree cotton]
ref|XP_010110480.1|  Serine carboxypeptidase-like 42                  94.7    6e-36   
ref|XP_010442147.1|  PREDICTED: serine carboxypeptidase-like 42         105   9e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010930631.1|  PREDICTED: serine carboxypeptidase-like 42         101   1e-35   Elaeis guineensis
ref|XP_009112251.1|  PREDICTED: serine carboxypeptidase-like 42         103   1e-35   Brassica rapa
emb|CDY37202.1|  BnaA09g08230D                                          103   2e-35   Brassica napus [oilseed rape]
gb|AFK38452.1|  unknown                                                 104   2e-35   Lotus japonicus
ref|NP_199039.1|  serine carboxypeptidase-like 42                       102   3e-35   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ87921.1|  predicted protein                                      103   4e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY66139.1|  BnaAnng21620D                                          103   5e-35   Brassica napus [oilseed rape]
ref|XP_002268397.1|  PREDICTED: serine carboxypeptidase-like 42         100   8e-35   Vitis vinifera
gb|EPS65711.1|  hypothetical protein M569_09067                         101   9e-35   Genlisea aurea
ref|XP_010482006.1|  PREDICTED: serine carboxypeptidase-like 42         101   9e-35   Camelina sativa [gold-of-pleasure]
gb|EAY80352.1|  hypothetical protein OsI_35523                          102   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_009406489.1|  PREDICTED: serine carboxypeptidase-like 42         103   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008786550.1|  PREDICTED: serine carboxypeptidase-like 42       99.4    3e-34   
ref|XP_009136205.1|  PREDICTED: serine carboxypeptidase-like 42         100   4e-34   Brassica rapa
gb|EMS56738.1|  Serine carboxypeptidase-like 42                         102   5e-34   Triticum urartu
gb|KFK24266.1|  hypothetical protein AALP_AAs40498U001000               100   7e-34   Arabis alpina [alpine rockcress]
ref|XP_004977165.1|  PREDICTED: serine carboxypeptidase-like 42-l...    104   1e-33   
ref|XP_004977164.1|  PREDICTED: serine carboxypeptidase-like 42-l...    104   1e-33   Setaria italica
gb|EMT33269.1|  Serine carboxypeptidase-like 42                         101   1e-33   
gb|EEE51848.1|  hypothetical protein OsJ_33355                          102   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067496.1|  Os11g0213600                                       102   1e-33   
ref|XP_003577714.1|  PREDICTED: serine carboxypeptidase-like 42         102   1e-33   Brachypodium distachyon [annual false brome]
ref|XP_004230572.1|  PREDICTED: serine carboxypeptidase-like 42 i...    100   1e-33   Solanum lycopersicum
ref|XP_010315077.1|  PREDICTED: serine carboxypeptidase-like 42 i...    100   1e-33   Solanum lycopersicum
emb|CDX93108.1|  BnaA03g38300D                                        98.6    2e-33   
emb|CDX80725.1|  BnaC08g05590D                                        97.4    2e-33   
emb|CDY48945.1|  BnaA08g04690D                                        97.1    2e-33   Brassica napus [oilseed rape]
ref|XP_004502581.1|  PREDICTED: serine carboxypeptidase-like 42-like  90.5    2e-33   Cicer arietinum [garbanzo]
ref|XP_006351861.1|  PREDICTED: serine carboxypeptidase-like 42-like    100   2e-33   Solanum tuberosum [potatoes]
gb|ACM17527.1|  putative serine carboxy peptidase                     99.8    2e-33   Oryza australiensis
ref|XP_009107652.1|  PREDICTED: serine carboxypeptidase-like 44 i...  96.7    3e-33   
ref|XP_009107650.1|  PREDICTED: serine carboxypeptidase-like 44 i...  96.7    3e-33   Brassica rapa
ref|XP_009107653.1|  PREDICTED: serine carboxypeptidase-like 44 i...  96.7    3e-33   Brassica rapa
ref|XP_009414969.1|  PREDICTED: serine carboxypeptidase-like 42       98.2    3e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009107648.1|  PREDICTED: serine carboxypeptidase-like 44 i...  96.7    3e-33   Brassica rapa
ref|XP_009586680.1|  PREDICTED: serine carboxypeptidase-like 42       95.9    3e-33   Nicotiana tomentosiformis
ref|XP_009107654.1|  PREDICTED: serine carboxypeptidase-like 44 i...  96.7    3e-33   Brassica rapa
gb|AAD28662.1|  putative serine carboxypeptidase II                     102   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002449388.1|  hypothetical protein SORBIDRAFT_05g009120          101   4e-33   Sorghum bicolor [broomcorn]
ref|NP_178937.2|  serine carboxypeptidase-like 43                       101   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123167.1|  PREDICTED: serine carboxypeptidase-like 42       98.6    5e-33   Brassica rapa
emb|CDY70042.1|  BnaCnng66490D                                          100   5e-33   Brassica napus [oilseed rape]
gb|AFW60600.1|  serine carboxypeptidase F13S12.6                        100   6e-33   
ref|NP_001151858.1|  serine carboxypeptidase F13S12.6 precursor         100   6e-33   Zea mays [maize]
ref|XP_003602149.1|  Serine carboxypeptidase-like protein             93.2    7e-33   Medicago truncatula
ref|XP_010468548.1|  PREDICTED: serine carboxypeptidase-like 43         100   7e-33   
ref|XP_006307408.1|  hypothetical protein CARUB_v10009034mg           97.8    7e-33   
ref|XP_009767155.1|  PREDICTED: serine carboxypeptidase-like 42 i...  94.7    7e-33   Nicotiana sylvestris
ref|XP_009767156.1|  PREDICTED: serine carboxypeptidase-like 42 i...  94.7    9e-33   Nicotiana sylvestris
emb|CDX81435.1|  BnaC09g08460D                                          100   1e-32   
ref|XP_004979109.1|  PREDICTED: serine carboxypeptidase-like 42-like  99.4    2e-32   Setaria italica
emb|CDY51660.1|  BnaC03g66990D                                        98.2    2e-32   Brassica napus [oilseed rape]
ref|XP_006663298.1|  PREDICTED: serine carboxypeptidase-like 42-like    102   2e-32   
gb|KEH35413.1|  serine carboxypeptidase-like protein                  91.7    2e-32   Medicago truncatula
ref|XP_006299245.1|  hypothetical protein CARUB_v10015394mg             100   2e-32   
ref|XP_002885858.1|  predicted protein                                99.8    4e-32   
emb|CDY23340.1|  BnaA08g12060D                                        98.6    4e-32   Brassica napus [oilseed rape]
gb|ACR37620.1|  unknown                                               98.6    7e-32   Zea mays [maize]
ref|NP_001183841.1|  hypothetical protein precursor                   98.2    7e-32   Zea mays [maize]
ref|NP_001031351.1|  serine carboxypeptidase-like 43                  97.1    1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|ACR37535.1|  unknown                                               98.2    1e-31   Zea mays [maize]
ref|XP_006279617.1|  hypothetical protein CARUB_v10026338mg           95.9    1e-31   Capsella rubella
ref|XP_006393769.1|  hypothetical protein EUTSA_v10011445mg           94.7    2e-31   Eutrema salsugineum [saltwater cress]
ref|NP_175046.1|  serine carboxypeptidase-like 44                     94.7    3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863806.1|  hypothetical protein ARALYDRAFT_331179           99.0    4e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_010463193.1|  PREDICTED: serine carboxypeptidase-like 44       93.6    5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010479023.1|  PREDICTED: serine carboxypeptidase-like 44       93.6    5e-31   Camelina sativa [gold-of-pleasure]
gb|EMS54298.1|  Serine carboxypeptidase-like 42                       96.3    9e-31   Triticum urartu
ref|XP_010493597.1|  PREDICTED: serine carboxypeptidase-like 42         105   9e-31   Camelina sativa [gold-of-pleasure]
ref|XP_002891272.1|  predicted protein                                92.8    1e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_004515138.1|  PREDICTED: serine carboxypeptidase-like 42-like  87.0    2e-30   Cicer arietinum [garbanzo]
ref|XP_002865553.1|  hypothetical protein ARALYDRAFT_494807             102   2e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_002862434.1|  hypothetical protein ARALYDRAFT_497456             100   2e-30   
ref|NP_199038.1|  serine carboxypeptidase-like 41                     95.1    9e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010239229.1|  PREDICTED: serine carboxypeptidase-like 42       95.9    3e-29   
gb|ABK25236.1|  unknown                                               82.8    3e-25   Picea sitchensis
ref|XP_010530237.1|  PREDICTED: serine carboxypeptidase-like 42         108   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_007019399.1|  Serine carboxypeptidase-like 42 isoform 3          108   2e-24   
ref|XP_010681521.1|  PREDICTED: serine carboxypeptidase-like 42       70.1    2e-23   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN74668.1|  hypothetical protein VITISV_005686                     101   6e-22   Vitis vinifera
gb|KGN47484.1|  hypothetical protein Csa_6G338160                       102   8e-22   Cucumis sativus [cucumbers]
ref|XP_007139316.1|  hypothetical protein PHAVU_008G019100g           80.1    1e-21   Phaseolus vulgaris [French bean]
ref|XP_007038110.1|  Serine carboxypeptidase-like 45 isoform 1        80.1    2e-21   
ref|XP_002449560.1|  hypothetical protein SORBIDRAFT_05g019090        80.5    2e-21   
ref|XP_006858474.1|  hypothetical protein AMTR_s00071p00113850        99.8    2e-21   Amborella trichopoda
ref|XP_004298533.1|  PREDICTED: serine carboxypeptidase-like 45       78.6    3e-21   Fragaria vesca subsp. vesca
ref|XP_008239549.1|  PREDICTED: serine carboxypeptidase-like 45       77.8    4e-21   Prunus mume [ume]
ref|XP_010929656.1|  PREDICTED: serine carboxypeptidase-like 45       78.6    4e-21   Elaeis guineensis
ref|XP_004492026.1|  PREDICTED: serine carboxypeptidase-like 45-like  77.4    1e-20   Cicer arietinum [garbanzo]
gb|AIC80774.1|  serine carboxypeptidase                               77.0    1e-20   Cicer arietinum [garbanzo]
gb|EPS74304.1|  hypothetical protein M569_00447                       72.8    2e-20   Genlisea aurea
ref|XP_004501743.1|  PREDICTED: serine carboxypeptidase-like 45-like  73.2    2e-20   Cicer arietinum [garbanzo]
ref|XP_003551804.1|  PREDICTED: serine carboxypeptidase-like 45-like  79.3    3e-20   Glycine max [soybeans]
gb|KHN13827.1|  Serine carboxypeptidase-like 45                       79.3    3e-20   Glycine soja [wild soybean]
emb|CDY66771.1|  BnaC02g44710D                                        91.7    3e-20   Brassica napus [oilseed rape]
ref|XP_003531913.1|  PREDICTED: serine carboxypeptidase-like 45-l...  79.3    3e-20   Glycine max [soybeans]
ref|XP_002280796.2|  PREDICTED: serine carboxypeptidase-like 45       78.2    3e-20   Vitis vinifera
ref|XP_002511104.1|  serine carboxypeptidase, putative                75.5    3e-20   Ricinus communis
gb|KHN47533.1|  Serine carboxypeptidase-like 45                       79.3    3e-20   Glycine soja [wild soybean]
ref|XP_006585840.1|  PREDICTED: serine carboxypeptidase-like 45-l...  79.0    4e-20   Glycine max [soybeans]
emb|CBI32794.3|  unnamed protein product                              74.3    6e-20   Vitis vinifera
ref|XP_010682654.1|  PREDICTED: serine carboxypeptidase-like 45       75.1    6e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010653629.1|  PREDICTED: serine carboxypeptidase-like 45       74.3    7e-20   Vitis vinifera
ref|XP_003520486.1|  PREDICTED: serine carboxypeptidase-like 45-l...  76.6    7e-20   Glycine max [soybeans]
ref|XP_010271865.1|  PREDICTED: serine carboxypeptidase-like 45 i...  74.3    7e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010271866.1|  PREDICTED: serine carboxypeptidase-like 45 i...  74.3    8e-20   Nelumbo nucifera [Indian lotus]
tpg|DAA42024.1|  TPA: hypothetical protein ZEAMMB73_711830            75.1    8e-20   
ref|XP_010271868.1|  PREDICTED: serine carboxypeptidase-like 45 i...  74.3    8e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010271867.1|  PREDICTED: serine carboxypeptidase-like 45 i...  74.3    9e-20   Nelumbo nucifera [Indian lotus]
ref|XP_008670742.1|  PREDICTED: serine carboxypeptidase-like 45       74.7    9e-20   Zea mays [maize]
gb|ACN31969.1|  unknown                                               75.1    9e-20   Zea mays [maize]
ref|XP_006576775.1|  PREDICTED: serine carboxypeptidase-like 45-l...  76.3    1e-19   
ref|XP_008791046.1|  PREDICTED: serine carboxypeptidase-like 45       79.3    1e-19   Phoenix dactylifera
ref|XP_006652227.1|  PREDICTED: serine carboxypeptidase-like 45-like  72.0    1e-19   Oryza brachyantha
gb|KCW90016.1|  hypothetical protein EUGRSUZ_A02215                   72.0    2e-19   Eucalyptus grandis [rose gum]
ref|XP_010023719.1|  PREDICTED: serine carboxypeptidase-like 45       72.0    2e-19   
ref|XP_010055754.1|  PREDICTED: serine carboxypeptidase-like 45       72.4    3e-19   Eucalyptus grandis [rose gum]
ref|XP_008798399.1|  PREDICTED: serine carboxypeptidase-like 42       70.5    4e-19   
ref|XP_003630573.1|  Serine carboxypeptidase                          72.8    5e-19   Medicago truncatula
ref|XP_010055744.1|  PREDICTED: serine carboxypeptidase-like 45 i...  70.9    6e-19   Eucalyptus grandis [rose gum]
ref|NP_001140326.1|  hypothetical protein                             70.1    1e-18   
tpg|DAA38063.1|  TPA: hypothetical protein ZEAMMB73_252249            70.1    1e-18   
gb|KDO83620.1|  hypothetical protein CISIN_1g0117641mg                89.4    1e-18   Citrus sinensis [apfelsine]
tpg|DAA38059.1|  TPA: hypothetical protein ZEAMMB73_252249            69.7    1e-18   
ref|XP_008667417.1|  PREDICTED: hypothetical protein isoform X1       69.7    2e-18   
ref|XP_008667418.1|  PREDICTED: hypothetical protein isoform X2       69.7    2e-18   
ref|XP_004503800.1|  PREDICTED: serine carboxypeptidase-like 45-like  70.9    2e-18   
ref|XP_011040753.1|  PREDICTED: serine carboxypeptidase-like 45       72.0    2e-18   Populus euphratica
ref|NP_001150027.1|  serine carboxypeptidase K10B2.2 precursor        68.9    2e-18   
ref|XP_006844530.1|  hypothetical protein AMTR_s00016p00162700        71.2    2e-18   
ref|XP_002307961.1|  hypothetical protein POPTR_0006s03440g           71.6    3e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011041403.1|  PREDICTED: serine carboxypeptidase-like 45       73.9    3e-18   Populus euphratica
ref|XP_010673054.1|  PREDICTED: serine carboxypeptidase-like 45       69.3    3e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009355265.1|  PREDICTED: serine carboxypeptidase-like 45       69.7    4e-18   Pyrus x bretschneideri [bai li]
gb|KDO83616.1|  hypothetical protein CISIN_1g0117641mg                88.2    5e-18   Citrus sinensis [apfelsine]
gb|KDO83619.1|  hypothetical protein CISIN_1g0117641mg                88.2    8e-18   Citrus sinensis [apfelsine]
ref|XP_002322611.2|  hypothetical protein POPTR_0016s03390g           72.8    8e-18   
ref|XP_002446348.1|  hypothetical protein SORBIDRAFT_06g014580        67.0    9e-18   Sorghum bicolor [broomcorn]
gb|KDO83617.1|  hypothetical protein CISIN_1g0117641mg                88.2    9e-18   Citrus sinensis [apfelsine]
ref|XP_008443351.1|  PREDICTED: serine carboxypeptidase-like 45       78.2    9e-18   
ref|XP_007028221.1|  Serine carboxypeptidase 45                       73.9    9e-18   
gb|KEH17941.1|  serine carboxypeptidase-like protein                  86.7    1e-17   Medicago truncatula
ref|XP_004136792.1|  PREDICTED: serine carboxypeptidase-like 45-like  78.2    1e-17   Cucumis sativus [cucumbers]
ref|XP_008357674.1|  PREDICTED: serine carboxypeptidase-like 45       67.8    2e-17   
ref|XP_006373742.1|  hypothetical protein POPTR_0016s04660g           73.2    2e-17   
ref|XP_007162065.1|  hypothetical protein PHAVU_001G120700g           68.9    2e-17   Phaseolus vulgaris [French bean]
ref|XP_003520484.1|  PREDICTED: serine carboxypeptidase-like 45-like  70.1    2e-17   Glycine max [soybeans]
gb|KHN30341.1|  Serine carboxypeptidase-like 45                       70.1    2e-17   Glycine soja [wild soybean]
ref|XP_002321745.2|  hypothetical protein POPTR_0015s11610g           62.8    3e-17   
gb|EMS60816.1|  Serine carboxypeptidase-like 45                       70.9    3e-17   Triticum urartu
ref|XP_009355267.1|  PREDICTED: serine carboxypeptidase-like 45 i...  67.4    3e-17   Pyrus x bretschneideri [bai li]
gb|ABN06118.1|  Peptidase S10, serine carboxypeptidase                82.4    3e-17   Medicago truncatula
gb|KDO83613.1|  hypothetical protein CISIN_1g0117641mg                87.4    4e-17   Citrus sinensis [apfelsine]
ref|XP_007203526.1|  hypothetical protein PRUPE_ppa026347mg           65.9    4e-17   Prunus persica
ref|XP_006434389.1|  hypothetical protein CICLE_v10000998mg           87.8    4e-17   
gb|KDO83614.1|  hypothetical protein CISIN_1g0117641mg                87.4    5e-17   Citrus sinensis [apfelsine]
ref|XP_010271870.1|  PREDICTED: serine carboxypeptidase-like 45 i...  68.9    5e-17   
ref|XP_010271869.1|  PREDICTED: serine carboxypeptidase-like 45 i...  68.9    6e-17   Nelumbo nucifera [Indian lotus]
ref|NP_001242846.1|  uncharacterized protein LOC100819443 precursor   72.8    8e-17   Glycine max [soybeans]
ref|XP_007224935.1|  hypothetical protein PRUPE_ppa021576mg           71.2    8e-17   
gb|KHN30339.1|  Serine carboxypeptidase-like 45                       72.4    9e-17   Glycine soja [wild soybean]
ref|XP_008240683.1|  PREDICTED: serine carboxypeptidase-like 45       63.9    9e-17   Prunus mume [ume]
gb|EAY93940.1|  hypothetical protein OsI_15713                        60.5    2e-16   Oryza sativa Indica Group [Indian rice]
gb|KEH37845.1|  serine carboxypeptidase-like protein                  64.7    2e-16   Medicago truncatula
gb|KDP37687.1|  hypothetical protein JCGZ_06344                       70.5    4e-16   Jatropha curcas
ref|XP_010653632.1|  PREDICTED: serine carboxypeptidase-like 45       64.7    5e-16   Vitis vinifera
ref|NP_001052663.1|  Os04g0396800                                     58.2    8e-16   
gb|KDO72509.1|  hypothetical protein CISIN_1g037032mg                 62.0    1e-15   Citrus sinensis [apfelsine]
ref|XP_006431096.1|  hypothetical protein CICLE_v10013839mg           62.0    1e-15   
gb|AFK49319.1|  unknown                                               81.6    1e-15   Lotus japonicus
emb|CBI32801.3|  unnamed protein product                              63.2    1e-15   Vitis vinifera
ref|XP_002277420.3|  PREDICTED: serine carboxypeptidase-like 45       63.2    1e-15   Vitis vinifera
ref|XP_009415855.1|  PREDICTED: serine carboxypeptidase-like 45       82.8    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN70439.1|  hypothetical protein VITISV_011900                   64.7    4e-15   Vitis vinifera
gb|KDO83605.1|  hypothetical protein CISIN_1g0117642mg                76.3    6e-15   Citrus sinensis [apfelsine]
gb|KJB11409.1|  hypothetical protein B456_001G257100                  55.8    7e-15   Gossypium raimondii
ref|XP_003633850.1|  PREDICTED: serine carboxypeptidase-like 46       60.1    8e-15   Vitis vinifera
ref|XP_009380118.1|  PREDICTED: serine carboxypeptidase-like 45 i...  81.3    1e-14   
ref|XP_010322561.1|  PREDICTED: serine carboxypeptidase-like 46 i...  59.7    1e-14   
gb|KGN59387.1|  hypothetical protein Csa_3G816000                     68.2    1e-14   Cucumis sativus [cucumbers]
ref|XP_004136609.1|  PREDICTED: serine carboxypeptidase-like 45-like  68.2    1e-14   
ref|XP_010322533.1|  PREDICTED: serine carboxypeptidase-like 45 i...  59.7    1e-14   
ref|XP_009380117.1|  PREDICTED: serine carboxypeptidase-like 45 i...  80.9    1e-14   
emb|CAN72075.1|  hypothetical protein VITISV_041582                   63.2    1e-14   Vitis vinifera
ref|XP_006838780.1|  hypothetical protein AMTR_s00002p00258640        58.9    1e-14   Amborella trichopoda
gb|KJB31552.1|  hypothetical protein B456_005G196500                  79.0    2e-14   Gossypium raimondii
ref|XP_004228838.1|  PREDICTED: serine carboxypeptidase-like 45 i...  59.7    2e-14   
ref|XP_004979352.1|  PREDICTED: serine carboxypeptidase-like 45-like  80.5    2e-14   Setaria italica
gb|KHG07552.1|  Serine carboxypeptidase-like 45                       56.2    2e-14   Gossypium arboreum [tree cotton]
ref|XP_006363923.1|  PREDICTED: serine carboxypeptidase-like 45-like  59.3    2e-14   Solanum tuberosum [potatoes]
ref|XP_002318164.2|  hypothetical protein POPTR_0012s10730g           80.1    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011042948.1|  PREDICTED: serine carboxypeptidase-like 45       80.1    3e-14   Populus euphratica
gb|KDO72510.1|  hypothetical protein CISIN_1g039529mg                 60.5    3e-14   Citrus sinensis [apfelsine]
gb|ACF83745.1|  unknown                                               78.2    3e-14   Zea mays [maize]
ref|XP_003577529.1|  PREDICTED: serine carboxypeptidase-like 45       79.7    3e-14   Brachypodium distachyon [annual false brome]
gb|ACF83470.1|  unknown                                               78.2    4e-14   Zea mays [maize]
ref|XP_010250555.1|  PREDICTED: serine carboxypeptidase-like 45       79.7    4e-14   Nelumbo nucifera [Indian lotus]
ref|XP_009404114.1|  PREDICTED: serine carboxypeptidase-like 45       79.7    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF83756.1|  unknown                                               78.2    4e-14   Zea mays [maize]
emb|CBI22166.3|  unnamed protein product                              56.6    4e-14   Vitis vinifera
ref|XP_006410496.1|  hypothetical protein EUTSA_v10016623mg           79.3    5e-14   Eutrema salsugineum [saltwater cress]
ref|XP_010099600.1|  Serine carboxypeptidase-like 45                  79.0    5e-14   Morus notabilis
gb|AAB80670.1|  putative serine carboxypeptidase II                   79.0    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469459.1|  PREDICTED: serine carboxypeptidase-like 46       79.0    6e-14   Camelina sativa [gold-of-pleasure]
ref|NP_850212.1|  serine carboxypeptidase-like 46                     79.0    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509871.1|  PREDICTED: serine carboxypeptidase-like 46       79.0    7e-14   Camelina sativa [gold-of-pleasure]
gb|KCW64996.1|  hypothetical protein EUGRSUZ_G02538                   55.5    7e-14   Eucalyptus grandis [rose gum]
ref|XP_010068798.1|  PREDICTED: serine carboxypeptidase-like 45       55.5    7e-14   
gb|KJB31548.1|  hypothetical protein B456_005G196500                  78.6    8e-14   Gossypium raimondii
ref|XP_002881286.1|  hypothetical protein ARALYDRAFT_482299           78.6    8e-14   
gb|EMT30771.1|  Serine carboxypeptidase-like 45                       78.6    9e-14   
ref|XP_008443182.1|  PREDICTED: serine carboxypeptidase-like 45 i...  67.4    9e-14   
ref|XP_008443181.1|  PREDICTED: serine carboxypeptidase-like 45 i...  67.4    9e-14   
ref|XP_006431097.1|  hypothetical protein CICLE_v10013776mg           60.5    1e-13   Citrus clementina [clementine]
ref|XP_010413849.1|  PREDICTED: serine carboxypeptidase-like 46       78.2    1e-13   Camelina sativa [gold-of-pleasure]
gb|ADN33978.1|  serine carboxypeptidase                               67.4    1e-13   Cucumis melo subsp. melo
ref|XP_002304645.2|  hypothetical protein POPTR_0003s16250g           77.0    1e-13   
ref|XP_011040386.1|  PREDICTED: serine carboxypeptidase-like 45       76.6    1e-13   Populus euphratica
gb|AFK47648.1|  unknown                                               74.7    1e-13   
ref|XP_002512656.1|  serine carboxypeptidase, putative                77.8    1e-13   
ref|XP_009592799.1|  PREDICTED: serine carboxypeptidase-like 40       53.1    1e-13   
gb|EMS58238.1|  Serine carboxypeptidase-like 45                       77.8    1e-13   
emb|CDY19500.1|  BnaC04g10990D                                        77.8    1e-13   
ref|XP_008777393.1|  PREDICTED: serine carboxypeptidase-like 45 i...  77.8    2e-13   
ref|NP_001151474.1|  LOC100285107 precursor                           77.8    2e-13   
ref|XP_002268172.1|  PREDICTED: serine carboxypeptidase-like 45       77.8    2e-13   
ref|XP_007209121.1|  hypothetical protein PRUPE_ppa005457mg           77.8    2e-13   
ref|XP_007223033.1|  hypothetical protein PRUPE_ppa005360mg           77.4    2e-13   
ref|XP_008777392.1|  PREDICTED: serine carboxypeptidase-like 45 i...  77.4    2e-13   
ref|XP_007223032.1|  hypothetical protein PRUPE_ppa005360mg           77.4    2e-13   
ref|XP_008222371.1|  PREDICTED: serine carboxypeptidase-like 45 i...  77.4    2e-13   
ref|XP_008222370.1|  PREDICTED: serine carboxypeptidase-like 45 i...  77.4    2e-13   
ref|XP_011073181.1|  PREDICTED: serine carboxypeptidase-like 45       77.4    2e-13   
gb|KDP23272.1|  hypothetical protein JCGZ_23105                       77.4    2e-13   
gb|EEC68261.1|  hypothetical protein OsI_36290                        77.4    2e-13   
ref|NP_001176565.1|  Os11g0522900                                     77.4    2e-13   
ref|XP_009143848.1|  PREDICTED: serine carboxypeptidase-like 46       77.0    3e-13   
gb|KFK44681.1|  hypothetical protein AALP_AA1G289600                  74.7    3e-13   
ref|XP_002277201.1|  PREDICTED: serine carboxypeptidase-like 45 i...  55.8    3e-13   
ref|XP_010661029.1|  PREDICTED: serine carboxypeptidase-like 45 i...  55.8    3e-13   
ref|XP_006662960.1|  PREDICTED: serine carboxypeptidase-like 45-like  77.0    3e-13   
ref|XP_010249188.1|  PREDICTED: serine carboxypeptidase-like 45       77.0    3e-13   
ref|XP_008392759.1|  PREDICTED: serine carboxypeptidase-like 45       75.5    3e-13   
ref|XP_007159975.1|  hypothetical protein PHAVU_002G282700g           75.5    4e-13   
ref|XP_010100042.1|  Serine carboxypeptidase-like 45                  76.3    4e-13   
gb|KGN63441.1|  hypothetical protein Csa_1G000650                     75.5    5e-13   
ref|XP_007099702.1|  Serine carboxypeptidase 46                       56.6    5e-13   
ref|XP_007159976.1|  hypothetical protein PHAVU_002G282700g           75.5    5e-13   
ref|XP_006482672.1|  PREDICTED: serine carboxypeptidase-like 46-like  59.7    5e-13   
ref|XP_007046208.1|  Serine carboxypeptidase 46 isoform 1             52.8    5e-13   
ref|XP_011002097.1|  PREDICTED: serine carboxypeptidase-like 45       76.3    5e-13   
ref|XP_010068797.1|  PREDICTED: serine carboxypeptidase-like 46       55.8    6e-13   
ref|XP_009334311.1|  PREDICTED: serine carboxypeptidase-like 45       76.3    6e-13   
ref|XP_009337518.1|  PREDICTED: serine carboxypeptidase-like 45       75.9    6e-13   
ref|XP_011036160.1|  PREDICTED: serine carboxypeptidase-like 45 i...  75.9    6e-13   
ref|XP_011036159.1|  PREDICTED: serine carboxypeptidase-like 45 i...  75.9    7e-13   
ref|XP_006304410.1|  hypothetical protein CARUB_v10010972mg           75.9    7e-13   
ref|XP_006294161.1|  hypothetical protein CARUB_v10023154mg           75.9    7e-13   
ref|XP_002297872.2|  serine carboxypeptidase S10 family protein       75.9    7e-13   
ref|XP_007043816.1|  Serine carboxypeptidase-like 45 isoform 1        75.9    7e-13   
gb|AFK47012.1|  unknown                                               74.7    7e-13   
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like       52.4    8e-13   
ref|XP_011020860.1|  PREDICTED: serine carboxypeptidase-like 45       75.5    9e-13   
gb|KEH35690.1|  serine carboxypeptidase-like protein                  75.5    1e-12   
emb|CDY35007.1|  BnaA01g27270D                                        50.1    1e-12   
ref|XP_009114428.1|  PREDICTED: serine carboxypeptidase-like 33       50.1    1e-12   
ref|XP_007159978.1|  hypothetical protein PHAVU_002G282700g           75.1    1e-12   
ref|XP_007159977.1|  hypothetical protein PHAVU_002G282700g           75.1    1e-12   
ref|XP_010942380.1|  PREDICTED: serine carboxypeptidase-like 45       75.1    1e-12   
ref|XP_010549304.1|  PREDICTED: serine carboxypeptidase-like 45 i...  75.1    1e-12   
gb|KHN31265.1|  Serine carboxypeptidase-like 45                       75.1    1e-12   
ref|XP_004152156.1|  PREDICTED: serine carboxypeptidase-like 45-like  75.1    1e-12   
ref|XP_004241645.1|  PREDICTED: serine carboxypeptidase-like 45       75.1    1e-12   
ref|XP_008454133.1|  PREDICTED: serine carboxypeptidase-like 45       75.1    1e-12   
ref|XP_010549305.1|  PREDICTED: serine carboxypeptidase-like 45 i...  75.1    1e-12   
gb|KJB40056.1|  hypothetical protein B456_007G044700                  75.1    1e-12   
gb|KHG09716.1|  Serine carboxypeptidase-like 45                       74.7    2e-12   
ref|XP_009762845.1|  PREDICTED: serine carboxypeptidase-like 45       53.5    2e-12   
ref|XP_006578724.1|  PREDICTED: serine carboxypeptidase-like 45-like  74.7    2e-12   
gb|KHN09723.1|  Serine carboxypeptidase-like 45                       74.7    2e-12   
ref|XP_009778790.1|  PREDICTED: serine carboxypeptidase-like 45       74.7    2e-12   
gb|KJB35835.1|  hypothetical protein B456_006G130200                  73.6    2e-12   
ref|NP_564298.1|  serine carboxypeptidase-like 45                     74.7    2e-12   
ref|XP_010478165.1|  PREDICTED: serine carboxypeptidase-like 45       74.7    2e-12   
ref|XP_003528093.2|  PREDICTED: serine carboxypeptidase-like 45-like  74.7    2e-12   
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1        49.7    2e-12   
gb|AAG51475.1|AC069471_6  serine carboxypeptidase II, putative        74.7    2e-12   
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...  50.4    2e-12   
ref|XP_006447850.1|  hypothetical protein CICLE_v10017890mg           72.4    2e-12   
ref|XP_010460580.1|  PREDICTED: serine carboxypeptidase-like 45       74.7    2e-12   
ref|XP_009113703.1|  PREDICTED: serine carboxypeptidase-like 45       74.7    2e-12   
emb|CDY11750.1|  BnaC03g58280D                                        74.7    2e-12   
ref|XP_009599118.1|  PREDICTED: serine carboxypeptidase-like 45       74.3    2e-12   
ref|XP_006406756.1|  hypothetical protein EUTSA_v10020640mg           49.3    2e-12   
ref|XP_006438865.1|  hypothetical protein CICLE_v10031451mg           72.4    2e-12   
ref|XP_006363922.1|  PREDICTED: serine carboxypeptidase-like 45-like  53.9    2e-12   
emb|CDY61693.1|  BnaC05g51120D                                        74.3    2e-12   
ref|XP_009109757.1|  PREDICTED: serine carboxypeptidase-like 45       74.3    2e-12   
gb|KFK44682.1|  hypothetical protein AALP_AA1G289900                  74.3    2e-12   
emb|CDX90124.1|  BnaA08g18600D                                        74.3    2e-12   
ref|XP_006415698.1|  hypothetical protein EUTSA_v10007573mg           74.3    2e-12   
ref|XP_009627244.1|  PREDICTED: serine carboxypeptidase-like 46       52.4    2e-12   
gb|EPS68240.1|  hypothetical protein M569_06534                       70.5    3e-12   
ref|XP_010265020.1|  PREDICTED: serine carboxypeptidase-like 45       57.4    3e-12   
ref|XP_010678341.1|  PREDICTED: serine carboxypeptidase-like 45       73.9    3e-12   
gb|EPS67928.1|  hypothetical protein M569_06845                       48.9    4e-12   
ref|XP_006297573.1|  hypothetical protein CARUB_v10013596mg           49.3    4e-12   
ref|XP_006363924.1|  PREDICTED: serine carboxypeptidase-like 45-like  52.4    4e-12   
ref|XP_010499305.1|  PREDICTED: serine carboxypeptidase-like 45       73.6    4e-12   
gb|AES77859.2|  serine carboxypeptidase-like protein                  73.6    4e-12   
gb|KJB35837.1|  hypothetical protein B456_006G130200                  73.6    4e-12   
sp|O82229.2|SCP23_ARATH  RecName: Full=Putative serine carboxypep...  50.8    4e-12   
ref|XP_004986851.1|  PREDICTED: serine carboxypeptidase-like 34-like  52.8    5e-12   
ref|XP_010505106.1|  PREDICTED: serine carboxypeptidase-like 33       48.9    5e-12   
ref|XP_003621641.1|  Serine carboxypeptidase-like protein             73.6    5e-12   
ref|XP_007162064.1|  hypothetical protein PHAVU_001G120600g           73.6    5e-12   
ref|XP_001765233.1|  predicted protein                                50.1    5e-12   
gb|AAC63669.1|  putative serine carboxypeptidase II                   50.4    5e-12   
gb|KJB35838.1|  hypothetical protein B456_006G130200                  73.6    5e-12   
gb|KJB35831.1|  hypothetical protein B456_006G130200                  73.6    5e-12   
gb|KHG30064.1|  Serine carboxypeptidase-like 45                       73.6    5e-12   
dbj|BAA94996.1|  serine carboxypeptidase II-like protein              49.3    5e-12   
ref|NP_188343.1|  protein serine carboxypeptidase-like 33             48.9    5e-12   
ref|XP_008374178.1|  PREDICTED: serine carboxypeptidase-like 45       73.2    5e-12   
ref|NP_179979.4|  serine carboxypeptidase-like 23                     50.4    6e-12   
ref|XP_006438863.1|  hypothetical protein CICLE_v10031451mg           72.4    6e-12   
ref|XP_002964377.1|  serine carboxypeptidase-like enzyme              73.2    6e-12   
ref|XP_002967656.1|  serine carboxypeptidase-like enzyme              73.2    7e-12   
gb|EYU21824.1|  hypothetical protein MIMGU_mgv1a006099mg              73.2    7e-12   
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...  49.3    7e-12   
ref|XP_008357780.1|  PREDICTED: serine carboxypeptidase-like 25 i...  49.3    7e-12   
ref|XP_010468225.1|  PREDICTED: serine carboxypeptidase-like 33       48.9    8e-12   
ref|XP_010044871.1|  PREDICTED: serine carboxypeptidase-like 45       72.8    8e-12   
tpg|DAA46115.1|  TPA: hypothetical protein ZEAMMB73_496779            51.6    8e-12   
ref|XP_002893504.1|  SCPL45                                           72.8    9e-12   
ref|XP_009378815.1|  PREDICTED: serine carboxypeptidase-like 45       72.4    1e-11   
gb|KGN59521.1|  hypothetical protein Csa_3G824180                     70.5    1e-11   
ref|XP_010239839.1|  PREDICTED: serine carboxypeptidase-like 45       72.4    1e-11   
gb|KHN08897.1|  Serine carboxypeptidase-like 45                       72.4    1e-11   
ref|XP_006438864.1|  hypothetical protein CICLE_v10031451mg           72.4    1e-11   
gb|KHF99089.1|  Serine carboxypeptidase-like 33                       55.1    1e-11   
ref|XP_008390188.1|  PREDICTED: serine carboxypeptidase-like 45       72.0    1e-11   
ref|XP_003554111.1|  PREDICTED: serine carboxypeptidase-like 45-like  72.0    1e-11   
ref|XP_002527614.1|  serine carboxypeptidase, putative                48.5    1e-11   
ref|XP_007145476.1|  hypothetical protein PHAVU_007G242200g           72.0    1e-11   
ref|XP_004975453.1|  PREDICTED: serine carboxypeptidase-like 45-like  72.0    2e-11   
ref|XP_008218862.1|  PREDICTED: serine carboxypeptidase-like 45       72.0    2e-11   
ref|XP_006482671.1|  PREDICTED: serine carboxypeptidase-like 44-like  61.6    2e-11   
ref|XP_004228389.1|  PREDICTED: serine carboxypeptidase-like 45       51.2    2e-11   
ref|XP_007137891.1|  hypothetical protein PHAVU_009G164600g           71.6    2e-11   
ref|XP_006341487.1|  PREDICTED: serine carboxypeptidase-like 45-like  71.2    2e-11   
ref|XP_002990798.1|  serine carboxypeptidase-like enzyme              71.2    2e-11   
ref|XP_002974500.1|  serine carboxypeptidase-like enzyme              71.2    2e-11   
ref|XP_011075459.1|  PREDICTED: serine carboxypeptidase-like 45       71.2    3e-11   
gb|KFK25189.1|  hypothetical protein AALP_AA8G078500                  54.3    3e-11   
gb|KHN08899.1|  Serine carboxypeptidase-like 46                       70.1    3e-11   
ref|XP_001776058.1|  predicted protein                                51.6    3e-11   
ref|XP_007032750.1|  Serine carboxypeptidase-like 25 isoform 3        48.1    3e-11   
emb|CBI21207.3|  unnamed protein product                              48.9    3e-11   
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...  48.9    3e-11   
ref|XP_004235841.1|  PREDICTED: serine carboxypeptidase-like 45 i...  71.2    3e-11   
ref|XP_001751694.1|  predicted protein                                52.8    3e-11   
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25       48.9    3e-11   
gb|KHN30340.1|  Serine carboxypeptidase-like 45                       71.2    3e-11   
ref|XP_008460256.1|  PREDICTED: serine carboxypeptidase-like 25 i...  49.3    3e-11   
ref|XP_003521119.1|  PREDICTED: serine carboxypeptidase-like 45-like  71.2    3e-11   
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25       48.1    3e-11   
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25       47.4    3e-11   
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...  47.8    3e-11   
ref|XP_001764645.1|  predicted protein                                49.7    3e-11   
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg           47.8    3e-11   
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25       47.4    3e-11   
ref|XP_006483005.1|  PREDICTED: serine carboxypeptidase-like 45-like  71.2    3e-11   
gb|KEH21654.1|  serine carboxypeptidase-like protein                  48.1    3e-11   
gb|KDO83181.1|  hypothetical protein CISIN_1g012396mg                 70.9    3e-11   
emb|CDP19962.1|  unnamed protein product                              47.4    3e-11   
ref|XP_006482750.1|  PREDICTED: serine carboxypeptidase-like 25-l...  47.8    3e-11   
ref|XP_006482748.1|  PREDICTED: serine carboxypeptidase-like 25-l...  47.8    3e-11   
ref|XP_004310134.1|  PREDICTED: serine carboxypeptidase-like 45       70.9    3e-11   
gb|KHN08898.1|  Serine carboxypeptidase-like 45                       70.9    3e-11   
ref|XP_010234952.1|  PREDICTED: serine carboxypeptidase-like 34       47.8    3e-11   
ref|XP_003554110.2|  PREDICTED: serine carboxypeptidase-like 45-like  70.9    4e-11   
ref|XP_011040747.1|  PREDICTED: serine carboxypeptidase-like 45 i...  70.9    4e-11   
ref|XP_006482749.1|  PREDICTED: serine carboxypeptidase-like 25-l...  47.8    4e-11   
ref|XP_011040748.1|  PREDICTED: serine carboxypeptidase-like 45 i...  70.9    4e-11   
ref|XP_009368797.1|  PREDICTED: serine carboxypeptidase-like 45       70.5    4e-11   
ref|XP_010429355.1|  PREDICTED: putative serine carboxypeptidase-...  47.0    5e-11   
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like  48.1    5e-11   
ref|XP_011086871.1|  PREDICTED: serine carboxypeptidase-like 45       70.5    5e-11   
gb|KDP37690.1|  hypothetical protein JCGZ_06347                       70.5    5e-11   
gb|KJB34659.1|  hypothetical protein B456_006G080600                  53.1    5e-11   
ref|XP_002307963.1|  hypothetical protein POPTR_0006s03490g           70.5    5e-11   
ref|XP_010274883.1|  PREDICTED: serine carboxypeptidase-like 35       50.4    6e-11   
gb|ABK25202.1|  unknown                                               70.1    6e-11   
ref|XP_006296368.1|  hypothetical protein CARUB_v10025540mg           47.8    6e-11   
ref|XP_011040750.1|  PREDICTED: serine carboxypeptidase-like 45       70.1    7e-11   
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                  48.1    7e-11   
ref|XP_009355269.1|  PREDICTED: serine carboxypeptidase-like 45       69.7    8e-11   
ref|XP_004136793.1|  PREDICTED: serine carboxypeptidase-like 45-like  69.7    8e-11   
ref|XP_009359890.1|  PREDICTED: serine carboxypeptidase-like 45       69.7    8e-11   
ref|XP_004513403.1|  PREDICTED: serine carboxypeptidase-like 45-like  69.7    8e-11   
ref|XP_002885191.1|  hypothetical protein ARALYDRAFT_479190           49.3    8e-11   
ref|XP_002465006.1|  hypothetical protein SORBIDRAFT_01g030370        48.5    8e-11   
ref|XP_009759845.1|  PREDICTED: serine carboxypeptidase-like 45       69.7    9e-11   
ref|XP_008369640.1|  PREDICTED: serine carboxypeptidase-like 45       69.7    9e-11   
ref|XP_010068795.1|  PREDICTED: serine carboxypeptidase-like 45       48.5    9e-11   
gb|KJB75608.1|  hypothetical protein B456_012G048700                  48.1    9e-11   
gb|ABR16719.1|  unknown                                               69.7    9e-11   
gb|KCW64994.1|  hypothetical protein EUGRSUZ_G02536                   48.5    9e-11   
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like  46.6    9e-11   
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25       49.3    1e-10   
gb|KHG16869.1|  Serine carboxypeptidase-like 25                       48.1    1e-10   
ref|XP_007043818.1|  Serine carboxypeptidase-like 45 isoform 3        69.7    1e-10   
ref|XP_010456442.1|  PREDICTED: serine carboxypeptidase-like 35       53.5    1e-10   
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like  47.0    1e-10   
ref|XP_006830556.1|  hypothetical protein AMTR_s00117p00106310        69.3    1e-10   
ref|XP_009615672.1|  PREDICTED: serine carboxypeptidase-like 45 i...  69.3    1e-10   
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like  48.9    1e-10   
ref|XP_009122437.1|  PREDICTED: serine carboxypeptidase-like 35       50.8    1e-10   
ref|XP_009591367.1|  PREDICTED: serine carboxypeptidase-like 31 i...  50.4    1e-10   
emb|CDX69961.1|  BnaA10g23100D                                        50.8    1e-10   
ref|XP_009591368.1|  PREDICTED: serine carboxypeptidase-like 31 i...  50.1    1e-10   
ref|XP_006347176.1|  PREDICTED: serine carboxypeptidase-like 31-like  51.2    1e-10   
gb|EYU28449.1|  hypothetical protein MIMGU_mgv1a004999mg              69.3    1e-10   
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25       47.0    1e-10   
ref|XP_009800559.1|  PREDICTED: serine carboxypeptidase-like 31 i...  50.1    1e-10   
ref|XP_009800560.1|  PREDICTED: serine carboxypeptidase-like 31 i...  50.1    1e-10   
ref|XP_010068957.1|  PREDICTED: serine carboxypeptidase-like 40       51.6    2e-10   
ref|XP_002517286.1|  serine carboxypeptidase, putative                55.1    2e-10   
ref|XP_002961948.1|  serine carboxypeptidase-like enzyme              68.9    2e-10   
gb|EYU18606.1|  hypothetical protein MIMGU_mgv1a004861mg              68.9    2e-10   
ref|XP_002971138.1|  serine carboxypeptidase-like enzyme              68.9    2e-10   
ref|XP_002871313.1|  hypothetical protein ARALYDRAFT_908774           53.1    2e-10   
ref|XP_006648043.1|  PREDICTED: serine carboxypeptidase 24-like       48.1    2e-10   
ref|XP_007046207.1|  Serine carboxypeptidase 46                       48.9    2e-10   
ref|XP_003593501.1|  Serine carboxypeptidase-like protein             49.3    2e-10   
ref|XP_003576614.1|  PREDICTED: serine carboxypeptidase II-3-like     47.4    2e-10   
ref|XP_006346528.1|  PREDICTED: serine carboxypeptidase II-3-like     46.2    3e-10   
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...  47.0    3e-10   



>ref|XP_009798650.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009798651.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nicotiana 
sylvestris]
Length=472

 Score =   112 bits (280),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  372  IPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKITVPYGAWFHKGQVGGWQTEYGNL  428


 Score = 84.3 bits (207),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSF+RGRRLPN TRPSIDD
Sbjct  429  LTFATVRGAAHMVPYAQPSRALHLFSSFIRGRRLPNNTRPSIDD  472



>ref|XP_006356286.1| PREDICTED: serine carboxypeptidase-like 42-like [Solanum tuberosum]
Length=472

 Score =   112 bits (279),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  372  IPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKITVPYGAWFHKGQVGGWQTEYGNL  428


 Score = 84.3 bits (207),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSF+RGRRLPN TRPSIDD
Sbjct  429  LTFATVRGAAHMVPYAQPARALHLFSSFIRGRRLPNNTRPSIDD  472



>ref|XP_004237734.1| PREDICTED: serine carboxypeptidase-like 42 [Solanum lycopersicum]
Length=472

 Score =   112 bits (279),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  372  IPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKITVPYGAWFHKGQVGGWQTEYGNL  428


 Score = 84.3 bits (207),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSF+RGRRLPN TRPSIDD
Sbjct  429  LTFATVRGAAHMVPYAQPARALHLFSSFIRGRRLPNNTRPSIDD  472



>ref|XP_009600050.1| PREDICTED: serine carboxypeptidase-like 42 [Nicotiana tomentosiformis]
Length=472

 Score =   112 bits (280),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  372  IPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKITVPYGAWFHKGQVGGWQTEYGNL  428


 Score = 83.6 bits (205),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSF+RGR+LPN TRPSIDD
Sbjct  429  LTFATVRGAAHMVPYAQPSRALHLFSSFIRGRKLPNNTRPSIDD  472



>ref|XP_011101717.1| PREDICTED: serine carboxypeptidase-like 42 [Sesamum indicum]
Length=469

 Score =   109 bits (272),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYGAWFH+ QVGGWATEYG  
Sbjct  369  IPVWIFSGDQDSVVPLLGSRTLVRELAHDLQFKITVPYGAWFHKGQVGGWATEYGNM  425


 Score = 84.3 bits (207),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN TRPSIDD
Sbjct  426  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNNTRPSIDD  469



>gb|EYU17411.1| hypothetical protein MIMGU_mgv1a005783mg [Erythranthe guttata]
Length=471

 Score =   109 bits (272),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAH+M FK+TVPYGAWFH+ QVGGWATEYG  
Sbjct  371  IPVWIFSGDQDSVVPLLGSRTLVRELAHEMQFKITVPYGAWFHKGQVGGWATEYGNL  427


 Score = 83.2 bits (204),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN TRP+IDD
Sbjct  428  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNNTRPAIDD  471



>ref|XP_010062160.1| PREDICTED: serine carboxypeptidase-like 42 [Eucalyptus grandis]
 gb|KCW69227.1| hypothetical protein EUGRSUZ_F02740 [Eucalyptus grandis]
Length=472

 Score =   107 bits (268),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAH++ FKVTVPYGAWFH+ QVGGWATEYG  
Sbjct  372  IPVWVFSGDQDSVVPLLGSRTLIRELAHNLNFKVTVPYGAWFHKGQVGGWATEYGNL  428


 Score = 84.7 bits (208),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN TRPSIDD
Sbjct  429  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNTTRPSIDD  472



>ref|XP_004139740.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g09040, mitochondrial-like [Cucumis sativus]
Length=1441

 Score =   109 bits (273),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  511   PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYG WFH+ QVGGW  EYG  
Sbjct  1342  PVWVFSGDQDSVVPLLGSRTLVRELAHDLKFKITVPYGTWFHKGQVGGWVIEYGNL  1397


 Score = 82.4 bits (202),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  345   LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
             LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN TRPSI D
Sbjct  1398  LTFATVRGAAHMVPYAQPSRALHLFSSFVGGRRLPNSTRPSIGD  1441



>ref|XP_007161488.1| hypothetical protein PHAVU_001G0732000g, partial [Phaseolus vulgaris]
 gb|ESW33482.1| hypothetical protein PHAVU_001G0732000g, partial [Phaseolus vulgaris]
Length=291

 Score =   106 bits (265),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAH++ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  191  IPVWVFSGDQDSVVPLLGSRTLIRELAHELQFKITVPYGAWFHKGQVGGWVTEYGNL  247


 Score = 85.1 bits (209),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN TRPSIDD
Sbjct  248  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNTTRPSIDD  291



>ref|XP_010664883.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Vitis 
vinifera]
Length=400

 Score =   106 bits (264),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  520  TTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             + PVW+FSGDQDSVVPLLGSRTL+RELA +M FK+TVP+GAWFH+ QVGGWATEYG  
Sbjct  298  NSIPVWVFSGDQDSVVPLLGSRTLIRELAQEMKFKITVPFGAWFHKGQVGGWATEYGNL  356


 Score = 85.1 bits (209),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN TRPSIDD
Sbjct  357  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNTTRPSIDD  400



>ref|XP_002278193.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Vitis 
vinifera]
 emb|CBI19968.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   105 bits (262),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  520  TTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             + PVW+FSGDQDSVVPLLGSRTL+RELA +M FK+TVP+GAWFH+ QVGGWATEYG  
Sbjct  365  NSIPVWVFSGDQDSVVPLLGSRTLIRELAQEMKFKITVPFGAWFHKGQVGGWATEYGNL  423


 Score = 85.1 bits (209),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN TRPSIDD
Sbjct  424  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNTTRPSIDD  467



>ref|XP_006581614.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Glycine 
max]
Length=414

 Score =   108 bits (271),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAHD+ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  314  IPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWVTEYGNL  370


 Score = 80.9 bits (198),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN T PSIDD
Sbjct  371  LTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTSPSIDD  414



>ref|XP_003544740.2| PREDICTED: serine carboxypeptidase-like 42-like isoformX1 [Glycine 
max]
Length=487

 Score =   105 bits (263),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAH++ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  387  IPVWVFSGDQDSVVPLLGSRTLIRELAHELQFKITVPYGAWFHKGQVGGWVTEYGNL  443


 Score = 83.6 bits (205),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN TRPSID+
Sbjct  444  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNTTRPSIDE  487



>gb|KHN05260.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=474

 Score =   105 bits (262),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAH++ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  374  IPVWVFSGDQDSVVPLLGSRTLIRELAHELQFKITVPYGAWFHKGQVGGWVTEYGNL  430


 Score = 83.2 bits (204),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN TRPSID+
Sbjct  431  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNTTRPSIDE  474



>ref|XP_006596272.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Glycine 
max]
Length=456

 Score =   105 bits (262),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAH++ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  356  IPVWVFSGDQDSVVPLLGSRTLIRELAHELQFKITVPYGAWFHKGQVGGWVTEYGNL  412


 Score = 83.2 bits (204),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN TRPSID+
Sbjct  413  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNTTRPSIDE  456



>ref|XP_004173353.1| PREDICTED: serine carboxypeptidase-like 42-like, partial [Cucumis 
sativus]
Length=393

 Score =   102 bits (255),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGK  347
             P+WI+SGD+DSVVPLLGSRTLVRELAHD+  KVTVPYGAWFH+ QVGGWA EYG 
Sbjct  293  IPLWIYSGDEDSVVPLLGSRTLVRELAHDLKLKVTVPYGAWFHKGQVGGWAIEYGN  348


 Score = 85.9 bits (211),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
             +LTFATVRGA HMVPFAQP RALHLFSSFVRGRRLPN TRPSIDD
Sbjct  348  NTLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNSTRPSIDD  393



>ref|XP_004490637.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Cicer 
arietinum]
Length=509

 Score =   107 bits (267),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAHD+ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  409  IPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWVTEYGNL  465


 Score = 81.3 bits (199),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN TRPSID+
Sbjct  466  LTFATVRGAAHMVPYAQPSRALHLFSSFVNGRRLPNTTRPSIDE  509



>ref|XP_003527966.2| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Glycine 
max]
Length=473

 Score =   107 bits (268),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAHD+ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  373  IPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWVTEYGNL  429


 Score = 81.3 bits (199),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN T PSIDD
Sbjct  430  LTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTSPSIDD  473



>gb|KHN23425.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=457

 Score =   107 bits (268),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAHD+ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  357  IPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWVTEYGNL  413


 Score = 80.9 bits (198),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN T PSIDD
Sbjct  414  LTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTSPSIDD  457



>ref|XP_004490638.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Cicer 
arietinum]
Length=476

 Score =   107 bits (267),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAHD+ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  376  IPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWVTEYGNL  432


 Score = 81.3 bits (199),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN TRPSID+
Sbjct  433  LTFATVRGAAHMVPYAQPSRALHLFSSFVNGRRLPNTTRPSIDE  476



>ref|XP_007019398.1| Serine carboxypeptidase-like 42 isoform 2 [Theobroma cacao]
 gb|EOY16623.1| Serine carboxypeptidase-like 42 isoform 2 [Theobroma cacao]
Length=433

 Score =   108 bits (269),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  333  IPVWVFSGDQDSVVPLLGSRTLVRELAHDLNFKITVPYGAWFHKHQVGGWVTEYGNL  389


 Score = 80.1 bits (196),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN TRPS+++
Sbjct  390  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNNTRPSVNE  433



>ref|XP_007019397.1| Serine carboxypeptidase-like 42 isoform 1 [Theobroma cacao]
 gb|EOY16622.1| Serine carboxypeptidase-like 42 isoform 1 [Theobroma cacao]
Length=473

 Score =   108 bits (269),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  373  IPVWVFSGDQDSVVPLLGSRTLVRELAHDLNFKITVPYGAWFHKHQVGGWVTEYGNL  429


 Score = 80.1 bits (196),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN TRPS+++
Sbjct  430  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNNTRPSVNE  473



>gb|KDP43043.1| hypothetical protein JCGZ_25229 [Jatropha curcas]
Length=491

 Score =   109 bits (273),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYGAWFH+ QVGGWATEYG  
Sbjct  391  IPVWVFSGDQDSVVPLLGSRTLVRELAHDLNFKITVPYGAWFHKGQVGGWATEYGNL  447


 Score = 78.2 bits (191),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN T  SIDD
Sbjct  448  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNRTHISIDD  491



>ref|XP_010244030.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nelumbo 
nucifera]
Length=469

 Score =   108 bits (271),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHD+ F+VTVPYGAWFH+ QVGGWATEYG  
Sbjct  369  IPVWVFSGDQDSVVPLLGSRTLVRELAHDLNFEVTVPYGAWFHKGQVGGWATEYGNL  425


 Score = 79.0 bits (193),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN TRPSI D
Sbjct  426  LTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTRPSIYD  469



>ref|XP_004148827.1| PREDICTED: serine carboxypeptidase-like 42-like [Cucumis sativus]
Length=480

 Score =   102 bits (254),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGK  347
             P+WI+SGD+DSVVPLLGSRTLVRELAHD+  KVTVPYGAWFH+ QVGGWA EYG 
Sbjct  380  IPLWIYSGDEDSVVPLLGSRTLVRELAHDLKLKVTVPYGAWFHKGQVGGWAIEYGN  435


 Score = 85.5 bits (210),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  348  SLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            +LTFATVRGA HMVPFAQP RALHLFSSFVRGRRLPN TRPSIDD
Sbjct  436  TLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNSTRPSIDD  480



>ref|XP_010244029.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nelumbo 
nucifera]
Length=505

 Score =   108 bits (271),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHD+ F+VTVPYGAWFH+ QVGGWATEYG  
Sbjct  405  IPVWVFSGDQDSVVPLLGSRTLVRELAHDLNFEVTVPYGAWFHKGQVGGWATEYGNL  461


 Score = 79.0 bits (193),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN TRPSI D
Sbjct  462  LTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTRPSIYD  505



>ref|XP_011074776.1| PREDICTED: serine carboxypeptidase-like 42 [Sesamum indicum]
Length=475

 Score =   110 bits (274),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYGAWFH+ QVGGWATEYG  
Sbjct  375  IPVWIFSGDQDSVVPLLGSRTLVRELAHDLNFKITVPYGAWFHKGQVGGWATEYGNL  431


 Score = 76.6 bits (187),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN T P I D
Sbjct  432  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNTTHPPIYD  475



>ref|XP_004290564.1| PREDICTED: serine carboxypeptidase-like 42 [Fragaria vesca subsp. 
vesca]
Length=467

 Score =   106 bits (265),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGD+DSVVPLLGSRTL+RELAHD+ FK+TVPYGAWFH+ QVGGWATEYG  
Sbjct  367  IPLWVFSGDEDSVVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWATEYGNL  423


 Score = 79.0 bits (193),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFVR RRLPN TRP ID+
Sbjct  424  LTFATVRGAAHMVPYAQPSRALHLFSSFVRNRRLPNTTRPPIDE  467



>ref|XP_003615811.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES98769.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=470

 Score =   107 bits (267),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTL+RELA D+ FKVTVPYGAWFH+ QVGGWATEYG  
Sbjct  370  IPVWIFSGDQDSVVPLLGSRTLIRELADDLKFKVTVPYGAWFHKGQVGGWATEYGNL  426


 Score = 77.8 bits (190),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVP+AQP RALHLFS+FV GRRLPN TRPSI+
Sbjct  427  LTFATVRGAAHMVPYAQPSRALHLFSNFVNGRRLPNTTRPSIE  469



>ref|XP_010245825.1| PREDICTED: serine carboxypeptidase-like 42 [Nelumbo nucifera]
Length=470

 Score =   107 bits (267),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELA D+ FKVTVPYGAWFH+ QVGGWATEYG  
Sbjct  370  IPVWVFSGDQDSVVPLLGSRTLVRELARDLNFKVTVPYGAWFHKGQVGGWATEYGNL  426


 Score = 77.8 bits (190),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSF+RGRRLPN T PSI D
Sbjct  427  LTFATVRGAAHMVPYAQPSRALHLFSSFIRGRRLPNTTHPSILD  470



>ref|XP_006578942.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Glycine 
max]
Length=454

 Score =   108 bits (270),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAHD+ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  354  IPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWVTEYGNL  410


 Score = 76.6 bits (187),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV  +RLPN T PSIDD
Sbjct  411  LTFATVRGAAHMVPYAQPSRALHLFSSFVLRKRLPNTTHPSIDD  454



>ref|XP_008441654.1| PREDICTED: serine carboxypeptidase-like 42 [Cucumis melo]
Length=408

 Score = 99.8 bits (247),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGK  347
             P+WIFSGD+DSVVPLLGSRTLVRELA D+  KVTVPYGAWFH+ QVGGWA EYG 
Sbjct  308  IPLWIFSGDEDSVVPLLGSRTLVRELALDLKLKVTVPYGAWFHKGQVGGWAIEYGN  363


 Score = 85.1 bits (209),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
             +LTFATVRGA HMVPFAQP RALHLFSSFVRGRRLPN TRPSIDD
Sbjct  363  NTLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNSTRPSIDD  408



>ref|XP_008461496.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Cucumis 
melo]
Length=441

 Score =   104 bits (260),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYG WFH+ QVGGW  EYG  
Sbjct  341  IPVWIFSGDQDSVVPLLGSRTLVRELAHDLKFKITVPYGTWFHKGQVGGWVIEYGNL  397


 Score = 80.1 bits (196),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN TRPSI+D
Sbjct  398  LTFATVRGAAHMVPYAQPSRALHLFSSFVGGRRLPNSTRPSIED  441



>ref|XP_008461495.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Cucumis 
melo]
Length=472

 Score =   104 bits (260),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYG WFH+ QVGGW  EYG  
Sbjct  372  IPVWIFSGDQDSVVPLLGSRTLVRELAHDLKFKITVPYGTWFHKGQVGGWVIEYGNL  428


 Score = 80.1 bits (196),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN TRPSI+D
Sbjct  429  LTFATVRGAAHMVPYAQPSRALHLFSSFVGGRRLPNSTRPSIED  472



>ref|XP_009360732.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=473

 Score =   106 bits (265),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHD+ F +TVPYGAWFH+ QVGGWATEYG  
Sbjct  373  IPVWVFSGDQDSVVPLLGSRTLVRELAHDLKFPITVPYGAWFHKGQVGGWATEYGNL  429


 Score = 77.8 bits (190),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFS+FVRGRRLPN   PSID+
Sbjct  430  LTFATVRGAAHMVPYAQPSRALHLFSAFVRGRRLPNTAHPSIDE  473



>ref|XP_004167283.1| PREDICTED: serine carboxypeptidase-like 42-like [Cucumis sativus]
Length=377

 Score =   105 bits (261),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYG WFH+ QVGGW  EYG  
Sbjct  277  IPVWVFSGDQDSVVPLLGSRTLVRELAHDLKFKITVPYGTWFHKGQVGGWVIEYGNL  333


 Score = 79.3 bits (194),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN TRPSI D
Sbjct  334  LTFATVRGAAHMVPYAQPSRALHLFSSFVGGRRLPNSTRPSIGD  377



>ref|XP_006434388.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
 gb|ESR47628.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
Length=479

 Score =   107 bits (266),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELA D+ F+VTVPYGAWFH++QVGGWATEYG  
Sbjct  379  IPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWATEYGNI  435


 Score = 77.0 bits (188),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTF TVRGA HMVP+AQP RALHLFSSFV GRRLPN TRP+I D
Sbjct  436  LTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD  479



>ref|XP_003522555.2| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Glycine 
max]
 gb|KHN44256.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=473

 Score =   107 bits (268),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAHD+ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  373  IPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWVTEYGNL  429


 Score = 75.9 bits (185),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV  +RLPN T PSIDD
Sbjct  430  LTFATVRGAAHMVPYAQPSRALHLFSSFVLRKRLPNTTHPSIDD  473



>ref|XP_007137531.1| hypothetical protein PHAVU_009G134900g [Phaseolus vulgaris]
 gb|ESW09525.1| hypothetical protein PHAVU_009G134900g [Phaseolus vulgaris]
Length=472

 Score =   105 bits (262),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAH++ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  373  IPVWVFSGDQDSVVPLLGSRTLIRELAHELKFKITVPYGAWFHQGQVGGWVTEYGNL  429


 Score = 78.2 bits (191),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPFAQP RAL LFSSFVRG RLPN TRPSID
Sbjct  430  LTFATVRGAAHMVPFAQPSRALRLFSSFVRGMRLPNTTRPSID  472



>gb|KGN44500.1| hypothetical protein Csa_7G319000 [Cucumis sativus]
Length=472

 Score =   104 bits (259),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYG WFH+ QVGGW  EYG  
Sbjct  372  IPVWVFSGDQDSVVPLLGSRTLVRELAHDLKFKITVPYGTWFHKGQVGGWVIEYGNL  428


 Score = 79.0 bits (193),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN TRPSI D
Sbjct  429  LTFATVRGAAHMVPYAQPSRALHLFSSFVGGRRLPNSTRPSIGD  472



>ref|XP_008373913.1| PREDICTED: serine carboxypeptidase-like 42 [Malus domestica]
Length=473

 Score =   103 bits (257),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELA D+ F +TVPYGAWFH+ QVGGWATEYG  
Sbjct  373  IPVWVFSGDQDSVVPLLGSRTLIRELAXDLKFPITVPYGAWFHKGQVGGWATEYGNL  429


 Score = 79.3 bits (194),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN TRP ID+
Sbjct  430  LTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTRPPIDE  473



>ref|XP_006472927.1| PREDICTED: serine carboxypeptidase-like 42-like [Citrus sinensis]
Length=478

 Score =   105 bits (262),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELA D+ F+VTVPYGAWFH++QVGGW TEYG  
Sbjct  378  IPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNL  434


 Score = 77.0 bits (188),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  366  GQQSMGSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            G +    LTF TVRGA HMVP+AQP RALHLFSSFV GRRLPN TRP+I D
Sbjct  428  GTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD  478



>ref|XP_006280410.1| hypothetical protein CARUB_v10026343mg [Capsella rubella]
 gb|EOA13308.1| hypothetical protein CARUB_v10026343mg [Capsella rubella]
Length=471

 Score =   108 bits (269),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVP LGSRTLVRELA D+ FK TVPYGAWFH+KQVGGWA EYGK 
Sbjct  371  IPVWIFSGDQDSVVPFLGSRTLVRELAQDLNFKTTVPYGAWFHKKQVGGWAIEYGKL  427


 Score = 73.6 bits (179),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN T  S D+
Sbjct  428  LTFATVRGAAHMVPYAQPSRALHLFSSFVNGRRLPNQTHSSTDE  471



>ref|XP_010519388.1| PREDICTED: serine carboxypeptidase-like 42 [Tarenaya hassleriana]
Length=471

 Score =   100 bits (248),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            VWIFSGDQDSVVPLLGSRTLVRELA ++ FK TVPYGAWFH+ QVGGW TEYG  
Sbjct  373  VWIFSGDQDSVVPLLGSRTLVRELAQELDFKNTVPYGAWFHKGQVGGWVTEYGNL  427


 Score = 81.6 bits (200),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV G+RLPN TRPSIDD
Sbjct  428  LTFATVRGAAHMVPYAQPSRALHLFSSFVSGQRLPNTTRPSIDD  471



>ref|XP_008237677.1| PREDICTED: serine carboxypeptidase-like 42 [Prunus mume]
Length=471

 Score =   104 bits (259),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAHD+ F++TVPYG WFH+ Q GGWATEYG  
Sbjct  373  IPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFQITVPYGVWFHKGQAGGWATEYGDL  429


 Score = 76.6 bits (187),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP+AQP RALHLFSSF+RGRRLPN T PSI
Sbjct  430  LTFATVRGAAHMVPYAQPSRALHLFSSFIRGRRLPNTTLPSI  471



>ref|XP_010679983.1| PREDICTED: serine carboxypeptidase-like 42 [Beta vulgaris subsp. 
vulgaris]
Length=477

 Score =   108 bits (269),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGDQDSVVPLLGSRTLVRELAHD+ FK TVPYGAWFH+ QVGGWATEYG  
Sbjct  377  IPIWVFSGDQDSVVPLLGSRTLVRELAHDLKFKATVPYGAWFHKGQVGGWATEYGNL  433


 Score = 72.0 bits (175),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+ QP RALHLFSSF+RGRRLP+ T+ S+ D
Sbjct  434  LTFATVRGAAHMVPYTQPSRALHLFSSFIRGRRLPSTTKSSMGD  477



>ref|XP_002526159.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF36235.1| serine carboxypeptidase, putative [Ricinus communis]
Length=476

 Score =   105 bits (263),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELA D+ FK+TVPYGAWFH+ QVGGWATEYG  
Sbjct  376  IPVWVFSGDQDSVVPLLGSRTLVRELADDLKFKITVPYGAWFHKGQVGGWATEYGDL  432


 Score = 74.3 bits (181),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTF TVRGA HMVP+AQP RALHLFSSFVRGRRLP+  R  IDD
Sbjct  433  LTFVTVRGAAHMVPYAQPSRALHLFSSFVRGRRLPSTARTPIDD  476



>ref|XP_009377698.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=474

 Score =   105 bits (261),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVP LGSRTL+RELAHD+ F +TVPYGAWFH+ QVGGWATEYG  
Sbjct  374  IPVWVFSGDQDSVVPFLGSRTLIRELAHDLKFPITVPYGAWFHKGQVGGWATEYGNL  430


 Score = 75.1 bits (183),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN T PSI
Sbjct  431  LTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTLPSI  472



>ref|XP_009377699.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=473

 Score =   103 bits (256),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVP LGSRTL+RELAHD+ F +TVPYGAWFH+ QV GWATEYG  
Sbjct  373  IPVWVFSGDQDSVVPFLGSRTLIRELAHDLKFPITVPYGAWFHKGQVAGWATEYGNL  429


 Score = 76.6 bits (187),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVP+AQP RALHLFSSFV G+RLPN TRP ID
Sbjct  430  LTFATVRGAAHMVPYAQPSRALHLFSSFVLGQRLPNTTRPPID  472



>gb|KJB59375.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
Length=344

 Score =   109 bits (273),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYGAWFH++QVGGW TEYG  
Sbjct  244  IPVWIFSGDQDSVVPLLGSRTLVRELAHDLKFKITVPYGAWFHKQQVGGWVTEYGNL  300


 Score = 69.3 bits (168),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP++QP RALHLFSSFV GRRLPN   P I
Sbjct  301  LTFATVRGAAHMVPYSQPSRALHLFSSFVHGRRLPNNIHPPI  342



>gb|KJB59374.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
 gb|KJB59376.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
 gb|KJB59378.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
Length=483

 Score =   109 bits (273),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYGAWFH++QVGGW TEYG  
Sbjct  383  IPVWIFSGDQDSVVPLLGSRTLVRELAHDLKFKITVPYGAWFHKQQVGGWVTEYGNL  439


 Score = 69.7 bits (169),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP++QP RALHLFSSFV GRRLPN   P I
Sbjct  440  LTFATVRGAAHMVPYSQPSRALHLFSSFVHGRRLPNNIHPPI  481



>gb|KJB59377.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
Length=468

 Score =   109 bits (272),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYGAWFH++QVGGW TEYG  
Sbjct  368  IPVWIFSGDQDSVVPLLGSRTLVRELAHDLKFKITVPYGAWFHKQQVGGWVTEYGNL  424


 Score = 69.7 bits (169),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP++QP RALHLFSSFV GRRLPN   P I
Sbjct  425  LTFATVRGAAHMVPYSQPSRALHLFSSFVHGRRLPNNIHPPI  466



>ref|XP_008373914.1| PREDICTED: serine carboxypeptidase-like 42 [Malus domestica]
Length=474

 Score =   103 bits (258),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELA D+ F +TVPYGAWFH+ QVGGWATEYG  
Sbjct  374  IPVWVFSGDQDSVVPLLGSRTLIRELAXDLKFPITVPYGAWFHKGQVGGWATEYGNL  430


 Score = 75.1 bits (183),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN T PSI
Sbjct  431  LTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTLPSI  472



>emb|CDP12019.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   104 bits (260),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHD+  + TVPYGAWFH++QVGGW TEYG  
Sbjct  370  IPVWVFSGDQDSVVPLLGSRTLVRELAHDLHLQTTVPYGAWFHKRQVGGWVTEYGNL  426


 Score = 74.3 bits (181),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVPFAQP RALHLFSSFVRG RLPN T+  +DD
Sbjct  427  LTFATVRGAAHMVPFAQPSRALHLFSSFVRGWRLPNTTQTRMDD  470



>ref|XP_009377728.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=491

 Score =   106 bits (265),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTL+RELAHD+ F +TVPYGAWFH+ QVGGWATEYG  
Sbjct  391  IPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFPITVPYGAWFHKGQVGGWATEYGNL  447


 Score = 72.0 bits (175),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP+AQP RAL LFSSFV GRRLPN T PSI
Sbjct  448  LTFATVRGAAHMVPYAQPSRALRLFSSFVHGRRLPNTTLPSI  489



>ref|XP_002865546.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41805.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   103 bits (256),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVWIFSGDQDSVVP +GSRTLVRELA+D+ F+ TVPYGAWFH+ QVGGWA EYGK 
Sbjct  374  PVWIFSGDQDSVVPFVGSRTLVRELANDLNFETTVPYGAWFHKSQVGGWAIEYGKL  429


 Score = 74.7 bits (182),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN T  S DD
Sbjct  430  LTFATVRGAAHMVPYAQPSRALHLFSSFVSGRRLPNNTHSSTDD  473



>ref|XP_011027377.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
42 [Populus euphratica]
Length=480

 Score =   104 bits (260),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLV+ELA D+ FK+TVPYG WFH+ QVGGWATEYG  
Sbjct  380  IPVWVFSGDQDSVVPLLGSRTLVKELAQDLNFKITVPYGTWFHKGQVGGWATEYGNL  436


 Score = 73.6 bits (179),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVR A HMVP+AQP RALHLFSSFVRGRRLPN T   +DD
Sbjct  437  LTFATVRAAAHMVPYAQPSRALHLFSSFVRGRRLPNTTHVPMDD  480



>ref|XP_002300939.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE80212.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=480

 Score =   104 bits (260),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLV+ELA D+ FK+TVPYG WFH+ QVGGWATEYG  
Sbjct  380  IPVWVFSGDQDSVVPLLGSRTLVKELAQDLNFKITVPYGTWFHKGQVGGWATEYGNL  436


 Score = 73.2 bits (178),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVR A HMVP+AQP RALHLFSSFVRGRRLPN T   +DD
Sbjct  437  LTFATVRSAAHMVPYAQPSRALHLFSSFVRGRRLPNTTDVRMDD  480



>gb|KHF97371.1| Serine carboxypeptidase-like 42 [Gossypium arboreum]
Length=483

 Score =   106 bits (265),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPY AWFH++QVGGW TEYG  
Sbjct  383  IPVWIFSGDQDSVVPLLGSRTLVRELAHDLKFKITVPYRAWFHKQQVGGWVTEYGNL  439


 Score = 71.6 bits (174),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP++QP RALHLFSSFV GRRLPN T P I
Sbjct  440  LTFATVRGAAHMVPYSQPSRALHLFSSFVHGRRLPNNTHPPI  481



>ref|XP_010110480.1| Serine carboxypeptidase-like 42 [Morus notabilis]
 gb|EXC26581.1| Serine carboxypeptidase-like 42 [Morus notabilis]
Length=442

 Score = 94.7 bits (234),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  493  GDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            GDQDSVVPLLGSRTL+RELAH++ FK+TVPYGAWFH+ QVGGWATEYG  
Sbjct  349  GDQDSVVPLLGSRTLIRELAHELKFKITVPYGAWFHKGQVGGWATEYGNL  398


 Score = 82.8 bits (203),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVPFAQP RALHLFSSFV GRRLPN TRPSIDD
Sbjct  399  LTFATVRGASHMVPFAQPSRALHLFSSFVHGRRLPNNTRPSIDD  442



>ref|XP_010442147.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010442148.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010442149.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=465

 Score =   105 bits (261),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVP LGSRTLVRELA D+ F  TVPYGAWFH++QVGGWA EYGK 
Sbjct  365  IPVWIFSGDQDSVVPFLGSRTLVRELAQDLNFATTVPYGAWFHKRQVGGWAIEYGKL  421


 Score = 71.6 bits (174),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALH FSSFV GRRLPN T  S D+
Sbjct  422  LTFATVRGAAHMVPYAQPSRALHFFSSFVSGRRLPNQTHSSTDE  465



>ref|XP_010930631.1| PREDICTED: serine carboxypeptidase-like 42 [Elaeis guineensis]
Length=476

 Score =   101 bits (252),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVP LGSRTLVRELAHD+ F VTVPY AWF++ QVGGWATEYG  
Sbjct  372  IPVWIFSGDQDSVVPFLGSRTLVRELAHDLKFGVTVPYSAWFYKGQVGGWATEYGNL  428


 Score = 75.1 bits (183),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVPFAQP RAL LF SFV G+RLPN T PSIDD
Sbjct  429  LTFATVRGAAHMVPFAQPARALRLFRSFVNGQRLPNTTYPSIDD  472



>ref|XP_009112251.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=469

 Score =   103 bits (257),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            VWIFSGDQDSVVPLLGSRTLVRELAHD+ F  T+PYG WFH+ QVGGW TEYGK 
Sbjct  371  VWIFSGDQDSVVPLLGSRTLVRELAHDLNFSTTLPYGPWFHKNQVGGWVTEYGKI  425


 Score = 72.8 bits (177),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALH+FSSFVRGRRLPN T  S D+
Sbjct  426  LTFATVRGAAHMVPYAQPSRALHIFSSFVRGRRLPNSTHYSPDE  469



>emb|CDY37202.1| BnaA09g08230D [Brassica napus]
Length=456

 Score =   103 bits (256),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            VWIFSGDQDSVVPLLGSRTLVRELAHD+ F  T+PYG WFH+ QVGGW TEYGK 
Sbjct  358  VWIFSGDQDSVVPLLGSRTLVRELAHDLNFSTTLPYGPWFHKNQVGGWVTEYGKI  412


 Score = 72.8 bits (177),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALH+FSSFVRGRRLPN T  S D+
Sbjct  413  LTFATVRGAAHMVPYAQPSRALHIFSSFVRGRRLPNSTHYSPDE  456



>gb|AFK38452.1| unknown [Lotus japonicus]
Length=160

 Score =   104 bits (259),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+ SGDQDSVVPLLGSRTL+RELAH++ +KVTVPYGAWFH+ QVGGW TEYG  
Sbjct  59   IPVWVLSGDQDSVVPLLGSRTLIRELAHELQYKVTVPYGAWFHKGQVGGWVTEYGNL  115


 Score = 71.2 bits (173),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP+AQP RAL LFS+FVRG RLPN TRPS+
Sbjct  116  LTFATVRGAAHMVPYAQPSRALGLFSAFVRGSRLPNTTRPSL  157



>ref|NP_199039.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana]
 sp|Q9FH05.1|SCP42_ARATH RecName: Full=Serine carboxypeptidase-like 42; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK32772.1|AF361604_1 AT5g42240/K5J14_4 [Arabidopsis thaliana]
 dbj|BAB10197.1| serine carboxypeptidase II-like [Arabidopsis thaliana]
 gb|AAN28838.1| At5g42240/K5J14_4 [Arabidopsis thaliana]
 gb|AED94786.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana]
Length=473

 Score =   102 bits (254),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            P+WIFSGDQDSVVP  GSRTLVRELA D+ FK TVPYGAWFH+ QVGGWA EYGK 
Sbjct  374  PIWIFSGDQDSVVPFGGSRTLVRELAQDLNFKTTVPYGAWFHKSQVGGWAIEYGKL  429


 Score = 73.2 bits (178),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN T  S D+
Sbjct  430  LTFATVRGAAHMVPYAQPSRALHLFSSFVSGRRLPNNTHSSTDE  473



>dbj|BAJ87921.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=303

 Score =   103 bits (256),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAHDMG  VTVPY  WF + QVGGWATEYG  
Sbjct  203  IPVWIFSGDQDSVVPLLGSRTLVRELAHDMGLPVTVPYRTWFRKGQVGGWATEYGNL  259


 Score = 71.2 bits (173),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVPFAQP RAL LF SFV G+RLPN T P IDD
Sbjct  260  LTFATVRGASHMVPFAQPDRALGLFRSFVLGQRLPNTTYPPIDD  303



>emb|CDY66139.1| BnaAnng21620D [Brassica napus]
Length=486

 Score =   103 bits (256),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            VWIFSGDQDSVVPLLGSRTLVRELAHD+ F  T+PYG WFH+ QVGGW TEYGK 
Sbjct  381  VWIFSGDQDSVVPLLGSRTLVRELAHDLNFSTTLPYGPWFHKDQVGGWVTEYGKL  435


 Score = 71.2 bits (173),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT  232
            LTFATVRGA HMVP+AQP RALHLFSSFVRGRRLPN T
Sbjct  436  LTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNNT  473



>ref|XP_002268397.1| PREDICTED: serine carboxypeptidase-like 42 [Vitis vinifera]
 emb|CBI20040.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   100 bits (250),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPL+GSRTLVRELA D+ F+ TVPYGAWFH+ QVGGW TEYG  
Sbjct  375  IPVWIFSGDQDSVVPLMGSRTLVRELAKDLNFQHTVPYGAWFHKGQVGGWQTEYGNL  431


 Score = 72.8 bits (177),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMV ++QP RALHLF++F+ GRRLPN TRPSID
Sbjct  432  LTFATVRGAAHMVSYSQPSRALHLFATFIHGRRLPNNTRPSID  474



>gb|EPS65711.1| hypothetical protein M569_09067, partial [Genlisea aurea]
Length=167

 Score =   101 bits (252),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWI+SGDQDSVVPLLGSRTLVRELAHDM   VTVPYGAWF + QVGG+ATEYG  
Sbjct  70   IPVWIYSGDQDSVVPLLGSRTLVRELAHDMKLPVTVPYGAWFDKHQVGGFATEYGNM  126


 Score = 72.0 bits (175),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPS  223
            LTFATVRGA HMVP++QP RALHLFSSFV GRRLPN T PS
Sbjct  127  LTFATVRGAAHMVPYSQPSRALHLFSSFVNGRRLPNDTNPS  167



>ref|XP_010482006.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=473

 Score =   101 bits (252),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVP LGSRT VRELA D  F+ TVPYGAWFH++QVGGWA EYGK 
Sbjct  373  IPVWIFSGDQDSVVPFLGSRTPVRELAQDFNFETTVPYGAWFHKRQVGGWAIEYGKL  429


 Score = 72.0 bits (175),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSF+ GRRLPN T  S D+
Sbjct  430  LTFATVRGAAHMVPYAQPSRALHLFSSFMSGRRLPNQTHSSTDE  473



>gb|EAY80352.1| hypothetical protein OsI_35523 [Oryza sativa Indica Group]
Length=529

 Score =   102 bits (255),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHDMG  VTVPY +WF R QVGGW TEYG  
Sbjct  430  IPVWVFSGDQDSVVPLLGSRTLVRELAHDMGLHVTVPYSSWFRRGQVGGWVTEYGNI  486


 Score = 70.5 bits (171),  Expect(2) = 1e-34, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPFAQP RAL LF SF  GRRLPN T P I+
Sbjct  487  LTFATVRGASHMVPFAQPDRALGLFQSFALGRRLPNTTHPPIN  529



>ref|XP_009406489.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   103 bits (256),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVW+FSGDQDSVVPLLGSRTLVRELAHD+ F+VTVPYG WF++ QVGGW TEYG  
Sbjct  372  PVWVFSGDQDSVVPLLGSRTLVRELAHDLNFRVTVPYGVWFYKGQVGGWVTEYGNL  427


 Score = 68.9 bits (167),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP+AQP RAL LF+SF+ G+RLPN T PSI
Sbjct  428  LTFATVRGASHMVPYAQPARALRLFTSFIHGQRLPNSTHPSI  469



>ref|XP_008786550.1| PREDICTED: serine carboxypeptidase-like 42 [Phoenix dactylifera]
Length=475

 Score = 99.4 bits (246),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVP LGSRTLVRELAHD+ F VT+PYGAWF++ Q GGW+TEYG  
Sbjct  371  IPVWIFSGDQDSVVPFLGSRTLVRELAHDLKFGVTLPYGAWFYKGQAGGWSTEYGNL  427


 Score = 72.0 bits (175),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RAL LF SFV G+RLPN T P IDD
Sbjct  428  LTFATVRGAAHMVPYAQPARALRLFRSFVNGQRLPNTTYPPIDD  471



>ref|XP_009136205.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=466

 Score =   100 bits (250),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVWIFSGDQD+VVPLLGSRTLVRELAH + FK T+PY  WFH+ QVGGW TEYGK 
Sbjct  367  PVWIFSGDQDAVVPLLGSRTLVRELAHHLNFKTTLPYRPWFHKDQVGGWVTEYGKL  422


 Score = 70.5 bits (171),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALH+FSSFV GRRLPN T  S D+
Sbjct  423  LTFATVRGAAHMVPYAQPSRALHMFSSFVHGRRLPNNTHYSPDE  466



>gb|EMS56738.1| Serine carboxypeptidase-like 42 [Triticum urartu]
Length=433

 Score =   102 bits (254),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -2

Query  517  TFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
              PVWIFSGDQDSVVPLLGSRTLVRELAHDMG  VTVPY  WF + QVGGW TEYG  
Sbjct  332  NIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGLPVTVPYSTWFRKGQVGGWTTEYGNL  389


 Score = 68.6 bits (166),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVPFAQP RAL LF SFV G+RLPN T P I D
Sbjct  390  LTFATVRGASHMVPFAQPDRALGLFRSFVLGQRLPNTTYPPIGD  433



>gb|KFK24266.1| hypothetical protein AALP_AAs40498U001000 [Arabis alpina]
Length=480

 Score =   100 bits (249),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  520  TTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            +  PVW+FSGD+DSV+PLLGSRTL+RELA D+ F  TVPYGAWFH+ QVGGWA EYG  
Sbjct  377  SKIPVWVFSGDEDSVIPLLGSRTLIRELADDLNFNTTVPYGAWFHKGQVGGWAIEYGNL  435


 Score = 70.1 bits (170),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT-RPSIDD  214
            LTFATVRGA HMVP+AQP RALHLF+SFV GRRLPN T  P I+D
Sbjct  436  LTFATVRGAAHMVPYAQPSRALHLFTSFVLGRRLPNKTPPPPIED  480



>ref|XP_004977165.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Setaria 
italica]
Length=445

 Score =   104 bits (260),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -2

Query  517  TFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
              PVW+FSGDQDSVVPLLGSRTLVRELAHDMG  VTVPY AWFH  QV GW TEYGK 
Sbjct  345  NIPVWVFSGDQDSVVPLLGSRTLVRELAHDMGLDVTVPYRAWFHNDQVAGWVTEYGKL  402


 Score = 65.5 bits (158),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPS  223
            LTFATVRGA HMVPFAQP RAL LF  FV G+RLPN T PS
Sbjct  403  LTFATVRGAAHMVPFAQPDRALGLFRWFVDGQRLPNTTNPS  443



>ref|XP_004977164.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Setaria 
italica]
Length=476

 Score =   104 bits (260),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -2

Query  517  TFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
              PVW+FSGDQDSVVPLLGSRTLVRELAHDMG  VTVPY AWFH  QV GW TEYGK 
Sbjct  376  NIPVWVFSGDQDSVVPLLGSRTLVRELAHDMGLDVTVPYRAWFHNDQVAGWVTEYGKL  433


 Score = 65.1 bits (157),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPS  223
            LTFATVRGA HMVPFAQP RAL LF  FV G+RLPN T PS
Sbjct  434  LTFATVRGAAHMVPFAQPDRALGLFRWFVDGQRLPNTTNPS  474



>gb|EMT33269.1| Serine carboxypeptidase-like 42 [Aegilops tauschii]
Length=487

 Score =   101 bits (251),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+WIFSGDQDSVVPLLGSRTLVRELAHDMG  VTVPY  WF + QVGGW TEYG  
Sbjct  387  IPLWIFSGDQDSVVPLLGSRTLVRELAHDMGLPVTVPYSTWFRKGQVGGWTTEYGNL  443


 Score = 68.6 bits (166),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVPFAQP RAL LF SFV G+RLPN T P I D
Sbjct  444  LTFATVRGASHMVPFAQPDRALGLFRSFVLGQRLPNTTYPPIGD  487



>gb|EEE51848.1| hypothetical protein OsJ_33355 [Oryza sativa Japonica Group]
Length=474

 Score =   102 bits (254),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHDMG  VTVPY +WF R QVGGW TEYG  
Sbjct  375  IPVWVFSGDQDSVVPLLGSRTLVRELAHDMGLHVTVPYSSWFRRGQVGGWVTEYGNI  431


 Score = 67.4 bits (163),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPFAQP RAL LF SF  GRRLPN T P I+
Sbjct  432  LTFATVRGASHMVPFAQPDRALGLFQSFALGRRLPNTTHPPIN  474



>ref|NP_001067496.1| Os11g0213600 [Oryza sativa Japonica Group]
 gb|ABA92134.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27859.1| Os11g0213600 [Oryza sativa Japonica Group]
Length=465

 Score =   102 bits (254),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHDMG  VTVPY +WF R QVGGW TEYG  
Sbjct  366  IPVWVFSGDQDSVVPLLGSRTLVRELAHDMGLHVTVPYSSWFRRGQVGGWVTEYGNI  422


 Score = 67.4 bits (163),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPFAQP RAL LF SF  GRRLPN T P I+
Sbjct  423  LTFATVRGASHMVPFAQPDRALGLFQSFALGRRLPNTTHPPIN  465



>ref|XP_003577714.1| PREDICTED: serine carboxypeptidase-like 42 [Brachypodium distachyon]
Length=472

 Score =   102 bits (253),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAH MGF VTVPY  WFH+ QVGGW TEYG  
Sbjct  373  IPVWVFSGDQDSVVPLLGSRTLVRELAHTMGFHVTVPYSTWFHKGQVGGWVTEYGNM  429


 Score = 67.8 bits (164),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPFAQP R+L LF SFV G+RLPN T P ID
Sbjct  430  LTFATVRGASHMVPFAQPDRSLGLFRSFVLGQRLPNTTHPPID  472



>ref|XP_004230572.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Solanum 
lycopersicum]
Length=477

 Score =   100 bits (248),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGK  347
            P+WIFSGDQDSVVPL+GSRTLVRELA D+ FK TVPYGAWFH+ QVGGW  EYG+
Sbjct  371  PLWIFSGDQDSVVPLVGSRTLVRELARDLKFKTTVPYGAWFHKGQVGGWQIEYGE  425


 Score = 69.7 bits (169),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVP+AQP RALHLF++FV G+RLPN TR  I+
Sbjct  427  LTFATVRGAAHMVPYAQPSRALHLFTTFVHGKRLPNTTRIPIN  469



>ref|XP_010315077.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Solanum 
lycopersicum]
Length=478

 Score =   100 bits (248),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGK  347
            P+WIFSGDQDSVVPL+GSRTLVRELA D+ FK TVPYGAWFH+ QVGGW  EYG+
Sbjct  372  PLWIFSGDQDSVVPLVGSRTLVRELARDLKFKTTVPYGAWFHKGQVGGWQIEYGE  426


 Score = 69.7 bits (169),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVP+AQP RALHLF++FV G+RLPN TR  I+
Sbjct  428  LTFATVRGAAHMVPYAQPSRALHLFTTFVHGKRLPNTTRIPIN  470



>emb|CDX93108.1| BnaA03g38300D [Brassica napus]
Length=449

 Score = 98.6 bits (244),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVWIFSGDQD+VVPLLGSRTLVRELAH + F  T+PY  WFH+ QVGGW TEYGK 
Sbjct  350  PVWIFSGDQDAVVPLLGSRTLVRELAHHLNFTTTLPYRPWFHKDQVGGWVTEYGKL  405


 Score = 70.5 bits (171),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALH+FSSFV GRRLPN T  S D+
Sbjct  406  LTFATVRGAAHMVPYAQPSRALHMFSSFVHGRRLPNNTHYSPDE  449



>emb|CDX80725.1| BnaC08g05590D [Brassica napus]
Length=476

 Score = 97.4 bits (241),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGD+DSV+PLLGSRTLV+ELA D+ F  TVPYGAWFH+ QVGGW  EYG  
Sbjct  376  IPIWVFSGDEDSVIPLLGSRTLVKELAEDLNFNTTVPYGAWFHKGQVGGWVIEYGDI  432


 Score = 72.0 bits (175),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN + P + D
Sbjct  433  LTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRLPNKSPPPLHD  476



>emb|CDY48945.1| BnaA08g04690D [Brassica napus]
Length=477

 Score = 97.1 bits (240),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGD+DSV+PLLGSRTLV+ELA D+ F  TVPYGAWFH+ QVGGW  EYG  
Sbjct  377  IPIWVFSGDEDSVIPLLGSRTLVKELAEDLNFNTTVPYGAWFHKGQVGGWVIEYGDI  433


 Score = 72.0 bits (175),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN + P + D
Sbjct  434  LTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRLPNKSPPPLHD  477



>ref|XP_004502581.1| PREDICTED: serine carboxypeptidase-like 42-like [Cicer arietinum]
Length=468

 Score = 90.5 bits (223),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWI+SGD DSVVPLLGSRTL RELAHD+ F +T  Y  WFH+ QVGGW TEYG  
Sbjct  369  IPVWIYSGDADSVVPLLGSRTLTRELAHDLKFGITDSYRVWFHKGQVGGWVTEYGNL  425


 Score = 78.6 bits (192),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPFAQP R+LHLFSSFV+G+RLPN T+PSID
Sbjct  426  LTFATVRGAGHMVPFAQPSRSLHLFSSFVQGKRLPNTTKPSID  468



>ref|XP_006351861.1| PREDICTED: serine carboxypeptidase-like 42-like [Solanum tuberosum]
Length=478

 Score =   100 bits (249),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGK  347
            P+WIFSGDQDSVVPL+GSRTLVRELA D+ FK TVPYGAWFH+ QVGGW  EYG+
Sbjct  373  PLWIFSGDQDSVVPLIGSRTLVRELARDLKFKTTVPYGAWFHKGQVGGWQVEYGE  427


 Score = 68.6 bits (166),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVP+AQP RALHLF++FV GRRLPN T   I+
Sbjct  429  LTFATVRGAAHMVPYAQPSRALHLFTTFVHGRRLPNTTHIPIN  471



>gb|ACM17527.1| putative serine carboxy peptidase [Oryza australiensis]
Length=466

 Score = 99.8 bits (247),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAH+MG  VTVPY +WF R QVGGW TEYG  
Sbjct  367  IPVWVFSGDQDSVVPLLGSRTLVRELAHNMGLHVTVPYSSWFCRGQVGGWVTEYGNI  423


 Score = 68.9 bits (167),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPFAQP RAL LF SF  GRRLPN T PSI+
Sbjct  424  LTFATVRGASHMVPFAQPDRALGLFQSFALGRRLPNTTHPSIN  466



>ref|XP_009107652.1| PREDICTED: serine carboxypeptidase-like 44 isoform X3 [Brassica 
rapa]
Length=454

 Score = 96.7 bits (239),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGD+DSV+PLLGSRTLV+ELA D+ F  TVPYGAWFH+ QVGGW  EYG  
Sbjct  354  IPIWVFSGDEDSVIPLLGSRTLVKELAEDLNFHTTVPYGAWFHKGQVGGWVIEYGDI  410


 Score = 72.0 bits (175),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN + P + D
Sbjct  411  LTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRLPNKSPPPLHD  454



>ref|XP_009107650.1| PREDICTED: serine carboxypeptidase-like 44 isoform X2 [Brassica 
rapa]
 ref|XP_009107651.1| PREDICTED: serine carboxypeptidase-like 44 isoform X2 [Brassica 
rapa]
Length=464

 Score = 96.7 bits (239),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGD+DSV+PLLGSRTLV+ELA D+ F  TVPYGAWFH+ QVGGW  EYG  
Sbjct  364  IPIWVFSGDEDSVIPLLGSRTLVKELAEDLNFHTTVPYGAWFHKGQVGGWVIEYGDI  420


 Score = 72.0 bits (175),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN + P + D
Sbjct  421  LTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRLPNKSPPPLHD  464



>ref|XP_009107653.1| PREDICTED: serine carboxypeptidase-like 44 isoform X4 [Brassica 
rapa]
Length=449

 Score = 96.7 bits (239),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGD+DSV+PLLGSRTLV+ELA D+ F  TVPYGAWFH+ QVGGW  EYG  
Sbjct  349  IPIWVFSGDEDSVIPLLGSRTLVKELAEDLNFHTTVPYGAWFHKGQVGGWVIEYGDI  405


 Score = 72.0 bits (175),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN + P + D
Sbjct  406  LTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRLPNKSPPPLHD  449



>ref|XP_009414969.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414970.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414971.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414972.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score = 98.2 bits (243),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHD+ F +TVPY  WF++ QVGGW TEYG  
Sbjct  371  IPVWVFSGDQDSVVPLLGSRTLVRELAHDLKFGITVPYSNWFYKGQVGGWVTEYGNL  427


 Score = 70.1 bits (170),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPFAQP RAL LF+SFV G+RLPN T P ID
Sbjct  428  LTFATVRGASHMVPFAQPGRALRLFASFVHGQRLPNSTYPPID  470



>ref|XP_009107648.1| PREDICTED: serine carboxypeptidase-like 44 isoform X1 [Brassica 
rapa]
 ref|XP_009107649.1| PREDICTED: serine carboxypeptidase-like 44 isoform X1 [Brassica 
rapa]
Length=477

 Score = 96.7 bits (239),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGD+DSV+PLLGSRTLV+ELA D+ F  TVPYGAWFH+ QVGGW  EYG  
Sbjct  377  IPIWVFSGDEDSVIPLLGSRTLVKELAEDLNFHTTVPYGAWFHKGQVGGWVIEYGDI  433


 Score = 72.0 bits (175),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN + P + D
Sbjct  434  LTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRLPNKSPPPLHD  477



>ref|XP_009586680.1| PREDICTED: serine carboxypeptidase-like 42 [Nicotiana tomentosiformis]
Length=470

 Score = 95.9 bits (237),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            P+WIFSGDQDSVVPL+GSRTLVRELA+D+  K TV YGAWFH+ QVGGW  EYG
Sbjct  372  PLWIFSGDQDSVVPLIGSRTLVRELANDLNLKTTVAYGAWFHKGQVGGWQVEYG  425


 Score = 72.4 bits (176),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN TR  I
Sbjct  428  LTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNATRIPI  469



>ref|XP_009107654.1| PREDICTED: serine carboxypeptidase-like 44 isoform X5 [Brassica 
rapa]
Length=396

 Score = 96.7 bits (239),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGD+DSV+PLLGSRTLV+ELA D+ F  TVPYGAWFH+ QVGGW  EYG  
Sbjct  296  IPIWVFSGDEDSVIPLLGSRTLVKELAEDLNFHTTVPYGAWFHKGQVGGWVIEYGDI  352


 Score = 71.6 bits (174),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN + P + D
Sbjct  353  LTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRLPNKSPPPLHD  396



>gb|AAD28662.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=468

 Score =   102 bits (253),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVWIFSGDQDSV+PL  SRTLVRELA D+ FK T+PYGAWFH++QVGGW TEYG  
Sbjct  367  PVWIFSGDQDSVIPLQSSRTLVRELAEDLNFKTTIPYGAWFHKEQVGGWVTEYGNL  422


 Score = 66.2 bits (160),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT--RPSIDD  214
            LTFATVRGA HMVP+A+P RALH+FSSF+ GRRLPN    + S DD
Sbjct  423  LTFATVRGAAHMVPYAEPSRALHMFSSFMNGRRLPNKPDLKSSTDD  468



>ref|XP_002449388.1| hypothetical protein SORBIDRAFT_05g009120 [Sorghum bicolor]
 gb|EES08376.1| hypothetical protein SORBIDRAFT_05g009120 [Sorghum bicolor]
Length=476

 Score =   101 bits (252),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGDQDSVVPLLGSRTLVRELAH+MG +VTVPY  WF R QVGGW T+YG F
Sbjct  377  IPLWVFSGDQDSVVPLLGSRTLVRELAHNMGLQVTVPYSTWFRRGQVGGWVTQYGNF  433


 Score = 66.2 bits (160),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPFAQP RAL LF S V G+RLPN T P I+
Sbjct  434  LTFATVRGASHMVPFAQPDRALRLFQSIVLGQRLPNTTSPPIE  476



>ref|NP_178937.2| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
 sp|Q84W27.1|SCP43_ARATH RecName: Full=Serine carboxypeptidase-like 43; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAO42304.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC06202.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
Length=442

 Score =   101 bits (252),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVWIFSGDQDSV+PL  SRTLVRELA D+ FK T+PYGAWFH++QVGGW TEYG  
Sbjct  341  PVWIFSGDQDSVIPLQSSRTLVRELAEDLNFKTTIPYGAWFHKEQVGGWVTEYGNL  396


 Score = 66.2 bits (160),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT--RPSIDD  214
            LTFATVRGA HMVP+A+P RALH+FSSF+ GRRLPN    + S DD
Sbjct  397  LTFATVRGAAHMVPYAEPSRALHMFSSFMNGRRLPNKPDLKSSTDD  442



>ref|XP_009123167.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=469

 Score = 98.6 bits (244),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVWIFSGDQDS+VP LG+RT +RELAHD+ F  T+PYG WFH+ QVGGW TEYGK 
Sbjct  370  PVWIFSGDQDSIVPFLGTRTNIRELAHDLNFSTTLPYGHWFHKDQVGGWVTEYGKL  425


 Score = 68.9 bits (167),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT  232
            LTFATVRGA HMVP+AQP RALH+FS FVRGRRLPN T
Sbjct  426  LTFATVRGAAHMVPYAQPARALHMFSCFVRGRRLPNNT  463



>emb|CDY70042.1| BnaCnng66490D [Brassica napus]
Length=449

 Score =   100 bits (250),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVWIFSGDQD+VVPLLGSRTLVRELAH + FK T+PY  WFH+ QVGGW TEYGK 
Sbjct  350  PVWIFSGDQDAVVPLLGSRTLVRELAHHLNFKTTLPYRPWFHKNQVGGWVTEYGKL  405


 Score = 66.6 bits (161),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALH+FSSFV GRRL N T  S D+
Sbjct  406  LTFATVRGAAHMVPYAQPSRALHMFSSFVHGRRLHNNTHYSPDE  449



>gb|AFW60600.1| serine carboxypeptidase F13S12.6 [Zea mays]
Length=471

 Score =   100 bits (250),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGDQDSVVPLLG+RTLVRELAH MG  VTVPY  WFH+ QVGGW TEYG F
Sbjct  372  IPLWVFSGDQDSVVPLLGTRTLVRELAHAMGLHVTVPYSTWFHKGQVGGWVTEYGNF  428


 Score = 66.6 bits (161),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPFAQP RAL LF S V G+RLPN T P ID
Sbjct  429  LTFATVRGASHMVPFAQPDRALGLFRSIVLGQRLPNTTNPHID  471



>ref|NP_001151858.1| serine carboxypeptidase F13S12.6 precursor [Zea mays]
 gb|ACG44640.1| serine carboxypeptidase F13S12.6 precursor [Zea mays]
Length=471

 Score =   100 bits (249),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGDQDSVVPLLG+RTLVRELAH MG  VTVPY  WFH+ QVGGW TEYG F
Sbjct  372  IPLWVFSGDQDSVVPLLGTRTLVRELAHAMGLHVTVPYSTWFHKGQVGGWVTEYGNF  428


 Score = 67.0 bits (162),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPFAQP RAL LF S V G+RLPN T P ID
Sbjct  429  LTFATVRGASHMVPFAQPDRALGLFRSIVLGQRLPNTTNPHID  471



>ref|XP_003602149.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES72400.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=465

 Score = 93.2 bits (230),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEY  353
             P+W++SGDQDSVVPLLGSRTL+RELAHDM FK+T  Y  WFH+ Q GGW TEY
Sbjct  365  IPIWVYSGDQDSVVPLLGSRTLIRELAHDMKFKITDSYRVWFHKGQAGGWVTEY  418


 Score = 74.3 bits (181),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP+ QP RALHLFSSFV G+RLPN T+PSI
Sbjct  422  LTFATVRGAGHMVPYGQPSRALHLFSSFVHGKRLPNTTKPSI  463



>ref|XP_010468548.1| PREDICTED: serine carboxypeptidase-like 43 [Camelina sativa]
Length=462

 Score =   100 bits (248),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVWIFSGDQDSV+PL  SRTLVRELA D+ FK TVPYGAWFH++Q+GGW TEYG  
Sbjct  363  PVWIFSGDQDSVIPLQSSRTLVRELAQDLNFKTTVPYGAWFHKEQIGGWFTEYGSL  418


 Score = 67.0 bits (162),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTF TVRGA HMVP+AQP RAL +FSSFV GR+LPN    SIDD
Sbjct  419  LTFVTVRGAAHMVPYAQPSRALLMFSSFVSGRKLPNKPHLSIDD  462



>ref|XP_006307408.1| hypothetical protein CARUB_v10009034mg [Capsella rubella]
 gb|EOA40306.1| hypothetical protein CARUB_v10009034mg [Capsella rubella]
Length=473

 Score = 97.8 bits (242),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  520  TTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            +  PVW+FSGD+DSV+PLLGSRTLV+ELA D+ F  TVPYGAWFH+ QVGGW  EYG  
Sbjct  371  SKVPVWVFSGDEDSVIPLLGSRTLVKELASDLNFNTTVPYGAWFHKGQVGGWVIEYGNL  429


 Score = 69.3 bits (168),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RALHLF+SFV GRRLP+ + P++ D
Sbjct  430  LTFATVRGAAHMVPYAQPSRALHLFTSFVLGRRLPHKSPPALHD  473



>ref|XP_009767155.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nicotiana 
sylvestris]
Length=475

 Score = 94.7 bits (234),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            P+WIFSGDQDSVVPL+GSRTLVRELA+D+  K TV YGAWFH+ QVGGW  EYG
Sbjct  377  PLWIFSGDQDSVVPLIGSRTLVRELANDLKMKTTVAYGAWFHKGQVGGWQIEYG  430


 Score = 72.4 bits (176),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN TR  I
Sbjct  433  LTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTRIPI  474



>ref|XP_009767156.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nicotiana 
sylvestris]
Length=445

 Score = 94.7 bits (234),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            P+WIFSGDQDSVVPL+GSRTLVRELA+D+  K TV YGAWFH+ QVGGW  EYG
Sbjct  347  PLWIFSGDQDSVVPLIGSRTLVRELANDLKMKTTVAYGAWFHKGQVGGWQIEYG  400


 Score = 72.0 bits (175),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP+AQP RALHLFSSFV GRRLPN TR  I
Sbjct  403  LTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTRIPI  444



>emb|CDX81435.1| BnaC09g08460D [Brassica napus]
Length=413

 Score =   100 bits (249),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            VWI SGDQDSVVPLLGSRTLVRELAHD+ F  T+PYG WFH+ QVGGW TEYGK 
Sbjct  316  VWISSGDQDSVVPLLGSRTLVRELAHDLNFSTTLPYGPWFHKNQVGGWVTEYGKI  370


 Score = 66.2 bits (160),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+A P RALH+FSSFVRGRRLPN T  S D+
Sbjct  371  LTFATVRGAAHMVPYA-PSRALHIFSSFVRGRRLPNSTHYSPDE  413



>ref|XP_004979109.1| PREDICTED: serine carboxypeptidase-like 42-like [Setaria italica]
Length=473

 Score = 99.4 bits (246),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGDQDSVVPLLGSRTLVRELAH MG  VTVPY  WF + QVGGW TEYG F
Sbjct  374  IPLWVFSGDQDSVVPLLGSRTLVRELAHTMGLPVTVPYSTWFRKGQVGGWVTEYGNF  430


 Score = 66.6 bits (161),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPFAQP RAL LF S + G+RLPN T P ID
Sbjct  431  LTFATVRGASHMVPFAQPDRALGLFRSIILGQRLPNTTNPPID  473



>emb|CDY51660.1| BnaC03g66990D [Brassica napus]
Length=441

 Score = 98.2 bits (243),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVWIFSGDQDS+VP LG+RT +RELAHD+ F  T+PYG WFH+ QVGGW TEYGK 
Sbjct  342  PVWIFSGDQDSIVPFLGTRTNIRELAHDLNFSTTLPYGHWFHKDQVGGWVTEYGKL  397


 Score = 67.8 bits (164),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT  232
            LTFATVRGA HMVP+AQP RALH+FS FVRGRRLPN T
Sbjct  398  LTFATVRGAAHMVPYAQPARALHMFSFFVRGRRLPNNT  435



>ref|XP_006663298.1| PREDICTED: serine carboxypeptidase-like 42-like [Oryza brachyantha]
Length=486

 Score =   102 bits (253),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPLLGSRTLVRELAH MG +VTVPY +WF R QVGGW TEYG  
Sbjct  387  IPVWIFSGDQDSVVPLLGSRTLVRELAHTMGLQVTVPYSSWFRRGQVGGWVTEYGNM  443


 Score = 63.9 bits (154),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPFAQP RAL LF SF  GRRLPN T   I+
Sbjct  444  LTFATVRGASHMVPFAQPDRALGLFQSFALGRRLPNTTNVPIN  486



>gb|KEH35413.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=477

 Score = 91.7 bits (226),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW++SGDQDS+VPLLGSR  +RELAHD+ F +T  Y  WFHR QVGGW TEYG  
Sbjct  372  IPVWVYSGDQDSIVPLLGSRRHIRELAHDLNFNITDSYRVWFHRDQVGGWVTEYGNL  428


 Score = 74.3 bits (181),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA H+VP+AQP +ALHLFSSFVRGRRLP  TRP I D
Sbjct  429  LTFATVRGAGHIVPYAQPSKALHLFSSFVRGRRLPKTTRPKIID  472



>ref|XP_006299245.1| hypothetical protein CARUB_v10015394mg [Capsella rubella]
 gb|EOA32143.1| hypothetical protein CARUB_v10015394mg [Capsella rubella]
Length=459

 Score =   100 bits (249),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVWIFSGDQDSV+PL  SRTLVRELAHD+ FK TVPY AWF+++QVGGW TEYG  
Sbjct  358  PVWIFSGDQDSVIPLQSSRTLVRELAHDLNFKTTVPYAAWFYKEQVGGWVTEYGNI  413


 Score = 65.5 bits (158),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT--RPSIDD  214
            LTFATVRGA HMV +AQP R LH+FSSFVRG+RLPN      SIDD
Sbjct  414  LTFATVRGAAHMVSYAQPSRGLHMFSSFVRGQRLPNKPHLNSSIDD  459



>ref|XP_002885858.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62117.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=451

 Score = 99.8 bits (247),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVWIFSGDQDSV+PL  SRT VRELA D+ FK TVPYGAWFH++QVGGW TEYG  
Sbjct  350  PVWIFSGDQDSVIPLQSSRTRVRELAQDLNFKTTVPYGAWFHKEQVGGWVTEYGNL  405


 Score = 65.1 bits (157),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT--RPSIDD  214
            LTFATVRGA HMV +A+P RALH+FS+FV GRRLPN    + SIDD
Sbjct  406  LTFATVRGAAHMVAYAEPSRALHMFSTFVTGRRLPNKPDLKSSIDD  451



>emb|CDY23340.1| BnaA08g12060D [Brassica napus]
Length=469

 Score = 98.6 bits (244),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVWIFSGDQDS+VP LG+RT +RELAHD+ F  T+PYG WFH+ QVGGW TEYGK 
Sbjct  370  PVWIFSGDQDSIVPFLGTRTNIRELAHDLNFSTTLPYGHWFHKDQVGGWVTEYGKL  425


 Score = 65.9 bits (159),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT  232
            LTFATVRGA H VP+AQP RALH+FS FVRGRRLPN T
Sbjct  426  LTFATVRGAAHRVPYAQPARALHMFSCFVRGRRLPNNT  463



>gb|ACR37620.1| unknown [Zea mays]
Length=321

 Score = 98.6 bits (244),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGDQDSVVPLLGSR+LVRELAH MG  VTVPY  WF + QVGGW TEYG F
Sbjct  222  IPLWVFSGDQDSVVPLLGSRSLVRELAHTMGLHVTVPYSTWFRKGQVGGWVTEYGNF  278


 Score = 65.5 bits (158),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVPFAQP RAL LF S V GRRLPN T P I
Sbjct  279  LTFATVRGASHMVPFAQPDRALGLFRSIVLGRRLPNATSPPI  320



>ref|NP_001183841.1| hypothetical protein precursor [Zea mays]
 gb|ACR38507.1| unknown [Zea mays]
 tpg|DAA38901.1| TPA: hypothetical protein ZEAMMB73_424549 [Zea mays]
Length=473

 Score = 98.2 bits (243),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGDQDSVVPLLGSR+LVRELAH MG  VTVPY  WF + QVGGW TEYG F
Sbjct  374  IPLWVFSGDQDSVVPLLGSRSLVRELAHTMGLHVTVPYSTWFRKGQVGGWVTEYGNF  430


 Score = 65.9 bits (159),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVPFAQP RAL LF S V GRRLPN T P I
Sbjct  431  LTFATVRGASHMVPFAQPDRALGLFRSIVLGRRLPNATSPPI  472



>ref|NP_001031351.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
 gb|AEC06203.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
Length=443

 Score = 97.1 bits (240),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQ-VGGWATEYGKF  344
            PVWIFSGDQDSV+PL  SRTLVRELA D+ FK T+PYGAWFH++Q VGGW TEYG  
Sbjct  341  PVWIFSGDQDSVIPLQSSRTLVRELAEDLNFKTTIPYGAWFHKEQVVGGWVTEYGNL  397


 Score = 66.2 bits (160),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT--RPSIDD  214
            LTFATVRGA HMVP+A+P RALH+FSSF+ GRRLPN    + S DD
Sbjct  398  LTFATVRGAAHMVPYAEPSRALHMFSSFMNGRRLPNKPDLKSSTDD  443



>gb|ACR37535.1| unknown [Zea mays]
Length=178

 Score = 98.2 bits (243),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+W+FSGDQDSVVPLLGSR+LVRELAH MG  VTVPY  WF + QVGGW TEYG F
Sbjct  79   IPLWVFSGDQDSVVPLLGSRSLVRELAHTMGLHVTVPYSTWFRKGQVGGWVTEYGNF  135


 Score = 64.7 bits (156),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVPFAQP RAL LF S V GRRLPN T P I
Sbjct  136  LTFATVRGASHMVPFAQPDRALGLFRSIVLGRRLPNATSPPI  177



>ref|XP_006279617.1| hypothetical protein CARUB_v10026338mg [Capsella rubella]
 gb|EOA12515.1| hypothetical protein CARUB_v10026338mg [Capsella rubella]
Length=472

 Score = 95.9 bits (237),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            PVWIFSGDQDSV+P  GSR+L+RELA D+ F++TVPY  WFH++QVGGWA EYG  
Sbjct  373  PVWIFSGDQDSVIPFTGSRSLIRELAQDLNFEITVPYRIWFHKRQVGGWAIEYGNL  428


 Score = 67.0 bits (162),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP+AQP RAL LFSSFV G RLPN    S DD
Sbjct  429  LTFATVRGAAHMVPYAQPARALQLFSSFVSGGRLPNKPHSSTDD  472



>ref|XP_006393769.1| hypothetical protein EUTSA_v10011445mg [Eutrema salsugineum]
 gb|ESQ31055.1| hypothetical protein EUTSA_v10011445mg [Eutrema salsugineum]
Length=479

 Score = 94.7 bits (234),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  520  TTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            +  PVW+FSGD+DSV+PLLGSRTLVR LA ++ F  TVPYGAWFH+ QVGGW  EYG  
Sbjct  377  SKIPVWVFSGDEDSVIPLLGSRTLVRGLAEELNFNTTVPYGAWFHKGQVGGWVIEYGNL  435


 Score = 67.4 bits (163),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMV +AQP RALHLF+SFV GRRLPN + P + D
Sbjct  436  LTFATVRGAAHMVSYAQPSRALHLFTSFVLGRRLPNKSPPPLHD  479



>ref|NP_175046.1| serine carboxypeptidase-like 44 [Arabidopsis thaliana]
 sp|Q9MAR8.1|SCP44_ARATH RecName: Full=Serine carboxypeptidase-like 44; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF63101.1|AC006423_2 Putative serine carboxypeptidases [Arabidopsis thaliana]
 gb|AEE31996.1| serine carboxypeptidase-like 44 [Arabidopsis thaliana]
Length=479

 Score = 94.7 bits (234),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  520  TTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            +  PVW+FSGD+DSV+PLLGSRTLV+ELA D+ F  TVPYGAWF + QVGGW  EYG  
Sbjct  377  SKVPVWVFSGDEDSVIPLLGSRTLVKELADDLNFNTTVPYGAWFDKGQVGGWVVEYGNL  435


 Score = 67.0 bits (162),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA HMVP++QP RALHLF+SFV GR+LP+ + P++ D
Sbjct  436  LTFATVRGAAHMVPYSQPSRALHLFTSFVLGRKLPHKSPPALHD  479



>ref|XP_002863806.1| hypothetical protein ARALYDRAFT_331179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40065.1| hypothetical protein ARALYDRAFT_331179 [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score = 99.0 bits (245),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  520  TTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
               PVWIFSGDQDSVVP LG+RT+V+ELA D+ FK TVPYG WFH++QVGGWA EYG  
Sbjct  370  NKIPVWIFSGDQDSVVPFLGTRTVVQELADDLNFKTTVPYGVWFHKRQVGGWAIEYGNL  428


 Score = 62.4 bits (150),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT  232
            LTFATVRGA H+V + QP RALHLFS+FVRG+RLPN T
Sbjct  429  LTFATVRGAAHVVAYKQPSRALHLFSAFVRGQRLPNKT  466



>ref|XP_010463193.1| PREDICTED: serine carboxypeptidase-like 44 [Camelina sativa]
Length=422

 Score = 93.6 bits (231),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  520  TTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            +  PVW+FSGD+DSV+PLLGSRTLVRELA D+    TVPY AWFH+ QVGGW  EYG  
Sbjct  320  SKVPVWVFSGDEDSVIPLLGSRTLVRELADDLYLNTTVPYAAWFHKGQVGGWVIEYGNL  378


 Score = 67.8 bits (164),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP+AQP RALHLF+SFV GRRLP+ + P++
Sbjct  379  LTFATVRGAAHMVPYAQPSRALHLFTSFVLGRRLPHKSPPAL  420



>ref|XP_010479023.1| PREDICTED: serine carboxypeptidase-like 44 [Camelina sativa]
Length=479

 Score = 93.6 bits (231),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  520  TTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            +  PVW+FSGD+DSV+PLLGSRTLVRELA D+    TVPY AWFH+ QVGGW  EYG  
Sbjct  377  SKVPVWVFSGDEDSVIPLLGSRTLVRELADDLYLNTTVPYAAWFHKGQVGGWVIEYGNL  435


 Score = 67.4 bits (163),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP+AQP RALHLF+SFV GRRLP+ + P++
Sbjct  436  LTFATVRGAAHMVPYAQPSRALHLFTSFVLGRRLPHKSPPAL  477



>gb|EMS54298.1| Serine carboxypeptidase-like 42 [Triticum urartu]
Length=402

 Score = 96.3 bits (238),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLL +RTLVRELAH MG  VTVPY +WF + QVGGWATEYG  
Sbjct  303  IPVWVFSGDQDSVVPLLRTRTLVRELAHAMGLPVTVPYSSWFRKGQVGGWATEYGNM  359


 Score = 63.9 bits (154),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMVPF+QP RAL LF SFV G+RLPN T   ID
Sbjct  360  LTFATVRGASHMVPFSQPDRALGLFRSFVLGQRLPNTTHRPID  402



>ref|XP_010493597.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010493598.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010493599.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=462

 Score =   105 bits (263),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVP LGSRTLVRELA D+ F+ TVPYGAWFH++QVGGWA EYGK 
Sbjct  369  IPVWIFSGDQDSVVPFLGSRTLVRELAQDLNFETTVPYGAWFHKRQVGGWAIEYGKL  425


 Score = 54.3 bits (129),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVR  256
            LTFATVRGA HMVP+AQP RALHLFSSF +
Sbjct  426  LTFATVRGAAHMVPYAQPSRALHLFSSFAQ  455



>ref|XP_002891272.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67531.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=479

 Score = 92.8 bits (229),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            VW+FSGDQDSV+PLLGSRTLV+ELA D+ F  TVPYGAWF + QVGGW  EYG  
Sbjct  381  VWVFSGDQDSVIPLLGSRTLVKELADDLNFNTTVPYGAWFDKGQVGGWVIEYGNL  435


 Score = 67.0 bits (162),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            +TFATVRGA HMVP++QP RALHLF+SFV GRRLP+ + P++ D
Sbjct  436  VTFATVRGAAHMVPYSQPSRALHLFTSFVLGRRLPHKSPPALHD  479



>ref|XP_004515138.1| PREDICTED: serine carboxypeptidase-like 42-like [Cicer arietinum]
Length=470

 Score = 87.0 bits (214),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             P+ I+SGDQDSVVPL+GSR+LVR+LA D+ F +T PY  WFH+ Q GGW TEYG  
Sbjct  370  IPILIYSGDQDSVVPLIGSRSLVRQLARDLKFNITDPYRVWFHKGQAGGWVTEYGNL  426


 Score = 72.0 bits (175),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSI  220
            LTFATVRGA HMVP+AQP RALHLFSSFV G+RLPN TR S+
Sbjct  427  LTFATVRGAGHMVPYAQPSRALHLFSSFVGGKRLPNTTRLSV  468



>ref|XP_002865553.1| hypothetical protein ARALYDRAFT_494807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41812.1| hypothetical protein ARALYDRAFT_494807 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   102 bits (253),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVP LG+RT+VRELA+D+ FK TVPYG WFH++QVGGWA EYG  
Sbjct  373  IPVWIFSGDQDSVVPFLGTRTVVRELANDLNFKTTVPYGVWFHKRQVGGWAIEYGNI  429


 Score = 57.0 bits (136),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA H V   QP +ALHLFS+F+RG RLPN T  ++ D
Sbjct  430  LTFATVRGAAHAVANTQPSQALHLFSTFLRGHRLPNKTDIAMHD  473



>ref|XP_002862434.1| hypothetical protein ARALYDRAFT_497456 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38692.1| hypothetical protein ARALYDRAFT_497456 [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score =   100 bits (249),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVP LG+RT+VRELA+D+ FK TVPYG WFH++QVGGWA +YG  
Sbjct  352  IPVWIFSGDQDSVVPFLGTRTVVRELANDLNFKTTVPYGVWFHKRQVGGWAIDYGNI  408


 Score = 58.2 bits (139),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA H V   QP RALHLFS+F+RG RLPN T  ++ D
Sbjct  409  LTFATVRGAAHAVANTQPSRALHLFSTFLRGHRLPNKTDIAMHD  452



>ref|NP_199038.1| serine carboxypeptidase-like 41 [Arabidopsis thaliana]
 sp|Q9FH06.1|SCP41_ARATH RecName: Full=Serine carboxypeptidase-like 41; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB10196.1| serine carboxypeptidase-II like [Arabidopsis thaliana]
 gb|AAO22761.1| putative serine carboxypeptidase-II [Arabidopsis thaliana]
 gb|AAO42380.1| putative serine carboxypeptidase-II [Arabidopsis thaliana]
 gb|AED94783.1| serine carboxypeptidase-like 41 [Arabidopsis thaliana]
Length=469

 Score = 95.1 bits (235),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV IFSGDQDSVVP LG+RT+V ELA+D+ FK TVPYG WFH++QVGGWA EYG  
Sbjct  369  IPVRIFSGDQDSVVPFLGTRTIVGELANDLNFKTTVPYGVWFHKRQVGGWAIEYGNL  425


 Score = 61.6 bits (148),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTFATVRGA H V + QP RALHLFS+F+RG+RLPN T  ++ D
Sbjct  426  LTFATVRGAAHAVAYTQPSRALHLFSTFLRGQRLPNKTDIAMHD  469



>ref|XP_010239229.1| PREDICTED: serine carboxypeptidase-like 42 [Brachypodium distachyon]
Length=380

 Score = 95.9 bits (237),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FS DQDSVVPLLGSRTLVRELAH MGF  TVPY  WFH+ QVGGW T YG  
Sbjct  280  IPVWVFSDDQDSVVPLLGSRTLVRELAHTMGFHCTVPYSTWFHKGQVGGWVTVYGNM  336


 Score = 59.3 bits (142),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRR-LPNMTRPSID  217
            LTFATVRGA HMVPFAQP RAL LF SFV G+  +PN T P I+
Sbjct  337  LTFATVRGASHMVPFAQPDRALGLFRSFVLGQTIIPNTTHPPIN  380



>gb|ABK25236.1| unknown [Picea sitchensis]
Length=469

 Score = 82.8 bits (203),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            VWIFSGDQDSVVPL+GSRT VR LA+D+   V VPY AW+H  QV GW T YG  
Sbjct  377  VWIFSGDQDSVVPLMGSRTNVRNLANDLKMSVKVPYRAWYHEGQVAGWTTVYGDL  431


 Score = 58.9 bits (141),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            LTFATVRGA HMVP++QP RALHLF +F+ G+ LP+
Sbjct  432  LTFATVRGASHMVPYSQPARALHLFRTFLSGKDLPD  467



>ref|XP_010530237.1| PREDICTED: serine carboxypeptidase-like 42 [Tarenaya hassleriana]
Length=474

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            VWIFSGDQDSVVPLLGSRTLVRELAH++GFK+TVPYGAWFHR QVGGWATEYG  
Sbjct  376  VWIFSGDQDSVVPLLGSRTLVRELAHELGFKITVPYGAWFHRGQVGGWATEYGNI  430


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 59/101 (58%), Gaps = 11/101 (11%)
 Frame = -3

Query  486  KIRLCHCSGREHLSVNLLTTWGSRLQSLMELGFT-----GNRWEAGQ------QSMGSLT  340
            KIR+   SG +   V LL +     +   ELGF      G  +  GQ      +    LT
Sbjct  373  KIRVWIFSGDQDSVVPLLGSRTLVRELAHELGFKITVPYGAWFHRGQVGGWATEYGNILT  432

Query  339  FATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            FATVRGA HMVP+AQP RALHLFS+FV GRRLPN TR S+D
Sbjct  433  FATVRGAAHMVPYAQPSRALHLFSNFVSGRRLPNTTRHSVD  473



>ref|XP_007019399.1| Serine carboxypeptidase-like 42 isoform 3, partial [Theobroma 
cacao]
 gb|EOY16624.1| Serine carboxypeptidase-like 42 isoform 3, partial [Theobroma 
cacao]
Length=439

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVW+FSGDQDSVVPLLGSRTLVRELAHD+ FK+TVPYGAWFH+ QVGGW TEYG  
Sbjct  373  IPVWVFSGDQDSVVPLLGSRTLVRELAHDLNFKITVPYGAWFHKHQVGGWVTEYGNL  429



>ref|XP_010681521.1| PREDICTED: serine carboxypeptidase-like 42 [Beta vulgaris subsp. 
vulgaris]
Length=354

 Score = 70.1 bits (170),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  466  LGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            LGSRT++ ELA D+  KVTVPYGAWFH++QVGGW+ EYG  
Sbjct  270  LGSRTMIHELARDLNLKVTVPYGAWFHKEQVGGWSIEYGNL  310


 Score = 65.9 bits (159),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            LTFATVRGA HMV ++QP RALHLFS FVRG+RLPN TR   D
Sbjct  311  LTFATVRGAAHMVLYSQPARALHLFSYFVRGQRLPNATRLPTD  353



>emb|CAN74668.1| hypothetical protein VITISV_005686 [Vitis vinifera]
Length=480

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PVWIFSGDQDSVVPL+GSRTLVRELA D+ F+ TVPYGAWFH+ QVGGW TEYG  
Sbjct  349  IPVWIFSGDQDSVVPLMGSRTLVRELAKDLNFQHTVPYGAWFHKGQVGGWQTEYGNL  405



>gb|KGN47484.1| hypothetical protein Csa_6G338160 [Cucumis sativus]
Length=806

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGK  347
             P+WI+SGD+DSVVPLLGSRTLVRELAHD+  KVTVPYGAWFH+ QVGGWA EYG 
Sbjct  374  IPLWIYSGDEDSVVPLLGSRTLVRELAHDLKLKVTVPYGAWFHKGQVGGWAIEYGN  429



>ref|XP_007139316.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
 gb|ESW11310.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
Length=461

 Score = 80.1 bits (196),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             PV ++SGDQDSV+PL GSRTLV +LA  +G K TVPY  WF ++QVGGW   YG
Sbjct  367  IPVLVYSGDQDSVIPLTGSRTLVHKLAKKLGLKTTVPYRVWFEKQQVGGWTQVYG  421


 Score = 49.3 bits (116),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  PF+QP RAL LF SF+ GR +P
Sbjct  424  LSFATIRGASHEAPFSQPERALVLFKSFLEGRPMP  458



>ref|XP_007038110.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOY22611.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score = 80.1 bits (196),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLVR LA ++G + TVPY  WF  KQVGGW   YG  
Sbjct  369  IPVLVYSGDQDSVIPLTGSRTLVRGLAKELGLETTVPYRVWFEGKQVGGWTQVYGNI  425


 Score = 48.1 bits (113),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNM  235
            L FAT+RGA H  PF+QP R+L LF SF+ G+ LP +
Sbjct  426  LAFATIRGASHEAPFSQPERSLMLFKSFLEGKPLPEV  462



>ref|XP_002449560.1| hypothetical protein SORBIDRAFT_05g019090 [Sorghum bicolor]
 gb|EES08548.1| hypothetical protein SORBIDRAFT_05g019090 [Sorghum bicolor]
Length=490

 Score = 80.5 bits (197),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            V ++SGDQDSV+PL GSRTLV+ LAHDMG K T PY  WF  +QVGGW   YG
Sbjct  396  VLVYSGDQDSVIPLTGSRTLVQNLAHDMGLKTTTPYRVWFEGQQVGGWTQVYG  448


 Score = 48.1 bits (113),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            G+L+FAT+RGA H  PF+QP R+L LF +F++G+ LP 
Sbjct  450  GALSFATIRGASHEAPFSQPGRSLVLFRAFLQGQPLPE  487



>ref|XP_006858474.1| hypothetical protein AMTR_s00071p00113850 [Amborella trichopoda]
 gb|ERN19941.1| hypothetical protein AMTR_s00071p00113850 [Amborella trichopoda]
Length=474

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            P+W+FSGDQDSVVPL+GSRTLVREL+ DM F++TVPYGAWF++ QVGGWA EYG  
Sbjct  376  PIWVFSGDQDSVVPLMGSRTLVRELSDDMNFEITVPYGAWFYKGQVGGWAAEYGNM  431


 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = -3

Query  375  WEAGQQSMGSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSID  217
            W A   +M  LTFATVRGA HMVP+AQP RAL LF +FV G+RLPN+T PSI+
Sbjct  424  WAAEYGNM--LTFATVRGAAHMVPYAQPARALKLFHTFVSGQRLPNITHPSIE  474



>ref|XP_004298533.1| PREDICTED: serine carboxypeptidase-like 45 [Fragaria vesca subsp. 
vesca]
Length=466

 Score = 78.6 bits (192),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLV  LA ++G   TVPY  WF  KQVGGW   YG  
Sbjct  372  IPVLVYSGDQDSVIPLTGSRTLVDRLARELGLNTTVPYRVWFQGKQVGGWTQVYGNI  428


 Score = 49.3 bits (116),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNM  235
            L+FAT+RGA H  PF+QP R+L LF SF++GR LP +
Sbjct  429  LSFATIRGASHEAPFSQPERSLVLFKSFLQGRPLPQV  465



>ref|XP_008239549.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=467

 Score = 77.8 bits (190),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLV  LA ++G   TVPY  WF  KQVGGW   YG  
Sbjct  373  IPVLVYSGDQDSVIPLTGSRTLVYRLARELGLNTTVPYRVWFEGKQVGGWTQVYGNI  429


 Score = 50.1 bits (118),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNM  235
            L+FAT+RGA H  PF+QP R+L LF SF+ GR LP +
Sbjct  430  LSFATIRGASHEAPFSQPERSLRLFKSFLEGRPLPEV  466



>ref|XP_010929656.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score = 78.6 bits (192),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             PV ++SGDQDSV+PL GSRTLV+ LA ++  K TVPY  WF  KQVGGW   YG
Sbjct  369  IPVLVYSGDQDSVIPLTGSRTLVQRLAKELKLKTTVPYRVWFEDKQVGGWTQVYG  423


 Score = 48.9 bits (115),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            LTFAT+RGA H  PF+QP R+L LF +F++GR LP 
Sbjct  426  LTFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPE  461



>ref|XP_004492026.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=462

 Score = 77.4 bits (189),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLV +LA ++    TVPY  WF ++QVGGW   YG  
Sbjct  368  IPVLVYSGDQDSVIPLTGSRTLVHQLAKELRMNTTVPYRVWFQKQQVGGWTQVYGNI  424


 Score = 48.9 bits (115),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FATVRGA H  PF+QP R+L LF SF+ GR LP
Sbjct  425  LSFATVRGASHEAPFSQPERSLVLFKSFLEGRPLP  459



>gb|AIC80774.1| serine carboxypeptidase [Cicer arietinum]
Length=430

 Score = 77.0 bits (188),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLV +LA ++    TVPY  WF ++QVGGW   YG  
Sbjct  336  IPVLVYSGDQDSVIPLTGSRTLVHQLAKELRMNTTVPYRVWFQKQQVGGWTQVYGNI  392


 Score = 48.9 bits (115),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FATVRGA H  PF+QP R+L LF SF+ GR LP
Sbjct  393  LSFATVRGASHEAPFSQPERSLVLFKSFLEGRPLP  427



>gb|EPS74304.1| hypothetical protein M569_00447, partial [Genlisea aurea]
Length=308

 Score = 72.8 bits (177),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDSV+PLL +R  + ELA  +G   T+ YGAWF+ KQV GW   YG F
Sbjct  212  VLVYSGDQDSVIPLLATRRNINELAKQLGLNATLSYGAWFYAKQVAGWTQSYGDF  266


 Score = 52.8 bits (125),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = -3

Query  360  QSMGS-LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT  232
            QS G  L++AT+RGA H  PF+QP R+  LFSSFV G++LP + 
Sbjct  261  QSYGDFLSYATIRGASHEAPFSQPERSYALFSSFVEGKQLPQLD  304



>ref|XP_004501743.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=470

 Score = 73.2 bits (178),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V I+SGDQDSV+PL GSRTLV++LA  +G   TV Y  WF  +QVGGW   YG  
Sbjct  378  VLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVSYRVWFESQQVGGWTQVYGNM  432


 Score = 52.0 bits (123),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNM  235
            L+FATVRGA H VPF+QP R+L LF SF+ GR LP +
Sbjct  433  LSFATVRGAAHEVPFSQPERSLVLFKSFLEGRPLPEV  469



>ref|XP_003551804.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score = 79.3 bits (194),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLV +LA ++G   TVPY  WF ++QVGGW   YG  
Sbjct  367  IPVLVYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI  423


 Score = 45.4 bits (106),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  PF+QP R+L LF SF+ G  LP
Sbjct  424  LSFATIRGASHEAPFSQPERSLVLFKSFLEGGPLP  458



>gb|KHN13827.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score = 79.3 bits (194),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLV +LA ++G   TVPY  WF ++QVGGW   YG  
Sbjct  360  IPVLVYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI  416


 Score = 45.4 bits (106),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  PF+QP R+L LF SF+ G  LP
Sbjct  417  LSFATIRGASHEAPFSQPERSLVLFKSFLEGGPLP  451



>emb|CDY66771.1| BnaC02g44710D [Brassica napus]
Length=115

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  496  SGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            SGDQDSVVPLLGSRTLVRELAHD+ F  T+PYG WFH+ QVGGW TEYG+ 
Sbjct  14   SGDQDSVVPLLGSRTLVRELAHDLNFSTTLPYGPWFHKDQVGGWVTEYGEL  64


 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 51/91 (56%), Gaps = 11/91 (12%)
 Frame = -3

Query  471  HCSGREHLSVNLLTTWGSRLQSLMELGFTGN----RWEAGQQSMG-------SLTFATVR  325
            HCSG +   V LL +     +   +L F+       W    Q  G        LTFATVR
Sbjct  12   HCSGDQDSVVPLLGSRTLVRELAHDLNFSTTLPYGPWFHKDQVGGWVTEYGELLTFATVR  71

Query  324  GAFHMVPFAQPFRALHLFSSFVRGRRLPNMT  232
            GA HMVP+AQP RALHLFS FVRGRRLPN T
Sbjct  72   GAAHMVPYAQPSRALHLFSGFVRGRRLPNNT  102



>ref|XP_003531913.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score = 79.3 bits (194),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLV +LA ++G   TVPY  WF ++QVGGW   YG  
Sbjct  367  IPVLVYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI  423


 Score = 45.4 bits (106),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  PF+QP R+L LF SF+ G  LP
Sbjct  424  LSFATIRGASHEAPFSQPERSLVLFKSFLEGGPLP  458



>ref|XP_002280796.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CAN81275.1| hypothetical protein VITISV_021177 [Vitis vinifera]
 emb|CBI15743.3| unnamed protein product [Vitis vinifera]
Length=462

 Score = 78.2 bits (191),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLV  LA ++G   TVPY  WF  KQVGGW   YG  
Sbjct  368  IPVLVYSGDQDSVIPLTGSRTLVHNLAKELGLNTTVPYRVWFEGKQVGGWTRVYGNI  424


 Score = 46.6 bits (109),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  PF+QP R+L LF SF+  R LP
Sbjct  425  LSFATIRGASHEAPFSQPERSLVLFKSFLEARPLP  459



>ref|XP_002511104.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF51706.1| serine carboxypeptidase, putative [Ricinus communis]
Length=460

 Score = 75.5 bits (184),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLV  LA ++G   TVPY  WF  KQVGGW   Y   
Sbjct  366  IPVLVYSGDQDSVIPLTGSRTLVHGLAKELGLNTTVPYRVWFAEKQVGGWTQVYSDI  422


 Score = 49.3 bits (116),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H VP++QP R+L LF SF+ G+ LP
Sbjct  423  LSFATIRGAAHEVPYSQPERSLVLFKSFLEGKHLP  457



>gb|KHN47533.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score = 79.3 bits (194),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLV +LA ++G   TVPY  WF ++QVGGW   YG  
Sbjct  360  IPVLVYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI  416


 Score = 45.4 bits (106),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  PF+QP R+L LF SF+ G  LP
Sbjct  417  LSFATIRGASHEAPFSQPERSLVLFKSFLEGGPLP  451



>ref|XP_006585840.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X2 [Glycine 
max]
Length=429

 Score = 79.0 bits (193),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLV +LA ++G   TVPY  WF ++QVGGW   YG  
Sbjct  335  IPVLVYSGDQDSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI  391


 Score = 45.1 bits (105),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  PF+QP R+L LF SF+ G  LP
Sbjct  392  LSFATIRGASHEAPFSQPERSLVLFKSFLEGGPLP  426



>emb|CBI32794.3| unnamed protein product [Vitis vinifera]
Length=453

 Score = 74.3 bits (181),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            V ++SGDQDSVVPL G+RTLV  LA D+G   TVPY  WF  +QVGGW   YG
Sbjct  358  VLVYSGDQDSVVPLTGTRTLVNGLAKDLGLNTTVPYRNWFQGRQVGGWTQVYG  410


 Score = 49.3 bits (116),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT  232
            L+FAT+RGA H  PF+QP R+L LF++F++G+ LP  T
Sbjct  413  LSFATIRGASHEAPFSQPERSLVLFNTFLQGKPLPEAT  450



>ref|XP_010682654.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=473

 Score = 75.1 bits (183),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV I+SGDQDSVVPL GSRTLV+ LA ++    TVPY  WF  KQVGGW   +G  
Sbjct  379  IPVLIYSGDQDSVVPLTGSRTLVKRLAEELKLNTTVPYRVWFVGKQVGGWTEVHGDL  435


 Score = 48.5 bits (114),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNM  235
            L+FATVRGA H  PF+QP R+L LF SF+ G+ LP +
Sbjct  436  LSFATVRGASHEAPFSQPERSLVLFKSFLEGKPLPEV  472



>ref|XP_010653629.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=461

 Score = 74.3 bits (181),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            V ++SGDQDSVVPL G+RTLV  LA D+G   TVPY  WF  +QVGGW   YG
Sbjct  366  VLVYSGDQDSVVPLTGTRTLVNGLAKDLGLNTTVPYRNWFQGRQVGGWTQVYG  418


 Score = 49.3 bits (116),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT  232
            L+FAT+RGA H  PF+QP R+L LF++F++G+ LP  T
Sbjct  421  LSFATIRGASHEAPFSQPERSLVLFNTFLQGKPLPEAT  458



>ref|XP_003520486.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score = 76.6 bits (187),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  523  GTTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             +   V ++SGDQDSV+PLLGSR+LV  LA ++G   TV Y AWF RKQV GW   YG+ 
Sbjct  364  NSNIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVAYRAWFERKQVAGWTQVYGEL  423


 Score = 46.6 bits (109),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNM  235
            L++AT+RGA H  PF QP R+L L  +F+ G+ LPN+
Sbjct  424  LSYATIRGASHEAPFTQPQRSLVLLKAFLEGKPLPNV  460



>ref|XP_010271865.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nelumbo 
nucifera]
Length=520

 Score = 74.3 bits (181),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            + ++SGDQDS++PL G+RTLV  LA+++G   TVPY  WF  KQVGGW   YG
Sbjct  428  ILVYSGDQDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYG  480


 Score = 48.9 bits (115),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            LTFAT+RG  H  PF+QP R+L LF+SF++G+ LP
Sbjct  483  LTFATIRGGSHEAPFSQPQRSLVLFNSFLKGKPLP  517



>ref|XP_010271866.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nelumbo 
nucifera]
Length=519

 Score = 74.3 bits (181),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            + ++SGDQDS++PL G+RTLV  LA+++G   TVPY  WF  KQVGGW   YG
Sbjct  427  ILVYSGDQDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYG  479


 Score = 48.9 bits (115),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            LTFAT+RG  H  PF+QP R+L LF+SF++G+ LP
Sbjct  482  LTFATIRGGSHEAPFSQPQRSLVLFNSFLKGKPLP  516



>tpg|DAA42024.1| TPA: hypothetical protein ZEAMMB73_711830 [Zea mays]
Length=276

 Score = 75.1 bits (183),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            V ++SGDQDSV+PL GSRTLV+ LA  MG K T PY  WF  +QVGGW   YG
Sbjct  182  VLVYSGDQDSVIPLTGSRTLVQSLARGMGLKTTTPYRVWFEGQQVGGWTQVYG  234


 Score = 48.1 bits (113),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            G+L+FATVRGA H  PF+QP R+L LF +F++G+ LP 
Sbjct  236  GALSFATVRGASHEAPFSQPGRSLVLFRAFLQGQPLPE  273



>ref|XP_010271868.1| PREDICTED: serine carboxypeptidase-like 45 isoform X4 [Nelumbo 
nucifera]
Length=503

 Score = 74.3 bits (181),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            + ++SGDQDS++PL G+RTLV  LA+++G   TVPY  WF  KQVGGW   YG  
Sbjct  411  ILVYSGDQDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI  465


 Score = 48.9 bits (115),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            LTFAT+RG  H  PF+QP R+L LF+SF++G+ LP
Sbjct  466  LTFATIRGGSHEAPFSQPQRSLVLFNSFLKGKPLP  500



>ref|XP_010271867.1| PREDICTED: serine carboxypeptidase-like 45 isoform X3 [Nelumbo 
nucifera]
Length=504

 Score = 74.3 bits (181),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            + ++SGDQDS++PL G+RTLV  LA+++G   TVPY  WF  KQVGGW   YG  
Sbjct  412  ILVYSGDQDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI  466


 Score = 48.9 bits (115),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            LTFAT+RG  H  PF+QP R+L LF+SF++G+ LP
Sbjct  467  LTFATIRGGSHEAPFSQPQRSLVLFNSFLKGKPLP  501



>ref|XP_008670742.1| PREDICTED: serine carboxypeptidase-like 45 [Zea mays]
 tpg|DAA42025.1| TPA: serine carboxypeptidase 1 [Zea mays]
Length=479

 Score = 74.7 bits (182),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            V ++SGDQDSV+PL GSRTLV+ LA  MG K T PY  WF  +QVGGW   YG
Sbjct  385  VLVYSGDQDSVIPLTGSRTLVQSLARGMGLKTTTPYRVWFEGQQVGGWTQVYG  437


 Score = 48.1 bits (113),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            G+L+FATVRGA H  PF+QP R+L LF +F++G+ LP 
Sbjct  439  GALSFATVRGASHEAPFSQPGRSLVLFRAFLQGQPLPE  476



>gb|ACN31969.1| unknown [Zea mays]
Length=319

 Score = 75.1 bits (183),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            V ++SGDQDSV+PL GSRTLV+ LA  MG K T PY  WF  +QVGGW   YG
Sbjct  225  VLVYSGDQDSVIPLTGSRTLVQSLARGMGLKTTTPYRVWFEGQQVGGWTQVYG  277


 Score = 48.1 bits (113),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            G+L+FATVRGA H  PF+QP R+L LF +F++G+ LP 
Sbjct  279  GALSFATVRGASHEAPFSQPGRSLVLFRAFLQGQPLPE  316



>ref|XP_006576775.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X2 [Glycine 
max]
Length=426

 Score = 76.3 bits (186),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  523  GTTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             +   V ++SGDQDSV+PLLGSR+LV  LA ++G   TV Y AWF RKQV GW   YG+ 
Sbjct  329  NSNIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVAYRAWFERKQVAGWTQVYGEL  388


 Score = 46.6 bits (109),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNM  235
            L++AT+RGA H  PF QP R+L L  +F+ G+ LPN+
Sbjct  389  LSYATIRGASHEAPFTQPQRSLVLLKAFLEGKPLPNV  425



>ref|XP_008791046.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
 ref|XP_008791047.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
Length=463

 Score = 79.3 bits (194),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             PV ++SGDQDSV+PL GSRTLV+ LA+++  K TVPY  WF  KQVGGW   YG
Sbjct  369  IPVLVYSGDQDSVIPLTGSRTLVQRLANELKLKTTVPYRVWFEGKQVGGWTQVYG  423


 Score = 43.9 bits (102),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L FAT+RGA H  PF+QP R+L LF +F++ R LP
Sbjct  426  LAFATIRGASHEAPFSQPERSLVLFRAFLQRRPLP  460



>ref|XP_006652227.1| PREDICTED: serine carboxypeptidase-like 45-like [Oryza brachyantha]
Length=467

 Score = 72.0 bits (175),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            PV ++SGDQDSV+PL GSRTLV+ LA  +    T PY  WF  +QVGGW   YG
Sbjct  371  PVLVYSGDQDSVIPLTGSRTLVQRLAARLRLNTTAPYRVWFQGRQVGGWTQAYG  424


 Score = 50.8 bits (120),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -3

Query  375  WEAGQQSMGSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            W       G+L FATVRGA H  PF+QP R+L LF +F+ GR LP+
Sbjct  419  WTQAYGGGGTLAFATVRGASHEAPFSQPERSLVLFRAFLAGRPLPD  464



>gb|KCW90016.1| hypothetical protein EUGRSUZ_A02215 [Eucalyptus grandis]
Length=469

 Score = 72.0 bits (175),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDS +PLLG+RTLV  LA  +G   TVPY  WF   QV GW   YG  
Sbjct  367  VLVYSGDQDSAIPLLGTRTLVNNLAKQLGLNTTVPYRVWFEESQVAGWTQVYGDI  421


 Score = 50.1 bits (118),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L++AT+RGA H+ PF+QP R+L LFSSF+ GR LP
Sbjct  422  LSYATIRGASHVAPFSQPERSLVLFSSFLGGRPLP  456



>ref|XP_010023719.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=477

 Score = 72.0 bits (175),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDS +PLLG+RTLV  LA  +G   TVPY  WF   QV GW   YG  
Sbjct  375  VLVYSGDQDSAIPLLGTRTLVNNLAKQLGLNTTVPYRVWFEESQVAGWTQVYGDI  429


 Score = 50.1 bits (118),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L++AT+RGA H+ PF+QP R+L LFSSF+ GR LP
Sbjct  430  LSYATIRGASHVAPFSQPERSLVLFSSFLGGRPLP  464



>ref|XP_010055754.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW90022.1| hypothetical protein EUGRSUZ_A02225 [Eucalyptus grandis]
Length=474

 Score = 72.4 bits (176),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            V ++SGDQDS +PLLG+RTLV  LA  +G   TVPY  WF   QV GW   YG
Sbjct  366  VLVYSGDQDSAIPLLGTRTLVNNLAKQLGLNTTVPYRVWFEESQVAGWTQVYG  418


 Score = 49.3 bits (116),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L++AT+RGA H  PF+QP R+L LFSSF+ GR LP
Sbjct  421  LSYATIRGASHEAPFSQPERSLLLFSSFLGGRPLP  455



>ref|XP_008798399.1| PREDICTED: serine carboxypeptidase-like 42 [Phoenix dactylifera]
Length=335

 Score = 70.5 bits (171),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKFNLC  335
             PVWIFSGDQDSVVPL G+R+ + +LA  +  K   PY  W+   QVGGW+  YG   L 
Sbjct  240  LPVWIFSGDQDSVVPLTGTRSQIAKLAQQLKLKPKSPYQPWYAHGQVGGWSETYGNGRLV  299

Query  334  HC  329
            + 
Sbjct  300  YA  301


 Score = 50.4 bits (119),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 2/42 (5%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRP  226
            G L +ATVR   HMVP+AQP RAL LF+ F+ G+ LP  +RP
Sbjct  296  GRLVYATVRDGSHMVPYAQPERALVLFTRFIEGKLLP--SRP  335



>ref|XP_003630573.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AET05049.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=465

 Score = 72.8 bits (177),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGK  347
            V I+SGDQDSV+PL GSRTLV +LA  +  K T+PY  WF   QVGGW   YG 
Sbjct  373  VLIYSGDQDSVIPLTGSRTLVHKLARQLALKTTIPYRVWFEGHQVGGWTQVYGN  426


 Score = 47.8 bits (112),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
             +LTFAT+RGA H  PF+QP R+L LF SF+  + LP
Sbjct  426  NTLTFATIRGASHEAPFSQPERSLVLFKSFLENKPLP  462



>ref|XP_010055744.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Eucalyptus 
grandis]
Length=477

 Score = 70.9 bits (172),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQD+ +PLLG+RT+V  LA  +G   TVPY  WF  +QV GW   YG  
Sbjct  369  VLVYSGDQDAAIPLLGTRTIVNNLAKQLGLNTTVPYRVWFKERQVAGWTQVYGDI  423


 Score = 49.7 bits (117),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  PF+QP R+L LFSSF+ GR LP
Sbjct  424  LSFATIRGASHEAPFSQPERSLVLFSSFLGGRPLP  458



>ref|NP_001140326.1| hypothetical protein [Zea mays]
 gb|ACF83592.1| unknown [Zea mays]
 tpg|DAA38062.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=269

 Score = 70.1 bits (170),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             P  ++SGDQDSV+PL GSRTLV  LA  +    T PY AWF  KQVGGW   +G
Sbjct  173  IPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFG  227


 Score = 49.3 bits (116),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            G+L+FATVRGA H  PF+QP R+L LF +F+ G++LP 
Sbjct  229  GALSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPE  266



>tpg|DAA38063.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=274

 Score = 70.1 bits (170),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             P  ++SGDQDSV+PL GSRTLV  LA  +    T PY AWF  KQVGGW   +G
Sbjct  178  IPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFG  232


 Score = 49.3 bits (116),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            G+L+FATVRGA H  PF+QP R+L LF +F+ G++LP 
Sbjct  234  GALSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPE  271



>gb|KDO83620.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
 gb|KDO83621.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=185

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQ  377
             PVW+FSGDQDSVVPLLGSRTL+RELA D+ F+VTVPYGAWFH++Q
Sbjct  140  IPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQ  185



>tpg|DAA38059.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=466

 Score = 69.7 bits (169),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             P  ++SGDQDSV+PL GSRTLV  LA  +    T PY AWF  KQVGGW   +G
Sbjct  370  IPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFG  424


 Score = 49.3 bits (116),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            G+L+FATVRGA H  PF+QP R+L LF +F+ G++LP 
Sbjct  426  GALSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPE  463



>ref|XP_008667417.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA38060.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=472

 Score = 69.7 bits (169),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             P  ++SGDQDSV+PL GSRTLV  LA  +    T PY AWF  KQVGGW   +G
Sbjct  376  IPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFG  430


 Score = 49.3 bits (116),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            G+L+FATVRGA H  PF+QP R+L LF +F+ G++LP 
Sbjct  432  GALSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPE  469



>ref|XP_008667418.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACF78622.1| unknown [Zea mays]
 gb|ACF84275.1| unknown [Zea mays]
 tpg|DAA38061.1| TPA: serine carboxypeptidase K10B2.2 [Zea mays]
Length=471

 Score = 69.7 bits (169),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             P  ++SGDQDSV+PL GSRTLV  LA  +    T PY AWF  KQVGGW   +G
Sbjct  375  IPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFG  429


 Score = 49.3 bits (116),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            G+L+FATVRGA H  PF+QP R+L LF +F+ G++LP 
Sbjct  431  GALSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPE  468



>ref|XP_004503800.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=466

 Score = 70.9 bits (172),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V I+SGDQDSV+PL GSR+LV++LA  +    TVPY  WF   QVGGW   YG  
Sbjct  374  VLIYSGDQDSVIPLTGSRSLVQKLARQLSLNTTVPYRVWFEGHQVGGWTQVYGNI  428


 Score = 47.8 bits (112),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNM  235
            L+FAT+RGA H  PF+QP R+L LF+SF+  R LP +
Sbjct  429  LSFATIRGASHEAPFSQPQRSLVLFNSFLEDRPLPEI  465



>ref|XP_011040753.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=482

 Score = 72.0 bits (175),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDSV+P +GSR LV  LA ++G   TVPY  WF  KQVGGW   YG  
Sbjct  388  VLVYSGDQDSVIPFMGSRILVDGLAKELGLNATVPYRPWFEDKQVGGWTQVYGDI  442


 Score = 46.6 bits (109),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            LTFAT+RGA H+ P   P R+L LFS+F+ G+ LP
Sbjct  443  LTFATIRGAGHLAPLTSPKRSLALFSAFMSGKPLP  477



>ref|NP_001150027.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG37565.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=471

 Score = 68.9 bits (167),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             P  ++SGDQDSV+PL GSRTLV  LA  +    T PY AWF  KQVGGW   +G
Sbjct  375  IPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNSTAPYRAWFQGKQVGGWTQVFG  429


 Score = 49.3 bits (116),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            G+L+FATVRGA H  PF+QP R+L LF +F+ G++LP 
Sbjct  431  GALSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPE  468



>ref|XP_006844530.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
 gb|ERN06205.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
Length=460

 Score = 71.2 bits (173),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLV  LA  +    TVPY  WF  +QVGGW   YG  
Sbjct  365  IPVLVYSGDQDSVIPLTGSRTLVHGLAAKLHLNTTVPYRVWFEGEQVGGWTQVYGNI  421


 Score = 47.0 bits (110),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  PF+QP R+L LF +F++GR LP
Sbjct  422  LSFATIRGASHEAPFSQPQRSLGLFRAFLQGRPLP  456



>ref|XP_002307961.1| hypothetical protein POPTR_0006s03440g [Populus trichocarpa]
 gb|EEE91484.1| hypothetical protein POPTR_0006s03440g [Populus trichocarpa]
Length=482

 Score = 71.6 bits (174),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDSV+P +GSR LV  LA ++G   TVPY  WF  KQVGGW   YG  
Sbjct  388  VLVYSGDQDSVIPFIGSRILVDGLAKELGLNATVPYRPWFEDKQVGGWTQVYGDI  442


 Score = 46.6 bits (109),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            LTFAT+RGA H+ P   P R+L LFS+F+ G+ LP
Sbjct  443  LTFATIRGAGHLAPLTSPKRSLALFSAFLSGKPLP  477



>ref|XP_011041403.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=476

 Score = 73.9 bits (180),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDSV+P  GSRTLV  LA  +G   TVPY AWF  KQVGGW   YG  
Sbjct  387  VLVYSGDQDSVIPFTGSRTLVEGLAKKLGLNATVPYTAWFEDKQVGGWTQVYGDI  441


 Score = 43.9 bits (102),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRL  244
            LTF+T+RG  HM PF+ P R+L LF++F+ G+ L
Sbjct  442  LTFSTIRGGSHMAPFSSPGRSLALFAAFLSGKPL  475



>ref|XP_010673054.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=467

 Score = 69.3 bits (168),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDSV+PL GSR LV  LA ++G K TV Y  W   KQVGGW   YG  
Sbjct  371  VLVYSGDQDSVLPLTGSRMLVDSLAKELGLKTTVSYRTWLSDKQVGGWTQVYGDI  425


 Score = 48.5 bits (114),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT  232
            L +AT+RGA H  PF+QP R+L LF SF+ G  LP++T
Sbjct  426  LAYATIRGAAHEAPFSQPARSLVLFRSFLNGSPLPDVT  463



>ref|XP_009355265.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score = 69.7 bits (169),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            V I+SGDQDSV+PL  +RTLV  LA D+G +  VPY  WF  KQV GW   Y 
Sbjct  368  VLIYSGDQDSVIPLTSTRTLVSGLAKDLGLQTNVPYRVWFEEKQVAGWTQVYS  420


 Score = 47.8 bits (112),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
             +L++AT+RGA H  P +QP R+L LF+SF+RG+ LP
Sbjct  421  DALSYATIRGAGHEAPISQPERSLLLFTSFLRGKPLP  457



>gb|KDO83616.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=211

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQ  377
             PVW+FSGDQDSVVPLLGSRTL+RELA D+ F+VTVPYGAWFH++Q
Sbjct  166  IPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQ  211



>gb|KDO83619.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=265

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQ  377
             PVW+FSGDQDSVVPLLGSRTL+RELA D+ F+VTVPYGAWFH++Q
Sbjct  220  IPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQ  265



>ref|XP_002322611.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
 gb|EEF04372.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
Length=442

 Score = 72.8 bits (177),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDSV+P  GSRTLV  LA  +G   TVPY  WF  KQVGGW   YG  
Sbjct  353  VLVYSGDQDSVIPFTGSRTLVEGLAKKLGLNATVPYTPWFEDKQVGGWTQVYGNI  407


 Score = 43.9 bits (102),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRL  244
            LTF+T+RG  HM PF+ P R+L LF++F+ G+ L
Sbjct  408  LTFSTIRGGSHMAPFSSPGRSLALFAAFLSGKPL  441



>ref|XP_002446348.1| hypothetical protein SORBIDRAFT_06g014580 [Sorghum bicolor]
 gb|EES10676.1| hypothetical protein SORBIDRAFT_06g014580 [Sorghum bicolor]
Length=474

 Score = 67.0 bits (162),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVT-VPYGAWFHRKQVGGWATEYG  350
             PV ++SGDQDSV+PL GSRTLV  LA  +    T  PY AWF  KQVGGW   +G
Sbjct  377  IPVLVYSGDQDSVIPLTGSRTLVSRLAGRLRLNTTAAPYRAWFQGKQVGGWTQVFG  432


 Score = 49.3 bits (116),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            G+L+FATVRGA H  PF+QP R+L LF +F+ G++LP
Sbjct  434  GALSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLP  470



>gb|KDO83617.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
 gb|KDO83618.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=304

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQ  377
             PVW+FSGDQDSVVPLLGSRTL+RELA D+ F+VTVPYGAWFH++Q
Sbjct  259  IPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQ  304



>ref|XP_008443351.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis melo]
Length=472

 Score = 78.2 bits (191),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKFN  341
            V ++SGDQDSV+PLLG+RTLV +LA  M    T+PY AWFH  QVGGW   +G+ N
Sbjct  382  VLVYSGDQDSVIPLLGTRTLVNKLAKAMRLNTTLPYSAWFHNHQVGGWVETFGEKN  437


 Score = 38.1 bits (87),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRR  247
             +L+FAT+RGA H  P+  P  +L LF++F++ + 
Sbjct  437  NNLSFATIRGAAHQAPYTSPATSLALFTAFLQAKN  471



>ref|XP_007028221.1| Serine carboxypeptidase 45 [Theobroma cacao]
 gb|EOY08723.1| Serine carboxypeptidase 45 [Theobroma cacao]
Length=470

 Score = 73.9 bits (180),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+P  G+RTLV +LA  +G   TVPY  WF  KQVGGW   YG  
Sbjct  377  IPVMVYSGDQDSVIPFTGTRTLVYKLAKALGLNTTVPYRPWFEGKQVGGWTQVYGDI  433


 Score = 42.4 bits (98),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  P +QP R+L LF + + G+ LP
Sbjct  434  LSFATIRGASHTAPASQPERSLALFKAVLAGKPLP  468



>gb|KEH17941.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=185

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  520  TTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQV  374
               PVW+FSGDQDSVVPLLGSRTL+RELA D+ FK+TVPYGAWF + Q+
Sbjct  133  NNIPVWVFSGDQDSVVPLLGSRTLIRELADDLKFKITVPYGAWFRKDQI  181



>ref|XP_004136792.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 ref|XP_004159658.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
Length=436

 Score = 78.2 bits (191),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKFN  341
            V IFSGDQD+V+PLLGSRTLV +LA  +    T+PY AWFH  QVGGW   +G+ N
Sbjct  346  VLIFSGDQDAVIPLLGSRTLVNKLAKALRLNTTLPYSAWFHNHQVGGWVETFGEKN  401


 Score = 38.1 bits (87),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRR  247
             +L+FAT+RGA H  P+  P  +L LF++F++ + 
Sbjct  401  NNLSFATIRGAAHQAPYTSPATSLTLFTAFLQAKN  435



>ref|XP_008357674.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=376

 Score = 67.8 bits (164),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            V I+SGDQDS++PL  +RTLV  LA D+G +  VPY  W   KQV GW   Y 
Sbjct  281  VLIYSGDQDSIIPLTSTRTLVNGLARDLGLQTNVPYRVWVQEKQVAGWTQVYS  333


 Score = 47.8 bits (112),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
             +L++AT+RGA H  P +QP R+L LF+SF+RG+ LP
Sbjct  334  DALSYATIRGAGHEAPISQPKRSLLLFTSFLRGKPLP  370



>ref|XP_006373742.1| hypothetical protein POPTR_0016s04660g [Populus trichocarpa]
 gb|ERP51539.1| hypothetical protein POPTR_0016s04660g [Populus trichocarpa]
Length=357

 Score = 73.2 bits (178),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDSV+P  GSRTLV  LA  +G   TVPY  WF  KQVGGW   YG  
Sbjct  268  VLVYSGDQDSVIPFTGSRTLVEGLAKKLGLNATVPYTPWFEDKQVGGWTQVYGDI  322


 Score = 42.4 bits (98),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRL  244
            LTF+T+RG  HM PF+ P R+L LF S + G+ L
Sbjct  323  LTFSTIRGGSHMAPFSSPGRSLALFESVLSGKTL  356



>ref|XP_007162065.1| hypothetical protein PHAVU_001G120700g [Phaseolus vulgaris]
 gb|ESW34059.1| hypothetical protein PHAVU_001G120700g [Phaseolus vulgaris]
Length=459

 Score = 68.9 bits (167),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDSV+PL+ SR LV  LA ++G + TV Y AWF  KQV GW   YG  
Sbjct  367  VLVYSGDQDSVIPLISSRYLVNGLAKEIGLETTVAYRAWFEEKQVAGWTQTYGDM  421


 Score = 45.8 bits (107),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -3

Query  360  QSMGS-LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNM  235
            Q+ G  L++AT+RGA H  PF QP R+L L  +F+ G++LP++
Sbjct  416  QTYGDMLSYATIRGASHEAPFTQPQRSLVLLKAFLDGKQLPSV  458



>ref|XP_003520484.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score = 70.1 bits (170),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  520  TTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            ++  V ++SGDQDSV+PLLGSR+LV  LA ++G   TV Y  WF  KQV GW   YG  
Sbjct  365  SSIRVLVYSGDQDSVIPLLGSRSLVNGLAKEIGLNTTVAYRPWFGEKQVAGWTQVYGDI  423


 Score = 45.1 bits (105),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT  232
            L++ATVRGA H  PF+QP R+L L  +F+ G+ LP + 
Sbjct  424  LSYATVRGASHEAPFSQPQRSLVLLKAFLEGKPLPGVV  461



>gb|KHN30341.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=459

 Score = 70.1 bits (170),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  520  TTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            ++  V ++SGDQDSV+PLLGSR+LV  LA ++G   TV Y  WF  KQV GW   YG  
Sbjct  363  SSIRVLVYSGDQDSVIPLLGSRSLVNGLAKEIGLNTTVAYRPWFGEKQVAGWTQVYGDI  421


 Score = 45.1 bits (105),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMT  232
            L++ATVRGA H  PF+QP R+L L  +F+ G+ LP + 
Sbjct  422  LSYATVRGASHEAPFSQPQRSLVLLKAFLEGKPLPGVV  459



>ref|XP_002321745.2| hypothetical protein POPTR_0015s11610g [Populus trichocarpa]
 gb|EEF05872.2| hypothetical protein POPTR_0015s11610g [Populus trichocarpa]
Length=494

 Score = 62.8 bits (151),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQ  377
             PV ++SGDQDSV+PL GSRTLV  +A ++G   TVPY  WF  KQ
Sbjct  396  IPVLVYSGDQDSVIPLTGSRTLVHRVAKELGLNTTVPYRVWFAGKQ  441


 Score = 52.0 bits (123),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 2/50 (4%)
 Frame = -3

Query  384  GNRWEAGQQSMGSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNM  235
             N+W+    ++  L+FAT+RGA H  PF+QP R+L LF SF+ G+ LP +
Sbjct  446  ANKWQYPNSNI--LSFATIRGASHEAPFSQPERSLMLFKSFLEGKHLPEV  493



>gb|EMS60816.1| Serine carboxypeptidase-like 45 [Triticum urartu]
Length=506

 Score = 70.9 bits (172),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWA  362
             PV ++SGDQDSV+PL GSRTLV  LA  +    TVPY  WF  KQVGGW 
Sbjct  411  IPVLVYSGDQDSVIPLTGSRTLVHRLAKRLRLNATVPYRVWFQGKQVGGWT  461


 Score = 44.3 bits (103),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  PF+QP R+L LF +F+  R LP
Sbjct  468  LSFATIRGASHEAPFSQPERSLVLFRAFLASRPLP  502



>ref|XP_009355267.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Pyrus 
x bretschneideri]
Length=462

 Score = 67.4 bits (163),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            V I+SGDQDS++PL  +RTLV  LA D+G +  VPY  W   KQV GW   Y 
Sbjct  367  VLIYSGDQDSIIPLTSTRTLVNGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYS  419


 Score = 47.4 bits (111),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
             +L++AT+RGA H  P +QP R+L LF+SF+RG+ LP
Sbjct  420  DALSYATIRGAGHEAPISQPERSLLLFASFLRGKPLP  456



>gb|ABN06118.1| Peptidase S10, serine carboxypeptidase [Medicago truncatula]
Length=63

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  520  TTFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQV  374
               PVW+FS DQDSVVPLLGSRTL+RELA D+ FK+TVPYGAWF + Q+
Sbjct  11   NNIPVWVFSRDQDSVVPLLGSRTLIRELADDLKFKITVPYGAWFRKGQI  59



>gb|KDO83613.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=394

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQ  377
             PVW+FSGDQDSVVPLLGSRTL+RELA D+ F+VTVPYGAWFH++Q
Sbjct  349  IPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQ  394



>ref|XP_007203526.1| hypothetical protein PRUPE_ppa026347mg [Prunus persica]
 gb|EMJ04725.1| hypothetical protein PRUPE_ppa026347mg [Prunus persica]
Length=461

 Score = 65.9 bits (159),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            ++++SGDQDSV+PL G+RT V  LA  +    TVPY  WF  KQV GW   YG
Sbjct  367  IFVYSGDQDSVIPLTGTRTAVDGLAEVLELNTTVPYRVWFEEKQVAGWTQVYG  419


 Score = 48.5 bits (114),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  P+ QP R+L LFSSFV G+ LP
Sbjct  422  LSFATIRGAGHTAPYTQPERSLLLFSSFVGGKPLP  456



>ref|XP_006434389.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
 gb|ESR47629.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
Length=424

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQ  377
             PVW+FSGDQDSVVPLLGSRTL+RELA D+ F+VTVPYGAWFH++Q
Sbjct  379  IPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQ  424



>gb|KDO83614.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
 gb|KDO83615.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=423

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQ  377
             PVW+FSGDQDSVVPLLGSRTL+RELA D+ F+VTVPYGAWFH++Q
Sbjct  378  IPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQ  423



>ref|XP_010271870.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nelumbo 
nucifera]
Length=434

 Score = 68.9 bits (167),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDSV+PL GSR LV  LA+++G   T+ Y  WF  KQVGGW   Y   
Sbjct  342  VLVYSGDQDSVIPLTGSRMLVHRLANELGLNTTIAYRVWFQDKQVGGWTQVYSDI  396


 Score = 44.7 bits (104),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  PF+QP R+L LF +F+  + LP
Sbjct  397  LSFATIRGASHEAPFSQPERSLLLFKAFLEDKPLP  431



>ref|XP_010271869.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nelumbo 
nucifera]
Length=465

 Score = 68.9 bits (167),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDSV+PL GSR LV  LA+++G   T+ Y  WF  KQVGGW   Y   
Sbjct  373  VLVYSGDQDSVIPLTGSRMLVHRLANELGLNTTIAYRVWFQDKQVGGWTQVYSDI  427


 Score = 44.7 bits (104),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H  PF+QP R+L LF +F+  + LP
Sbjct  428  LSFATIRGASHEAPFSQPERSLLLFKAFLEDKPLP  462



>ref|NP_001242846.1| uncharacterized protein LOC100819443 precursor [Glycine max]
 gb|ACU18848.1| unknown [Glycine max]
Length=481

 Score = 72.8 bits (177),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGK  347
            V ++SGDQDSV+P +G+R LV  LA  +G K T+PY AWF  KQVGGW   YG 
Sbjct  390  VIVYSGDQDSVIPFMGTRRLVDRLAKTLGLKTTLPYSAWFVDKQVGGWTKVYGN  443


 Score = 40.4 bits (93),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            LT+ T+RGA H  P  QP R+  LF++F++G+ LP
Sbjct  445  LTYTTIRGASHGTPATQPKRSFVLFNAFLQGKPLP  479



>ref|XP_007224935.1| hypothetical protein PRUPE_ppa021576mg [Prunus persica]
 gb|EMJ26134.1| hypothetical protein PRUPE_ppa021576mg [Prunus persica]
Length=438

 Score = 71.2 bits (173),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEY  353
            V ++SGDQDSVVP  GSR+L+  LA  +G K TVPY AWF  KQVGGW   Y
Sbjct  346  VMVYSGDQDSVVPFFGSRSLINGLATQLGLKSTVPYRAWFEGKQVGGWTQVY  397


 Score = 42.0 bits (97),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FA +RGA H  P  QP R+L LF SF+ G+ LP
Sbjct  401  LSFAIIRGASHTAPSTQPKRSLALFKSFLGGKPLP  435



>gb|KHN30339.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=481

 Score = 72.4 bits (176),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGK  347
            V ++SGDQDSV+P +G+R LV  LA  +G K T+PY AWF  KQVGGW   YG 
Sbjct  390  VIVYSGDQDSVIPFMGTRRLVDRLAKTLGLKTTLPYSAWFVDKQVGGWTQVYGN  443


 Score = 40.4 bits (93),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            LT+ T+RGA H  P  QP R+  LF++F++G+ LP
Sbjct  445  LTYTTIRGASHGTPATQPKRSFVLFNAFLQGKPLP  479



>ref|XP_008240683.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=456

 Score = 63.9 bits (154),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            +  +SGDQDSV+PL G+RT V  LA  +    TVPY  WF  KQV GW   YG
Sbjct  362  ILAYSGDQDSVIPLTGTRTAVDGLAEVLELNTTVPYRVWFEEKQVAGWTQVYG  414


 Score = 49.3 bits (116),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RGA H VP+ QP R+L LFSSF+ G+ LP
Sbjct  417  LSFATIRGAGHTVPYTQPERSLLLFSSFLGGKPLP  451



>gb|EAY93940.1| hypothetical protein OsI_15713 [Oryza sativa Indica Group]
Length=470

 Score = 60.5 bits (145),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVP-YGAWFHRKQVGGWATEYG  350
            PV ++SGDQDSV+PL GSRT+V+ LA  +    T   Y  WF  +QVGGW   +G
Sbjct  374  PVLVYSGDQDSVIPLTGSRTVVQRLAGRLRLGTTAAGYRVWFEGRQVGGWTQSFG  428


 Score = 51.6 bits (122),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            G+L+FATVRGA H  PF+QP R+L LF++F+ GR LP+
Sbjct  430  GALSFATVRGASHEAPFSQPERSLVLFAAFLAGRPLPD  467



>gb|KEH37845.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=464

 Score = 64.7 bits (156),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V  +SGDQDS +PL G+RTLV+ LA D+G   T  Y  WF  KQV GW   YG F
Sbjct  373  VLAYSGDQDSFIPLTGTRTLVKGLAKDLGLNTTEVYRVWFDGKQVAGWTEVYGGF  427


 Score = 47.0 bits (110),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            G L+FAT+RGA H  PF+QP R L LF SFV G+  P
Sbjct  426  GFLSFATIRGAAHAAPFSQPERLLVLFKSFVEGKSPP  462



>gb|KDP37687.1| hypothetical protein JCGZ_06344 [Jatropha curcas]
Length=463

 Score = 70.5 bits (171),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V I+SGDQDSV+P +GSRTLV  LA  +G   TV Y  W   KQVGGW   YG  
Sbjct  374  VLIYSGDQDSVIPFIGSRTLVNNLAKQLGLNATVAYRGWIEDKQVGGWTEVYGDI  428


 Score = 40.4 bits (93),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRL  244
            L+F T+RG  H+ PF+ P R+L LF +F+ G+ L
Sbjct  429  LSFTTIRGGSHLAPFSSPKRSLALFKAFLAGKPL  462



>ref|XP_010653632.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CBI32796.3| unnamed protein product [Vitis vinifera]
Length=444

 Score = 64.7 bits (156),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -2

Query  502  IFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            ++SGDQDS + L+G+R+L+  LA  +  K TVPY  WF +KQVGGW   YG  
Sbjct  355  VYSGDQDSRISLIGTRSLLEGLAKKLKLKTTVPYRNWFEKKQVGGWTQVYGDI  407


 Score = 45.8 bits (107),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            L+FAT+RG  H  P +QP R+L LF++F+ G+ LP+
Sbjct  408  LSFATIRGGSHTAPISQPTRSLALFTAFLEGKPLPD  443



>ref|NP_001052663.1| Os04g0396800 [Oryza sativa Japonica Group]
 emb|CAE05146.2| OSJNBa0039C07.2 [Oryza sativa Japonica Group]
 dbj|BAF14577.1| Os04g0396800 [Oryza sativa Japonica Group]
 gb|EAZ30581.1| hypothetical protein OsJ_14632 [Oryza sativa Japonica Group]
 dbj|BAG91822.1| unnamed protein product [Oryza sativa Japonica Group]
Length=470

 Score = 58.2 bits (139),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVP-YGAWFHRKQVGGWATEYG  350
            PV ++SGDQDSV+PL GSRT+V+ LA  +    T   Y  WF  +QVGGW   +G
Sbjct  374  PVLVYSGDQDSVIPLTGSRTVVQRLAGWLRLGTTAAGYRVWFEGRQVGGWTQSFG  428


 Score = 51.6 bits (122),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  351  GSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            G+L+FATVRGA H  PF+QP R+L LF++F+ GR LP+
Sbjct  430  GALSFATVRGASHEAPFSQPERSLVLFAAFLAGRPLPD  467



>gb|KDO72509.1| hypothetical protein CISIN_1g037032mg [Citrus sinensis]
Length=473

 Score = 62.0 bits (149),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            P+ +FSGDQD+ +PL  +R + + LA+D+    T  Y  W+ ++QVGGW+  +G F
Sbjct  370  PILLFSGDQDTKIPLTQTRIIAKNLANDLKLFPTTNYANWYDKQQVGGWSQSFGAF  425


 Score = 47.4 bits (111),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -3

Query  360  QSMGSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            +++  LT+ATVRGA H VP+  P  AL LF SF+ G  LPN
Sbjct  429  KNITYLTYATVRGAAHEVPYTTPSPALTLFQSFLTGSPLPN  469



>ref|XP_006431096.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
 gb|ESR44336.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
Length=473

 Score = 62.0 bits (149),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -2

Query  511  PVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            P+ +FSGDQD+ +PL  +R + + LA+D+    T  Y  W+ ++QVGGW+  +G F
Sbjct  370  PILLFSGDQDTKIPLTQTRIIAKNLANDLKLFPTTNYANWYDKQQVGGWSQSFGAF  425


 Score = 47.4 bits (111),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -3

Query  360  QSMGSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            +++  LT+ATVRGA H VP+  P  AL LF SF+ G  LPN
Sbjct  429  KNITYLTYATVRGAAHEVPYTTPSPALTLFQSFLTGSPLPN  469



>gb|AFK49319.1| unknown [Lotus japonicus]
Length=224

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSRTLV +LA ++G K TVPY  WF  KQVGGW   YG  
Sbjct  130  LPVLVYSGDQDSVIPLTGSRTLVHQLAKELGLKTTVPYRVWFEGKQVGGWTQVYGNI  186



>emb|CBI32801.3| unnamed protein product [Vitis vinifera]
Length=422

 Score = 63.2 bits (152),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -2

Query  502  IFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            ++SGDQDS + L G+R+L+  LA  +  K TVPY  WF +KQVGGW   YG  
Sbjct  333  VYSGDQDSRMSLFGTRSLLEGLAKKLKLKTTVPYRNWFEKKQVGGWTQVYGDI  385


 Score = 45.8 bits (107),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            L+FAT+RG  H  P +QP R+L LF++F+ G+ LP+
Sbjct  386  LSFATIRGGSHTAPISQPARSLALFTAFLEGKPLPD  421



>ref|XP_002277420.3| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=457

 Score = 63.2 bits (152),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -2

Query  502  IFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            ++SGDQDS + L G+R+L+  LA  +  K TVPY  WF +KQVGGW   YG  
Sbjct  368  VYSGDQDSRMSLFGTRSLLEGLAKKLKLKTTVPYRNWFEKKQVGGWTQVYGDI  420


 Score = 45.8 bits (107),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPN  238
            L+FAT+RG  H  P +QP R+L LF++F+ G+ LP+
Sbjct  421  LSFATIRGGSHTAPISQPARSLALFTAFLEGKPLPD  456



>ref|XP_009415855.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             PV ++SGDQDSV+PL GSRTLV++LA++MG K TVPY  WF  KQVGGW   YG
Sbjct  369  IPVLVYSGDQDSVIPLTGSRTLVQKLANEMGLKTTVPYRVWFEGKQVGGWTQVYG  423


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 44/86 (51%), Gaps = 1/86 (1%)
 Frame = -3

Query  495  AGIKIRLCHCSGREHLSVNLLTTWGSRLQSLMELGFTGNRWEAGQQSMGS-LTFATVRGA  319
            +G +  +   +G   L   L    G +      + F G +     Q  G  L+FAT+RGA
Sbjct  375  SGDQDSVIPLTGSRTLVQKLANEMGLKTTVPYRVWFEGKQVGGWTQVYGDILSFATIRGA  434

Query  318  FHMVPFAQPFRALHLFSSFVRGRRLP  241
             H  PF+QP R+L LF SF++GR LP
Sbjct  435  SHEAPFSQPERSLVLFRSFLQGRPLP  460



>emb|CAN70439.1| hypothetical protein VITISV_011900 [Vitis vinifera]
Length=453

 Score = 64.7 bits (156),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -2

Query  502  IFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            ++SGDQDS + L+G+R+L+  LA  +  K TVPY  WF +KQVGGW   YG  
Sbjct  355  VYSGDQDSRISLIGTRSLLEGLAKKLKLKTTVPYRNWFEKKQVGGWTQVYGDI  407


 Score = 42.7 bits (99),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RG  H  P +QP R+L LF++F+ G+  P
Sbjct  408  LSFATIRGGSHTAPISQPXRSLALFTAFLEGKPPP  442



>gb|KDO83605.1| hypothetical protein CISIN_1g0117642mg, partial [Citrus sinensis]
 gb|KDO83606.1| hypothetical protein CISIN_1g0117642mg, partial [Citrus sinensis]
 gb|KDO83607.1| hypothetical protein CISIN_1g0117642mg, partial [Citrus sinensis]
 gb|KDO83608.1| hypothetical protein CISIN_1g0117642mg, partial [Citrus sinensis]
 gb|KDO83609.1| hypothetical protein CISIN_1g0117642mg, partial [Citrus sinensis]
 gb|KDO83610.1| hypothetical protein CISIN_1g0117642mg, partial [Citrus sinensis]
 gb|KDO83611.1| hypothetical protein CISIN_1g0117642mg, partial [Citrus sinensis]
 gb|KDO83612.1| hypothetical protein CISIN_1g0117642mg, partial [Citrus sinensis]
Length=55

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPSIDD  214
            LTF TVRGA HMVP+AQP RALHLFSSFV GRRLPN TRP+I D
Sbjct  12   LTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD  55



>gb|KJB11409.1| hypothetical protein B456_001G257100 [Gossypium raimondii]
Length=420

 Score = 55.8 bits (133),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             PV ++SGDQD+ +PL  +R +   +A ++       YG W+ +KQVGGW   +G
Sbjct  316  IPVLLYSGDQDAKIPLTQTRIIANNIAKELNLSPFSNYGTWYDQKQVGGWTQSFG  370


 Score = 50.8 bits (120),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 3/50 (6%)
 Frame = -3

Query  372  EAGQQSMGSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLPNMTRPS  223
            +A  +++  LTFATVRGA H VPF  P +AL LF SFV G  LP   RPS
Sbjct  373  DANGKNVTYLTFATVRGAAHEVPFTSPSQALTLFHSFVNGIPLP---RPS  419



>ref|XP_003633850.1| PREDICTED: serine carboxypeptidase-like 46 [Vitis vinifera]
 emb|CBI22165.3| unnamed protein product [Vitis vinifera]
Length=479

 Score = 60.1 bits (144),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             P+ +FSGDQD+++PL  +R +   +A D+       YG W+ +KQVGGW   +G
Sbjct  376  IPILLFSGDQDAIIPLTQTRIIANNVAKDLKLVPFTEYGTWYDKKQVGGWTQSFG  430


 Score = 46.6 bits (109),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            LTFATVRGA H VPF  P +AL +F SF+ G  LP
Sbjct  441  LTFATVRGAAHEVPFTSPSQALTMFKSFLSGSPLP  475



>ref|XP_009380118.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=467

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             PV ++SGDQDSV+PL GSRTLV+ LA+++G K T+PY AWF  +QVGGW   YG
Sbjct  369  IPVLVYSGDQDSVIPLTGSRTLVQRLANELGLKTTIPYRAWFEGEQVGGWTQVYG  423



>ref|XP_010322561.1| PREDICTED: serine carboxypeptidase-like 46 isoform X3 [Solanum 
lycopersicum]
Length=394

 Score = 59.7 bits (143),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             P+ +FSGDQDSV+PL  +R + + LA D+       YG W+   Q+GGW+  YG
Sbjct  286  IPILLFSGDQDSVLPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQSYG  340


 Score = 46.2 bits (108),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -3

Query  360  QSMGSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            +++  LTFATVRGA H VP+  P +AL LF +F+RG   P
Sbjct  346  KNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPP  385



>gb|KGN59387.1| hypothetical protein Csa_3G816000 [Cucumis sativus]
Length=488

 Score = 68.2 bits (165),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDS +P  G+RTLV  LA+ M    TV Y  WF  K+VGGW  EYGKF
Sbjct  397  VLVYSGDQDSALPFSGTRTLVNSLANSMNLCPTVRYRPWFSDKKVGGWTEEYGKF  451


 Score = 37.7 bits (86),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            LT+A VRGA       QP R+L LF SF+ G+ LP
Sbjct  452  LTYAIVRGASQKTAQIQPKRSLQLFKSFLAGKPLP  486



>ref|XP_004136609.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
Length=420

 Score = 68.2 bits (165),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            V ++SGDQDS +P  G+RTLV  LA+ M    TV Y  WF  K+VGGW  EYGKF
Sbjct  329  VLVYSGDQDSALPFSGTRTLVNSLANSMNLCPTVRYRPWFSDKKVGGWTEEYGKF  383


 Score = 37.7 bits (86),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            LT+A VRGA       QP R+L LF SF+ G+ LP
Sbjct  384  LTYAIVRGASQKTAQIQPKRSLQLFKSFLAGKPLP  418



>ref|XP_010322533.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Solanum 
lycopersicum]
Length=447

 Score = 59.7 bits (143),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             P+ +FSGDQDSV+PL  +R + + LA D+       YG W+   Q+GGW+  YG
Sbjct  339  IPILLFSGDQDSVLPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQSYG  393


 Score = 45.8 bits (107),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -3

Query  360  QSMGSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            +++  LTFATVRGA H VP+  P +AL LF +F+RG   P
Sbjct  399  KNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPP  438



>ref|XP_009380117.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=489

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             PV ++SGDQDSV+PL GSRTLV+ LA+++G K T+PY AWF  +QVGGW   YG
Sbjct  391  IPVLVYSGDQDSVIPLTGSRTLVQRLANELGLKTTIPYRAWFEGEQVGGWTQVYG  445



>emb|CAN72075.1| hypothetical protein VITISV_041582 [Vitis vinifera]
Length=365

 Score = 63.2 bits (152),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -2

Query  502  IFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
            ++SGDQDS   L+G+R+L+  LA  +  K TVPY  WF +KQVGGW   YG  
Sbjct  267  VYSGDQDSRXSLIGTRSLLEGLAKKLKLKTTVPYRNWFEKKQVGGWTQVYGDI  319


 Score = 42.4 bits (98),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            L+FAT+RG  H  P +QP R+L LF++F+ G+  P
Sbjct  320  LSFATIRGGSHTAPISQPARSLALFTAFLEGKPPP  354



>ref|XP_006838780.1| hypothetical protein AMTR_s00002p00258640 [Amborella trichopoda]
 gb|ERN01349.1| hypothetical protein AMTR_s00002p00258640 [Amborella trichopoda]
Length=478

 Score = 58.9 bits (141),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKFN  341
             P++++SGDQDS +PL  +R +  +LA  +       Y  W+ +KQVGGW   +G+ N
Sbjct  381  IPIFLYSGDQDSKIPLTQTRIIANQLAKRLKLSPITKYAPWYDKKQVGGWVQAFGRGN  438


 Score = 46.6 bits (109),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -3

Query  345  LTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            LTFATVRGA H VPF  P +AL LF +F+ G  LP
Sbjct  442  LTFATVRGAAHEVPFTSPSQALTLFRAFITGSPLP  476



>gb|KJB31552.1| hypothetical protein B456_005G196500 [Gossypium raimondii]
Length=316

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKF  344
             PV ++SGDQDSV+PL GSR LV +LA ++G K TVPY  WF  +QVGGW   YG  
Sbjct  222  IPVMVYSGDQDSVIPLTGSRKLVNQLAEELGLKTTVPYRVWFEGQQVGGWTQAYGNI  278


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -3

Query  495  AGIKIRLCHCSGREHLSVNLLTTWGSRLQSLMELGFTGNRWEAGQQSMGS-LTFATVRGA  319
            +G +  +   +G   L   L    G +      + F G +     Q+ G+ L+FAT+RGA
Sbjct  228  SGDQDSVIPLTGSRKLVNQLAEELGLKTTVPYRVWFEGQQVGGWTQAYGNILSFATIRGA  287

Query  318  FHMVPFAQPFRALHLFSSFVRGRRLP  241
             H  PF+QP R+L LF +F+ GR LP
Sbjct  288  SHEAPFSQPERSLVLFKAFLEGRPLP  313



>ref|XP_004228838.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Solanum 
lycopersicum]
Length=482

 Score = 59.7 bits (143),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -2

Query  514  FPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
             P+ +FSGDQDSV+PL  +R + + LA D+       YG W+   Q+GGW+  YG
Sbjct  374  IPILLFSGDQDSVLPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQSYG  428


 Score = 45.8 bits (107),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -3

Query  360  QSMGSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            +++  LTFATVRGA H VP+  P +AL LF +F+RG   P
Sbjct  434  KNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPP  473



>ref|XP_004979352.1| PREDICTED: serine carboxypeptidase-like 45-like [Setaria italica]
Length=472

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  508  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYG  350
            V ++SGDQDSV+PL GSRTLV+ LAHDMG K T PY  WF  +QVGGW   YG
Sbjct  378  VLVYSGDQDSVIPLTGSRTLVQNLAHDMGLKTTTPYRVWFEGQQVGGWTQVYG  430



>gb|KHG07552.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=476

 Score = 56.2 bits (134),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -2

Query  517  TFPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGK  347
            + PV +F+GDQDS +PL  +R +   LA ++       Y  W+ +KQVGGW   +GK
Sbjct  372  SIPVLLFNGDQDSKIPLTQTRIIANMLAKELKLVPFGSYAPWYDKKQVGGWTQSFGK  428


 Score = 48.9 bits (115),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -3

Query  360  QSMGSLTFATVRGAFHMVPFAQPFRALHLFSSFVRGRRLP  241
            Q++  LTFATVRGA H VP+  PF+AL LF +F+R   LP
Sbjct  433  QNLTFLTFATVRGAAHEVPYTSPFQALTLFQAFLRRSLLP  472



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400