BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF047K23

Length=422
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011093636.1|  PREDICTED: hexokinase-1                          74.3    1e-12   Sesamum indicum [beniseed]
gb|AFO84084.1|  hexokinase                                            73.9    2e-12   Actinidia deliciosa [Chinese gooseberry]
gb|AFO84083.1|  hexokinase                                            72.4    6e-12   Actinidia chinensis
gb|KDP33801.1|  hypothetical protein JCGZ_07372                       71.6    1e-11   Jatropha curcas
sp|Q9SEK3.1|HXK1_SPIOL  RecName: Full=Hexokinase-1; AltName: Full...  71.2    2e-11   Spinacia oleracea
emb|CDP03252.1|  unnamed protein product                              67.8    3e-11   Coffea canephora [robusta coffee]
ref|XP_007160283.1|  hypothetical protein PHAVU_002G308400g           70.1    3e-11   Phaseolus vulgaris [French bean]
ref|XP_010267128.1|  PREDICTED: hexokinase-1-like                     70.1    3e-11   Nelumbo nucifera [Indian lotus]
gb|KDO66585.1|  hypothetical protein CISIN_1g010895mg                 67.8    5e-11   Citrus sinensis [apfelsine]
gb|AHB32106.1|  hexokinase                                            69.3    7e-11   Camellia sinensis [black tea]
gb|AHD25654.1|  hexokinase 1                                          68.9    7e-11   Camellia sinensis [black tea]
gb|AAS60195.1|  hexokinase 4a                                         68.6    1e-10   Nicotiana tabacum [American tobacco]
gb|KHN41674.1|  Hexokinase-1                                          68.6    1e-10   Glycine soja [wild soybean]
gb|KDO66584.1|  hypothetical protein CISIN_1g010895mg                 67.8    1e-10   Citrus sinensis [apfelsine]
ref|XP_003525287.1|  PREDICTED: hexokinase-1-like                     68.6    1e-10   Glycine max [soybeans]
emb|CDP03250.1|  unnamed protein product                              68.2    1e-10   Coffea canephora [robusta coffee]
gb|KDO66582.1|  hypothetical protein CISIN_1g010895mg                 68.2    2e-10   Citrus sinensis [apfelsine]
ref|XP_003530493.1|  PREDICTED: hexokinase-1-like                     68.2    2e-10   Glycine max [soybeans]
ref|NP_001275786.1|  hexokinase                                       67.8    2e-10   Citrus sinensis [apfelsine]
ref|XP_009601881.1|  PREDICTED: hexokinase-2-like                     67.8    2e-10   Nicotiana tomentosiformis
ref|XP_007013022.1|  Hexokinase 2 isoform 3                           67.0    3e-10   
gb|EYU27268.1|  hypothetical protein MIMGU_mgv1a019208mg              67.4    3e-10   Erythranthe guttata [common monkey flower]
ref|XP_007215785.1|  hypothetical protein PRUPE_ppa009797mg           65.5    3e-10   
gb|KJB83117.1|  hypothetical protein B456_013G230400                  67.4    3e-10   Gossypium raimondii
ref|XP_007013021.1|  Hexokinase 1 isoform 2                           67.0    3e-10   Theobroma cacao [chocolate]
ref|XP_007013020.1|  Hexokinase 1 isoform 1                           67.0    4e-10   
gb|KHG22031.1|  Hexokinase-1                                          67.0    4e-10   Gossypium arboreum [tree cotton]
ref|XP_010688341.1|  PREDICTED: hexokinase-1                          67.0    5e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH21332.1|  hexokinase                                            65.9    6e-10   Medicago truncatula
ref|XP_007024321.1|  Hexokinase 2                                     66.2    8e-10   
ref|XP_008228416.1|  PREDICTED: hexokinase-1-like                     65.9    1e-09   Prunus mume [ume]
gb|AET05183.2|  hexokinase                                            65.9    1e-09   Medicago truncatula
ref|XP_002325031.1|  Hexokinase 1 family protein                      65.5    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_008387424.1|  PREDICTED: hexokinase-1-like                     63.2    2e-09   
emb|CBI27996.3|  unnamed protein product                              65.1    2e-09   Vitis vinifera
gb|AEJ95926.1|  HXK1                                                  65.1    2e-09   Vitis vinifera
ref|XP_002283608.1|  PREDICTED: hexokinase-1-like                     65.1    2e-09   Vitis vinifera
emb|CAN83149.1|  hypothetical protein VITISV_024177                   65.1    2e-09   Vitis vinifera
ref|XP_009795017.1|  PREDICTED: hexokinase-2-like                     64.7    3e-09   Nicotiana sylvestris
ref|XP_011008120.1|  PREDICTED: hexokinase-1-like                     64.3    3e-09   Populus euphratica
ref|XP_011014418.1|  PREDICTED: hexokinase-1-like                     64.3    3e-09   Populus euphratica
gb|AFK48467.1|  unknown                                               61.6    4e-09   Lotus japonicus
gb|KGN60580.1|  hypothetical protein Csa_2G000870                     61.2    4e-09   Cucumis sativus [cucumbers]
ref|XP_006353496.1|  PREDICTED: hexokinase-1-like isoform X1          63.9    5e-09   Solanum tuberosum [potatoes]
ref|XP_009338734.1|  PREDICTED: hexokinase-1-like isoform X1          63.5    6e-09   Pyrus x bretschneideri [bai li]
ref|XP_010049611.1|  PREDICTED: hexokinase-1-like                     63.5    6e-09   Eucalyptus grandis [rose gum]
ref|XP_006353497.1|  PREDICTED: hexokinase-1-like isoform X2          63.2    7e-09   Solanum tuberosum [potatoes]
ref|XP_008458856.1|  PREDICTED: hexokinase-1-like isoform X2          63.2    7e-09   
ref|XP_008458873.1|  PREDICTED: hexokinase-1-like isoform X3          63.2    7e-09   Cucumis melo [Oriental melon]
gb|KHG25517.1|  Hexokinase-1 -like protein                            63.2    7e-09   Gossypium arboreum [tree cotton]
gb|KJB65034.1|  hypothetical protein B456_010G077400                  63.2    8e-09   Gossypium raimondii
ref|XP_008458849.1|  PREDICTED: hexokinase-1-like isoform X1          63.5    8e-09   Cucumis melo [Oriental melon]
ref|XP_010106711.1|  hypothetical protein L484_000821                 59.7    8e-09   Morus notabilis
ref|XP_004503491.1|  PREDICTED: hexokinase-1-like isoform X2          63.2    8e-09   Cicer arietinum [garbanzo]
ref|XP_004503490.1|  PREDICTED: hexokinase-1-like isoform X1          63.2    9e-09   
ref|XP_010098150.1|  hypothetical protein L484_026284                 63.2    9e-09   Morus notabilis
ref|XP_003630707.1|  Hexokinase                                       63.2    9e-09   
gb|ADZ96378.1|  hexokinase 1                                          63.2    9e-09   Eriobotrya japonica [loquat]
gb|KEH27216.1|  hexokinase                                            62.8    9e-09   Medicago truncatula
ref|NP_001234710.1|  hexokinase                                       62.8    1e-08   Solanum lycopersicum
ref|XP_006853711.1|  hypothetical protein AMTR_s00056p00151260        62.8    1e-08   Amborella trichopoda
ref|XP_004302852.1|  PREDICTED: hexokinase-1-like                     62.4    1e-08   Fragaria vesca subsp. vesca
gb|KHN40378.1|  Hexokinase-1                                          62.4    1e-08   Glycine soja [wild soybean]
ref|XP_010249484.1|  PREDICTED: hexokinase-1                          62.4    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_003516735.1|  PREDICTED: hexokinase-1-like                     62.4    1e-08   Glycine max [soybeans]
ref|XP_008242483.1|  PREDICTED: hexokinase-1                          62.4    2e-08   Prunus mume [ume]
gb|KJB56835.1|  hypothetical protein B456_009G137700                  62.0    2e-08   Gossypium raimondii
ref|XP_007203872.1|  hypothetical protein PRUPE_ppa004637mg           62.0    2e-08   Prunus persica
ref|NP_001284452.1|  hexokinase-1-like                                61.6    2e-08   Cucumis melo [Oriental melon]
gb|AHG98487.1|  hexokinase                                            61.6    3e-08   Dimocarpus longan [longan]
gb|ACJ04704.1|  hexokinase 1                                          61.2    3e-08   Cucumis melo [Oriental melon]
ref|XP_004141023.1|  PREDICTED: hexokinase-1-like                     61.2    3e-08   
ref|XP_004135675.1|  PREDICTED: hexokinase-2-like                     60.8    5e-08   Cucumis sativus [cucumbers]
ref|XP_008795834.1|  PREDICTED: hexokinase-2-like isoform X1          60.8    5e-08   Phoenix dactylifera
gb|AAS60196.1|  hexokinase 4b                                         60.8    5e-08   Nicotiana tabacum [American tobacco]
ref|NP_001280783.1|  uncharacterized protein LOC103443741             60.8    5e-08   Malus domestica [apple tree]
gb|KFK40349.1|  hypothetical protein AALP_AA3G362600                  60.8    5e-08   Arabis alpina [alpine rockcress]
gb|AIX02984.1|  hexokinase                                            60.5    6e-08   Morella rubra [Chinese arbutus]
ref|XP_008795842.1|  PREDICTED: hexokinase-2-like isoform X2          60.5    6e-08   Phoenix dactylifera
gb|AAS60197.1|  hexokinase 5                                          60.5    6e-08   Nicotiana tabacum [American tobacco]
gb|AAL60583.1|AF454961_1  hexokinase                                  60.5    6e-08   Brassica oleracea
emb|CDY03331.1|  BnaC09g10170D                                        60.5    6e-08   
ref|XP_006408903.1|  hypothetical protein EUTSA_v10001968mg           60.5    6e-08   Eutrema salsugineum [saltwater cress]
gb|AID50967.1|  hexokinase 1                                          60.5    7e-08   Malus domestica [apple tree]
ref|XP_008337603.1|  PREDICTED: hexokinase-1-like                     60.1    7e-08   
ref|XP_002514221.1|  hexokinase, putative                             59.7    1e-07   Ricinus communis
gb|KFK29465.1|  hypothetical protein AALP_AA7G137600                  59.3    2e-07   Arabis alpina [alpine rockcress]
ref|XP_002283574.1|  PREDICTED: hexokinase-2                          59.3    2e-07   Vitis vinifera
ref|XP_007135629.1|  hypothetical protein PHAVU_010G144900g           58.9    2e-07   Phaseolus vulgaris [French bean]
gb|KHN27811.1|  Hexokinase-1                                          58.5    2e-07   Glycine soja [wild soybean]
gb|KHN40379.1|  Hexokinase-2                                          58.9    2e-07   Glycine soja [wild soybean]
ref|XP_003516783.1|  PREDICTED: hexokinase-1-like                     58.5    3e-07   Glycine max [soybeans]
ref|XP_003529000.1|  PREDICTED: hexokinase-1-like                     58.5    3e-07   Glycine max [soybeans]
gb|KJB70380.1|  hypothetical protein B456_011G070700                  58.5    3e-07   Gossypium raimondii
ref|XP_010047252.1|  PREDICTED: hexokinase-2-like                     57.8    5e-07   Eucalyptus grandis [rose gum]
emb|CDY48733.1|  BnaA09g10080D                                        57.8    5e-07   Brassica napus [oilseed rape]
ref|XP_008778615.1|  PREDICTED: hexokinase-2-like isoform X2          57.0    5e-07   
gb|AIB55755.1|  hexokinase, partial (chloroplast)                     55.5    5e-07   Brassica rapa
ref|XP_002867423.1|  ATHXK1                                           57.4    6e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_003533038.1|  PREDICTED: hexokinase-1-like isoform X1          57.4    6e-07   Glycine max [soybeans]
ref|XP_008789199.1|  PREDICTED: hexokinase-2-like                     57.4    6e-07   
gb|KHG28915.1|  Hexokinase-1                                          57.4    7e-07   Gossypium arboreum [tree cotton]
ref|XP_010665886.1|  PREDICTED: hexokinase-1-like isoform X2          57.4    7e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008778614.1|  PREDICTED: hexokinase-2-like isoform X1          57.0    7e-07   Phoenix dactylifera
emb|CBI36049.3|  unnamed protein product                              57.0    8e-07   Vitis vinifera
ref|XP_004513053.1|  PREDICTED: hexokinase-1-like                     57.0    8e-07   Cicer arietinum [garbanzo]
ref|XP_010665885.1|  PREDICTED: hexokinase-1-like isoform X1          57.0    8e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009352555.1|  PREDICTED: hexokinase-1                          57.0    9e-07   Pyrus x bretschneideri [bai li]
ref|XP_009112637.1|  PREDICTED: hexokinase-1-like                     57.0    1e-06   Brassica rapa
gb|AAL60584.1|AF454962_1  hexokinase                                  57.0    1e-06   Brassica oleracea
ref|XP_010924444.1|  PREDICTED: hexokinase-2-like isoform X2          56.6    1e-06   Elaeis guineensis
ref|XP_010924442.1|  PREDICTED: hexokinase-2-like isoform X1          56.6    1e-06   Elaeis guineensis
ref|XP_010915190.1|  PREDICTED: hexokinase-2-like                     56.2    2e-06   Elaeis guineensis
gb|KCW79624.1|  hypothetical protein EUGRSUZ_C00983                   55.8    2e-06   Eucalyptus grandis [rose gum]
ref|XP_010047667.1|  PREDICTED: hexokinase-1-like                     55.8    2e-06   Eucalyptus grandis [rose gum]
ref|XP_010526433.1|  PREDICTED: hexokinase-1                          55.8    2e-06   Tarenaya hassleriana [spider flower]
emb|CDY35895.1|  BnaA07g00920D                                        55.8    2e-06   Brassica napus [oilseed rape]
ref|XP_003627048.1|  Hexokinase                                       55.5    2e-06   Medicago truncatula
ref|XP_009102132.1|  PREDICTED: hexokinase-1                          55.5    3e-06   Brassica rapa
ref|XP_004287480.1|  PREDICTED: hexokinase-1                          55.5    3e-06   Fragaria vesca subsp. vesca
ref|XP_010540986.1|  PREDICTED: hexokinase-1-like                     55.5    3e-06   Tarenaya hassleriana [spider flower]
gb|AAA60333.1|  hexokinase                                            55.1    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008387327.1|  PREDICTED: hexokinase-1-like                     55.5    3e-06   
pdb|4QS7|A  Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure ...  55.5    3e-06   Arabidopsis thaliana [mouse-ear cress]
pdb|4QS9|A  Chain A, Arabidopsis Hexokinase 1 (athxk1) Mutant S17...  55.5    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194642.1|  hexokinase 1                                        55.5    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007152969.1|  hypothetical protein PHAVU_004G175500g           55.1    3e-06   Phaseolus vulgaris [French bean]
ref|XP_009803252.1|  PREDICTED: hexokinase-1                          54.7    5e-06   Nicotiana sylvestris
ref|XP_009606563.1|  PREDICTED: hexokinase-1                          54.7    5e-06   Nicotiana tomentosiformis
gb|AAP40021.1|  hexokinase                                            54.7    6e-06   Nicotiana benthamiana
ref|XP_009406171.1|  PREDICTED: hexokinase-2-like                     54.3    6e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004961448.1|  PREDICTED: hexokinase-5-like                     54.3    6e-06   Setaria italica
gb|EYU21451.1|  hypothetical protein MIMGU_mgv1a005070mg              54.3    7e-06   Erythranthe guttata [common monkey flower]
dbj|BAJ93240.1|  predicted protein                                    54.3    8e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010447886.1|  PREDICTED: hexokinase-1                          53.9    9e-06   
ref|XP_010438337.1|  PREDICTED: hexokinase-1-like                     53.9    9e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010433133.1|  PREDICTED: hexokinase-1-like                     53.9    9e-06   Camelina sativa [gold-of-pleasure]
gb|ABI18156.1|  hexokinase                                            53.9    9e-06   Helianthus annuus
sp|Q9SEK2.1|HXK1_TOBAC  RecName: Full=Hexokinase-1; AltName: Full...  53.9    1e-05   Nicotiana tabacum [American tobacco]
gb|EMS60419.1|  Hexokinase-9                                          53.5    1e-05   Triticum urartu
gb|EMS52197.1|  Hexokinase-8                                          53.5    1e-05   Triticum urartu
ref|XP_003568072.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-5...  53.5    1e-05   
ref|XP_010915379.1|  PREDICTED: hexokinase-2-like                     53.5    1e-05   Elaeis guineensis
ref|XP_006643859.1|  PREDICTED: hexokinase-8-like                     53.1    2e-05   Oryza brachyantha
gb|AHY84731.1|  hexokinase                                            53.1    2e-05   Manihot esculenta [manioc]
ref|NP_001044214.1|  Os01g0742500                                     53.1    2e-05   
ref|XP_006285258.1|  hypothetical protein CARUB_v10006629mg           53.1    2e-05   Capsella rubella
gb|EAZ13494.1|  hypothetical protein OsJ_03410                        52.8    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009392524.1|  PREDICTED: hexokinase-2-like                     53.1    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004510315.1|  PREDICTED: hexokinase-1-like                     52.8    2e-05   Cicer arietinum [garbanzo]
gb|EMT07302.1|  Hexokinase-2                                          52.4    3e-05   
ref|NP_001056137.1|  Os05g0532600                                     50.1    3e-05   
dbj|BAJ89593.1|  predicted protein                                    52.4    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEB00838.1|  hexokinase 2                                          52.0    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008672063.1|  PREDICTED: uncharacterized protein LOC100192...  52.4    3e-05   Zea mays [maize]
ref|XP_003567061.1|  PREDICTED: hexokinase-9-like isoform X1          52.4    3e-05   Brachypodium distachyon [annual false brome]
gb|ACG43712.1|  hexokinase-1                                          52.0    3e-05   Zea mays [maize]
ref|NP_001130970.1|  uncharacterized protein LOC100192075             52.0    3e-05   Zea mays [maize]
ref|XP_010232254.1|  PREDICTED: hexokinase-9-like isoform X2          52.0    4e-05   
dbj|BAP47497.1|  hexokinase                                           52.0    4e-05   Gentiana triflora
ref|XP_006646274.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-9...  52.0    4e-05   
ref|XP_010231125.1|  PREDICTED: hexokinase-2 isoform X2               51.6    4e-05   
ref|XP_003568034.1|  PREDICTED: hexokinase-2 isoform X1               52.0    4e-05   Brachypodium distachyon [annual false brome]
ref|XP_009405075.1|  PREDICTED: hexokinase-2-like                     52.0    4e-05   
gb|KJB35041.1|  hypothetical protein B456_006G096800                  51.6    5e-05   Gossypium raimondii
emb|CDO97969.1|  unnamed protein product                              51.6    5e-05   Coffea canephora [robusta coffee]
gb|AFW78822.1|  hexokinase-2                                          51.6    5e-05   
gb|EEC70091.1|  hypothetical protein OsI_00720                        51.6    5e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_006654666.1|  PREDICTED: hexokinase-5-like                     51.6    5e-05   
gb|EEE54030.1|  hypothetical protein OsJ_00699                        51.6    6e-05   Oryza sativa Japonica Group [Japonica rice]
sp|Q1WM15.2|HXK8_ORYSJ  RecName: Full=Hexokinase-8; AltName: Full...  51.6    6e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAZ93625.1|  hexokinase 8                                          51.2    6e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EMT15586.1|  Hexokinase-7                                          51.2    6e-05   
ref|XP_004969912.1|  PREDICTED: hexokinase-6-like                     51.2    6e-05   Setaria italica
ref|NP_001042264.1|  Os01g0190400                                     51.2    6e-05   
gb|KCW79125.1|  hypothetical protein EUGRSUZ_C005692                  48.5    6e-05   Eucalyptus grandis [rose gum]
ref|XP_011072439.1|  PREDICTED: hexokinase-1-like                     51.2    7e-05   Sesamum indicum [beniseed]
ref|NP_001233957.1|  hexokinase                                       51.2    7e-05   Solanum lycopersicum
ref|XP_010489125.1|  PREDICTED: hexokinase-2-like                     51.2    7e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008675068.1|  PREDICTED: hexokinase-6                          51.2    8e-05   Zea mays [maize]
gb|EMS52462.1|  Hexokinase-2                                          50.8    8e-05   Triticum urartu
ref|NP_001056082.1|  Os05g0522500                                     50.8    9e-05   
gb|EMT08969.1|  Hexokinase-5                                          50.8    9e-05   
gb|EMS55979.1|  Hexokinase-5                                          50.8    9e-05   Triticum urartu
sp|O64390.1|HXK1_SOLTU  RecName: Full=Hexokinase-1; AltName: Full...  50.8    9e-05   Solanum tuberosum [potatoes]
gb|EAY98739.1|  hypothetical protein OsI_20669                        50.8    9e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_006299465.1|  hypothetical protein CARUB_v10015630mg           50.4    1e-04   Capsella rubella
sp|Q2KNB9.1|HXK2_ORYSJ  RecName: Full=Hexokinase-2; AltName: Full...  50.4    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009415191.1|  PREDICTED: hexokinase-2-like                     50.4    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS70676.1|  hexokinase 1a                                         50.4    1e-04   Genlisea aurea
ref|XP_010416617.1|  PREDICTED: hexokinase-2-like                     50.4    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_006343033.1|  PREDICTED: hexokinase-1-like                     50.4    1e-04   
gb|ACG44289.1|  hexokinase-2                                          50.4    1e-04   Zea mays [maize]
gb|AAT77515.1|  hexokinase 7                                          50.4    1e-04   Nicotiana tabacum [American tobacco]
gb|EAY98804.1|  hypothetical protein OsI_20748                        50.1    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010467922.1|  PREDICTED: hexokinase-2 isoform X1               50.1    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010467923.1|  PREDICTED: hexokinase-2 isoform X2               50.1    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_004968460.1|  PREDICTED: hexokinase-8-like                     50.1    2e-04   Setaria italica
gb|KHN39258.1|  Hexokinase-1                                          49.7    2e-04   Glycine soja [wild soybean]
gb|AFU82542.1|  hexokinase                                            48.5    2e-04   Artemisia tridentata [big sagebrush]
gb|EYU45835.1|  hypothetical protein MIMGU_mgv1a005054mg              50.1    2e-04   Erythranthe guttata [common monkey flower]
gb|KDP40854.1|  hypothetical protein JCGZ_24853                       50.1    2e-04   Jatropha curcas
ref|NP_001123599.1|  hexokinase2                                      49.7    2e-04   Zea mays [maize]
gb|ACG47843.1|  hexokinase-1                                          49.7    2e-04   Zea mays [maize]
ref|XP_006646311.1|  PREDICTED: hexokinase-6-like                     49.7    2e-04   
ref|XP_003569773.1|  PREDICTED: hexokinase-6                          49.7    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_009622660.1|  PREDICTED: hexokinase-2                          49.3    3e-04   Nicotiana tomentosiformis
gb|AAS60194.1|  hexokinase 3                                          49.3    3e-04   Nicotiana tabacum [American tobacco]
ref|XP_009777315.1|  PREDICTED: hexokinase-2                          49.3    3e-04   Nicotiana sylvestris
ref|XP_002440104.1|  hypothetical protein SORBIDRAFT_09g026080        49.3    3e-04   Sorghum bicolor [broomcorn]
gb|ACN35115.1|  unknown                                               49.3    3e-04   Zea mays [maize]
gb|EAY75659.1|  hypothetical protein OsI_03566                        49.3    3e-04   Oryza sativa Indica Group [Indian rice]
sp|Q2KNB7.1|HXK9_ORYSJ  RecName: Full=Hexokinase-9; AltName: Full...  49.3    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105529.1|  LOC542510                                        49.3    3e-04   
gb|AFW82530.1|  hexokinase                                            49.3    3e-04   
gb|AHY84734.1|  hexokinase                                            49.3    3e-04   Manihot esculenta [manioc]
ref|XP_002455027.1|  hypothetical protein SORBIDRAFT_03g003190        49.3    3e-04   Sorghum bicolor [broomcorn]
gb|AAO24584.1|  At2g19860                                             48.9    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179576.1|  hexokinase 2                                        48.9    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077921.1|  hexokinase 2                                     48.9    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886018.1|  ATHXK2                                           48.9    3e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_004972151.1|  PREDICTED: hexokinase-9-like                     47.0    4e-04   
ref|XP_009394175.1|  PREDICTED: hexokinase-2-like                     48.5    5e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001754148.1|  hexokinase protein HXK7                          48.1    6e-04   
ref|XP_002299739.1|  hypothetical protein POPTR_0001s19130g           48.1    7e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011000949.1|  PREDICTED: hexokinase-1-like                     48.1    7e-04   Populus euphratica
ref|XP_002515958.1|  hexokinase, putative                             48.1    7e-04   Ricinus communis
ref|XP_002458467.1|  hypothetical protein SORBIDRAFT_03g034230        48.1    7e-04   Sorghum bicolor [broomcorn]
gb|EMT13168.1|  Hexokinase-8                                          47.8    8e-04   



>ref|XP_011093636.1| PREDICTED: hexokinase-1 [Sesamum indicum]
Length=496

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR CMESTLKELLG+ +E +V+EHSNDGSGIGAALLAA+HSQYLE D S
Sbjct  447  KFRKCMESTLKELLGDVAEDIVVEHSNDGSGIGAALLAASHSQYLEIDNS  496



>gb|AFO84084.1| hexokinase [Actinidia deliciosa]
Length=497

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+ MESTLKELLGEAS+++VIEHSNDGSG+GAALLAA+HSQYLE ++S
Sbjct  448  KFREAMESTLKELLGEASDTIVIEHSNDGSGVGAALLAASHSQYLEVEDS  497



>gb|AFO84083.1| hexokinase [Actinidia chinensis]
Length=497

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+ MESTLKELLG+ASE++VIEHSNDGSGIGAALLAA+HS YLE +ES
Sbjct  448  KFRNSMESTLKELLGKASETIVIEHSNDGSGIGAALLAASHSLYLEVEES  497



>gb|KDP33801.1| hypothetical protein JCGZ_07372 [Jatropha curcas]
Length=498

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR CMESTLKELLGE  SES+VIEHSNDGSGIGAALLAA+HSQYL+  ES
Sbjct  448  KFRVCMESTLKELLGEEVSESIVIEHSNDGSGIGAALLAASHSQYLDVAES  498



>sp|Q9SEK3.1|HXK1_SPIOL RecName: Full=Hexokinase-1; AltName: Full=SoHxK1 [Spinacia oleracea]
 gb|AAF18584.1|AF118132_1 chloroplast outer envelope hexokinase 1 [Spinacia oleracea]
Length=498

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 47/51 (92%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+CME +LKELLG E +E++VIEHSNDGSGIGAALLAA+HSQYLE DES
Sbjct  448  KFRECMEDSLKELLGDEVAETIVIEHSNDGSGIGAALLAASHSQYLEEDES  498



>emb|CDP03252.1| unnamed protein product [Coffea canephora]
Length=219

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+CM+STL+ELLG+A E++ I HSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  170  KFRNCMDSTLQELLGDAYENVSIIHSNDGSGIGAALLAASHSQYLEVEES  219



>ref|XP_007160283.1| hypothetical protein PHAVU_002G308400g [Phaseolus vulgaris]
 gb|ESW32277.1| hypothetical protein PHAVU_002G308400g [Phaseolus vulgaris]
Length=498

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 48/51 (94%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+C+ESTLKELLGE A+E++VIEH+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  448  KFRECLESTLKELLGEEAAETIVIEHANDGSGIGAALLAASHSQYLGVEES  498



>ref|XP_010267128.1| PREDICTED: hexokinase-1-like [Nelumbo nucifera]
Length=500

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 48/50 (96%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR+C+E+TLKELLGE ASES+V+EHSNDGSGIGAALLAA+HSQYLE ++S
Sbjct  451  FRNCLENTLKELLGEEASESVVVEHSNDGSGIGAALLAASHSQYLEVEDS  500



>gb|KDO66585.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
 gb|KDO66586.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=284

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KF  CM+ST+KELLGE  SE++VIEHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  234  KFSACMQSTVKELLGEEVSETVVIEHSNDGSGIGAALLAASHSQYLEVEES  284



>gb|AHB32106.1| hexokinase [Camellia sinensis]
Length=495

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            KFR+ ME TLKELLGEAS ++VIEHSNDGSGIGAALLAA+HSQYLE
Sbjct  448  KFRNAMEGTLKELLGEASGTIVIEHSNDGSGIGAALLAASHSQYLE  493



>gb|AHD25654.1| hexokinase 1 (chloroplast) [Camellia sinensis]
Length=495

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            KFR+ ME TLKELLGEAS ++VIEHSNDGSGIGAALLAA+HSQYLE
Sbjct  448  KFRNAMEGTLKELLGEASGTIVIEHSNDGSGIGAALLAASHSQYLE  493



>gb|AAS60195.1| hexokinase 4a [Nicotiana tabacum]
Length=498

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+CME T+KELLG+A+ES+VIE SNDGSGIGAALLAA+HSQYL  +ES
Sbjct  449  KFRNCMEGTIKELLGDAAESIVIELSNDGSGIGAALLAASHSQYLGLEES  498



>gb|KHN41674.1| Hexokinase-1 [Glycine soja]
Length=437

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 47/51 (92%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+C+E TLKELLG EA+E++VIEH+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  387  KFRECLEGTLKELLGDEAAETIVIEHANDGSGIGAALLAASHSQYLGVEES  437



>gb|KDO66584.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=363

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KF  CM+ST+KELLGE  SE++VIEHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  313  KFSACMQSTVKELLGEEVSETVVIEHSNDGSGIGAALLAASHSQYLEVEES  363



>ref|XP_003525287.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=498

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 47/51 (92%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+C+E TLKELLG EA+E++VIEH+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  448  KFRECLEGTLKELLGDEAAETIVIEHANDGSGIGAALLAASHSQYLGVEES  498



>emb|CDP03250.1| unnamed protein product [Coffea canephora]
Length=497

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+CM+STL+ELLG+A E++ I HSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  448  KFRNCMDSTLQELLGDAYENVSIIHSNDGSGIGAALLAASHSQYLEVEES  497



>gb|KDO66582.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=465

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KF  CM+ST+KELLGE  SE++VIEHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  415  KFSACMQSTVKELLGEEVSETVVIEHSNDGSGIGAALLAASHSQYLEVEES  465



>ref|XP_003530493.1| PREDICTED: hexokinase-1-like [Glycine max]
 gb|KHN16646.1| Hexokinase-1 [Glycine soja]
Length=498

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 47/51 (92%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+C+ES LKELLG EA+E++VIEH+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  448  KFRECLESALKELLGDEAAETIVIEHANDGSGIGAALLAASHSQYLGVEES  498



>ref|NP_001275786.1| hexokinase [Citrus sinensis]
 ref|XP_006451310.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|AAG28503.1|AF196966_1 hexokinase [Citrus sinensis]
 gb|ESR64550.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|KDO66583.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=498

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KF  CM+ST+KELLGE  SE++VIEHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  448  KFSACMQSTVKELLGEEVSETVVIEHSNDGSGIGAALLAASHSQYLEVEES  498



>ref|XP_009601881.1| PREDICTED: hexokinase-2-like [Nicotiana tomentosiformis]
Length=498

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+CME T+KELLG+A+ES+VIE SNDGSG+GAALLAA+HSQYL  +ES
Sbjct  449  KFRNCMEGTIKELLGDAAESIVIELSNDGSGVGAALLAASHSQYLGLEES  498



>ref|XP_007013022.1| Hexokinase 2 isoform 3 [Theobroma cacao]
 gb|EOY30641.1| Hexokinase 2 isoform 3 [Theobroma cacao]
Length=437

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR CME+TL ELLG E S+++VIEHSNDGSGIGA LLAA HSQY+E +ES
Sbjct  387  KFRTCMENTLTELLGDEVSDNIVIEHSNDGSGIGATLLAACHSQYIEVEES  437



>gb|EYU27268.1| hypothetical protein MIMGU_mgv1a019208mg [Erythranthe guttata]
Length=489

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 46/50 (92%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGEA-SESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR+CM+STLKELLGEA S+ +++EHSNDGSGIGAAL+AA+HSQYL  +ES
Sbjct  440  FRNCMKSTLKELLGEAASDRVILEHSNDGSGIGAALIAASHSQYLPVEES  489



>ref|XP_007215785.1| hypothetical protein PRUPE_ppa009797mg [Prunus persica]
 gb|EMJ16984.1| hypothetical protein PRUPE_ppa009797mg [Prunus persica]
Length=277

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +  CME+TL+ELLGE  SES+VIEHSNDGSGIGAALLAA+HSQYL  DES
Sbjct  228  YSKCMENTLRELLGEEVSESIVIEHSNDGSGIGAALLAASHSQYLGVDES  277



>gb|KJB83117.1| hypothetical protein B456_013G230400 [Gossypium raimondii]
Length=498

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR CME+TL ELLGE  SE+++IEHSNDGSGIGAALLAA+HSQY+  DES
Sbjct  448  KFRTCMENTLTELLGEEVSENIIIEHSNDGSGIGAALLAASHSQYIGIDES  498



>ref|XP_007013021.1| Hexokinase 1 isoform 2 [Theobroma cacao]
 gb|EOY30640.1| Hexokinase 1 isoform 2 [Theobroma cacao]
Length=498

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR CME+TL ELLG E S+++VIEHSNDGSGIGA LLAA HSQY+E +ES
Sbjct  448  KFRTCMENTLTELLGDEVSDNIVIEHSNDGSGIGATLLAACHSQYIEVEES  498



>ref|XP_007013020.1| Hexokinase 1 isoform 1 [Theobroma cacao]
 gb|EOY30639.1| Hexokinase 1 isoform 1 [Theobroma cacao]
Length=521

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR CME+TL ELLG E S+++VIEHSNDGSGIGA LLAA HSQY+E +ES
Sbjct  471  KFRTCMENTLTELLGDEVSDNIVIEHSNDGSGIGATLLAACHSQYIEVEES  521



>gb|KHG22031.1| Hexokinase-1 [Gossypium arboreum]
Length=529

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR CME+TL ELLGE  SE+++IEHSNDGSGIGAALLAA+HSQY+  DES
Sbjct  479  KFRTCMENTLTELLGEEVSENIIIEHSNDGSGIGAALLAASHSQYIGIDES  529



>ref|XP_010688341.1| PREDICTED: hexokinase-1 [Beta vulgaris subsp. vulgaris]
Length=498

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 47/51 (92%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+CME +LKELLG E ++++V+EHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  448  KFRECMEDSLKELLGDEIADTIVVEHSNDGSGIGAALLAASHSQYLEEEES  498



>gb|KEH21332.1| hexokinase [Medicago truncatula]
Length=363

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR C+E TLKELLG EA+E++V+EH+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  313  KFRVCLEDTLKELLGDEAAETVVVEHANDGSGIGAALLAASHSQYLGVEES  363



>ref|XP_007024321.1| Hexokinase 2 [Theobroma cacao]
 gb|EOY26943.1| Hexokinase 2 [Theobroma cacao]
Length=498

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR C+E+TL ELLGE  SES+V+EHSNDGSGIGAALLAA+HSQY+E +ES
Sbjct  449  FRKCLENTLSELLGEEVSESIVVEHSNDGSGIGAALLAASHSQYVEMEES  498



>ref|XP_008228416.1| PREDICTED: hexokinase-1-like [Prunus mume]
Length=497

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +  CME+TL+ELLGE  SES+VIEHSNDGSGIGAALLAA+HSQYL  DES
Sbjct  448  YSKCMENTLRELLGEEVSESIVIEHSNDGSGIGAALLAASHSQYLGVDES  497



>gb|AET05183.2| hexokinase [Medicago truncatula]
Length=498

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR C+E TLKELLG EA+E++V+EH+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  448  KFRVCLEDTLKELLGDEAAETVVVEHANDGSGIGAALLAASHSQYLGVEES  498



>ref|XP_002325031.1| Hexokinase 1 family protein [Populus trichocarpa]
 gb|EEF03596.1| Hexokinase 1 family protein [Populus trichocarpa]
Length=498

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KF  CMESTLKELLGE  S+++V+E SNDGSGIGAALLAA+HSQYLE +ES
Sbjct  448  KFSTCMESTLKELLGEEVSDNIVVEQSNDGSGIGAALLAASHSQYLEVEES  498



>ref|XP_008387424.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=216

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +  CME+TL+ELLGE  +E++VIEHSNDGSGIGAALLAA+HSQYL  DES
Sbjct  167  YSKCMENTLRELLGEEVAETIVIEHSNDGSGIGAALLAASHSQYLGIDES  216



>emb|CBI27996.3| unnamed protein product [Vitis vinifera]
Length=436

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            FR C+ESTLKELLG E S+++VI+HSNDGSGIGAALLAA+HSQYLE D
Sbjct  388  FRTCLESTLKELLGAEVSDNIVIKHSNDGSGIGAALLAASHSQYLEED  435



>gb|AEJ95926.1| HXK1 [Vitis vinifera]
Length=470

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            FR C+ESTLKELLG E S+++VI+HSNDGSGIGAALLAA+HSQYLE D
Sbjct  422  FRTCLESTLKELLGAEVSDNIVIKHSNDGSGIGAALLAASHSQYLEED  469



>ref|XP_002283608.1| PREDICTED: hexokinase-1-like [Vitis vinifera]
Length=497

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            FR C+ESTLKELLG E S+++VI+HSNDGSGIGAALLAA+HSQYLE D
Sbjct  449  FRTCLESTLKELLGAEVSDNIVIKHSNDGSGIGAALLAASHSQYLEED  496



>emb|CAN83149.1| hypothetical protein VITISV_024177 [Vitis vinifera]
Length=498

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            FR C+ESTLKELLG E S+++VI+HSNDGSGIGAALLAA+HSQYLE D
Sbjct  450  FRTCLESTLKELLGAEVSDNIVIKHSNDGSGIGAALLAASHSQYLEED  497



>ref|XP_009795017.1| PREDICTED: hexokinase-2-like [Nicotiana sylvestris]
Length=498

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+CME T+KELLG+A+E++V++ SNDGSG+GAALLAA+HSQYL  +ES
Sbjct  449  KFRNCMEGTIKELLGDAAENIVVKLSNDGSGVGAALLAASHSQYLGLEES  498



>ref|XP_011008120.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=498

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KF  CMESTLKELLGE  S+++V+E SNDGSGIGAALLAA+HSQYL+ +ES
Sbjct  448  KFSTCMESTLKELLGEEVSDNIVVEQSNDGSGIGAALLAASHSQYLDVEES  498



>ref|XP_011014418.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=498

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KF  CMESTLKELLGE  S+++V+E SNDGSGIGAALLAA+HSQYL+ +ES
Sbjct  448  KFSTCMESTLKELLGEEVSDNIVVEQSNDGSGIGAALLAASHSQYLDVEES  498



>gb|AFK48467.1| unknown [Lotus japonicus]
Length=182

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR C+EST+KELLG+  +E++ IEHSNDGSGIGAALLAA+HSQYL  ++S
Sbjct  132  KFRTCLESTIKELLGDDGAETIGIEHSNDGSGIGAALLAASHSQYLAMEDS  182



>gb|KGN60580.1| hypothetical protein Csa_2G000870 [Cucumis sativus]
Length=154

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            KFR  ME+TLKELLG E + ++ +EHSN+GSGIGAAL AA+HSQYLE DE
Sbjct  82   KFRTTMENTLKELLGDEVAANVFVEHSNNGSGIGAALFAASHSQYLEVDE  131



>ref|XP_006353496.1| PREDICTED: hexokinase-1-like isoform X1 [Solanum tuberosum]
Length=499

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+C+E T+KELLG+ ++S+VIE SNDGSG+GAALLAA+HSQY + +ES
Sbjct  450  KFRNCLEETMKELLGDTADSIVIELSNDGSGVGAALLAASHSQYTDLEES  499



>ref|XP_009338734.1| PREDICTED: hexokinase-1-like isoform X1 [Pyrus x bretschneideri]
Length=497

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +  CME+TL+ELLGE  +E++VIEHSNDGSGIGAALLAA+HSQYL  DES
Sbjct  448  YSKCMENTLRELLGEEVAETIVIEHSNDGSGIGAALLAASHSQYLGIDES  497



>ref|XP_010049611.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
 gb|KCW82325.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=500

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KF  CMESTLKEL+GE  ++++VIEHSNDGSGIGAALLAA+HS+YL A+E 
Sbjct  450  KFSACMESTLKELIGEEVAQNIVIEHSNDGSGIGAALLAASHSEYLMAEEP  500



>ref|XP_006353497.1| PREDICTED: hexokinase-1-like isoform X2 [Solanum tuberosum]
Length=466

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+C+E T+KELLG+ ++S+VIE SNDGSG+GAALLAA+HSQY + +ES
Sbjct  417  KFRNCLEETMKELLGDTADSIVIELSNDGSGVGAALLAASHSQYTDLEES  466



>ref|XP_008458856.1| PREDICTED: hexokinase-1-like isoform X2 [Cucumis melo]
 ref|XP_008458864.1| PREDICTED: hexokinase-1-like isoform X2 [Cucumis melo]
Length=502

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR  ME+TLKELLG E + ++ +EHSNDGSGIGAALLAA+HSQYLE DE 
Sbjct  452  KFRTTMENTLKELLGDEVAANVFVEHSNDGSGIGAALLAASHSQYLEVDEP  502



>ref|XP_008458873.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458879.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458886.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458893.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458902.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458909.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458916.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458922.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458929.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458934.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458936.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458939.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
Length=498

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR  ME+TLKELLG E + ++ +EHSNDGSGIGAALLAA+HSQYLE DE 
Sbjct  448  KFRTTMENTLKELLGDEVAANVFVEHSNDGSGIGAALLAASHSQYLEVDEP  498



>gb|KHG25517.1| Hexokinase-1 -like protein [Gossypium arboreum]
Length=498

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR CME+TL ELLGE ASE++ +EHS DGSGIGAALLAA+HSQY+E +E 
Sbjct  448  KFRTCMENTLWELLGEEASENIAVEHSMDGSGIGAALLAASHSQYIEVEEP  498



>gb|KJB65034.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
 gb|KJB65035.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
 gb|KJB65036.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
Length=498

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR CME+TL ELLGE ASE++ +EHS DGSGIGAALLAA+HSQY+E +E 
Sbjct  448  KFRTCMENTLWELLGEEASENIAVEHSMDGSGIGAALLAASHSQYIEVEEP  498



>ref|XP_008458849.1| PREDICTED: hexokinase-1-like isoform X1 [Cucumis melo]
Length=583

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR  ME+TLKELLG E + ++ +EHSNDGSGIGAALLAA+HSQYLE DE 
Sbjct  533  KFRTTMENTLKELLGDEVAANVFVEHSNDGSGIGAALLAASHSQYLEVDEP  583



>ref|XP_010106711.1| hypothetical protein L484_000821 [Morus notabilis]
 gb|EXC11522.1| hypothetical protein L484_000821 [Morus notabilis]
Length=108

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR  MES LKELLGE  + +++IEHSNDGSGIGAALLAA+HSQYLE ++S
Sbjct  58   KFRAGMESALKELLGEEVAGNILIEHSNDGSGIGAALLAASHSQYLEVEDS  108



>ref|XP_004503491.1| PREDICTED: hexokinase-1-like isoform X2 [Cicer arietinum]
Length=498

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR C+E TLKELLG EA++++V++H+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  448  KFRVCLEETLKELLGDEAADTVVVKHANDGSGIGAALLAASHSQYLGVEES  498



>ref|XP_004503490.1| PREDICTED: hexokinase-1-like isoform X1 [Cicer arietinum]
Length=526

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR C+E TLKELLG EA++++V++H+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  476  KFRVCLEETLKELLGDEAADTVVVKHANDGSGIGAALLAASHSQYLGVEES  526



>ref|XP_010098150.1| hypothetical protein L484_026284 [Morus notabilis]
 gb|EXB74587.1| hypothetical protein L484_026284 [Morus notabilis]
Length=499

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +R C+ESTL EL+GE  SES+VIEHSNDGSGIGAA LAA+HSQY + +ES
Sbjct  449  YRKCLESTLTELIGEKVSESIVIEHSNDGSGIGAAFLAASHSQYPDVEES  498



>ref|XP_003630707.1| Hexokinase [Medicago truncatula]
Length=610

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 43/46 (93%), Gaps = 1/46 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  287
            KFR C+E TLKELLG EA+E++V+EH+NDGSGIGAALLAA+HSQYL
Sbjct  448  KFRVCLEDTLKELLGDEAAETVVVEHANDGSGIGAALLAASHSQYL  493



>gb|ADZ96378.1| hexokinase 1 [Eriobotrya japonica]
Length=497

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +  CME+TL+ELLGE  +E+++IEHSNDGSGIGAALLAA+HSQYL  DES
Sbjct  448  YSKCMENTLRELLGEEVAETIIIEHSNDGSGIGAALLAASHSQYLGIDES  497



>gb|KEH27216.1| hexokinase [Medicago truncatula]
Length=496

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR CMESTL+ELLG EAS ++ IEHSNDGSGIGAALLAA+ SQYL  +ES
Sbjct  446  KFRTCMESTLRELLGDEASGTIGIEHSNDGSGIGAALLAASQSQYLGVEES  496



>ref|NP_001234710.1| hexokinase [Solanum lycopersicum]
 gb|AAY60841.1| hexokinase [Solanum lycopersicum]
Length=499

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+C++ T+KELLG+A++S VIE SNDGSG+GAALLAA+HSQY + +ES
Sbjct  450  KFRNCLKETMKELLGDAADSTVIELSNDGSGVGAALLAASHSQYTDLEES  499



>ref|XP_006853711.1| hypothetical protein AMTR_s00056p00151260 [Amborella trichopoda]
 gb|ERN15178.1| hypothetical protein AMTR_s00056p00151260 [Amborella trichopoda]
Length=500

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KF DC+E TLKELLGE  +E +VI H+NDGSGIGA+LLAA+HSQY+E +ES
Sbjct  449  KFSDCLEKTLKELLGEEVAEHVVIVHANDGSGIGASLLAASHSQYVELEES  499



>ref|XP_004302852.1| PREDICTED: hexokinase-1-like [Fragaria vesca subsp. vesca]
Length=498

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +  CME+TL+ELLGE    S+VIEHSNDGSGIGAAL+AA+HSQYL+ DES
Sbjct  449  YSKCMENTLRELLGEEVGASIVIEHSNDGSGIGAALIAASHSQYLQDDES  498



>gb|KHN40378.1| Hexokinase-1 [Glycine soja]
Length=482

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR  +ESTLKELLG EA+E++ IE SNDGSGIGAALLAA+HSQYLE  ES
Sbjct  432  KFRSSLESTLKELLGDEAAETIGIEQSNDGSGIGAALLAASHSQYLEVQES  482



>ref|XP_010249484.1| PREDICTED: hexokinase-1 [Nelumbo nucifera]
Length=498

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR C+ESTLKELLGE  S ++ +EHSNDGSGIGAALLAA+HSQYLE ++S
Sbjct  449  FRVCLESTLKELLGEEVSANVSVEHSNDGSGIGAALLAASHSQYLEVEDS  498



>ref|XP_003516735.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=496

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR  +ESTLKELLG EA+E++ IE SNDGSGIGAALLAA+HSQYLE  ES
Sbjct  446  KFRSSLESTLKELLGDEAAETIGIEQSNDGSGIGAALLAASHSQYLEVQES  496



>ref|XP_008242483.1| PREDICTED: hexokinase-1 [Prunus mume]
Length=498

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR  MESTLKELLG E +E + +EHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  449  FRTSMESTLKELLGDEVAEHISVEHSNDGSGIGAALLAASHSQYLEVEES  498



>gb|KJB56835.1| hypothetical protein B456_009G137700 [Gossypium raimondii]
Length=498

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +R+C+E+TL EL+GE  S ++ IEHSNDGSGIGAALLAA+HSQYLE DES
Sbjct  449  YRECLENTLNELVGEEVSRTIEIEHSNDGSGIGAALLAASHSQYLETDES  498



>ref|XP_007203872.1| hypothetical protein PRUPE_ppa004637mg [Prunus persica]
 gb|EMJ05071.1| hypothetical protein PRUPE_ppa004637mg [Prunus persica]
Length=498

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR  MESTLKELLG E +E + +EHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  449  FRTSMESTLKELLGDEVAEHISVEHSNDGSGIGAALLAASHSQYLEVEES  498



>ref|NP_001284452.1| hexokinase-1-like [Cucumis melo]
 ref|XP_008450786.1| PREDICTED: hexokinase-1-like [Cucumis melo]
 gb|ACJ04705.1| hexokinase 2 [Cucumis melo]
Length=498

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+ +ES+LKELLGE  +++ VIEHSNDGSGIGAALLAA+HSQYL  +ES
Sbjct  448  KFRNSLESSLKELLGEQVADNFVIEHSNDGSGIGAALLAASHSQYLGVEES  498



>gb|AHG98487.1| hexokinase [Dimocarpus longan]
Length=496

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            KF  CMESTLKELLGE  +E++VIE SNDGSGIGAALLAA+HSQYLE
Sbjct  448  KFSSCMESTLKELLGEEVAENIVIELSNDGSGIGAALLAASHSQYLE  494



>gb|ACJ04704.1| hexokinase 1 [Cucumis melo]
Length=498

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR  ME+TLKELLG E + ++ +EHSNDGSGIGAALLAA+HSQYLE DE 
Sbjct  449  FRTTMENTLKELLGDEVAANVFVEHSNDGSGIGAALLAASHSQYLEVDEP  498



>ref|XP_004141023.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 ref|XP_004157890.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 gb|KGN60576.1| hypothetical protein Csa_2G000830 [Cucumis sativus]
Length=498

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR  ME+TLKELLG E + ++ +EHSNDGSGIGAALLAA+HSQYLE +E 
Sbjct  448  KFRTTMENTLKELLGDEVAANVFVEHSNDGSGIGAALLAASHSQYLEVEEP  498



>ref|XP_004135675.1| PREDICTED: hexokinase-2-like [Cucumis sativus]
 ref|XP_004157285.1| PREDICTED: hexokinase-2-like [Cucumis sativus]
 gb|KGN66181.1| hypothetical protein Csa_1G574970 [Cucumis sativus]
Length=498

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+ +ES+LKELLG + +++ VIEHSNDGSGIGAALLAA+HSQYL  +ES
Sbjct  448  KFRNSLESSLKELLGDQVADNFVIEHSNDGSGIGAALLAASHSQYLGVEES  498



>ref|XP_008795834.1| PREDICTED: hexokinase-2-like isoform X1 [Phoenix dactylifera]
Length=526

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 47/51 (92%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +FR+C+E+TL+E+LGE A+ S+VI+ ++DGSGIGAALLAA+HSQYLE +ES
Sbjct  476  RFRNCLETTLREMLGEEAAPSIVIKLASDGSGIGAALLAASHSQYLELEES  526



>gb|AAS60196.1| hexokinase 4b [Nicotiana tabacum]
Length=498

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+CME T+KELLG+A+E++V++ S DGSG+GAALLAA+HSQYL   ES
Sbjct  449  KFRNCMEGTIKELLGDAAENIVVKLSYDGSGVGAALLAASHSQYLGLKES  498



>ref|NP_001280783.1| uncharacterized protein LOC103443741 [Malus domestica]
 gb|AFU56883.1| hexokinase [Malus domestica]
Length=497

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +  CME+TL+ELLGE  +E++VIEHSNDGSGIGAALLAA+HSQY   DES
Sbjct  448  YSKCMENTLRELLGEEVAETVVIEHSNDGSGIGAALLAASHSQYPGIDES  497



>gb|KFK40349.1| hypothetical protein AALP_AA3G362600 [Arabis alpina]
Length=500

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            +F +CMES LKELLG EASES+ + HSNDGSG+GAALLAA+HSQYLE D
Sbjct  448  QFSECMESALKELLGDEASESVEVIHSNDGSGVGAALLAASHSQYLEED  496



>gb|AIX02984.1| hexokinase [Morella rubra]
Length=497

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR CM+STL ELLGE  + ++V+EHSNDGSGIGAALLAA+HSQY   +ES
Sbjct  447  KFRTCMKSTLNELLGEEVAGNIVVEHSNDGSGIGAALLAASHSQYAGVEES  497



>ref|XP_008795842.1| PREDICTED: hexokinase-2-like isoform X2 [Phoenix dactylifera]
Length=500

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 47/51 (92%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +FR+C+E+TL+E+LGE A+ S+VI+ ++DGSGIGAALLAA+HSQYLE +ES
Sbjct  450  RFRNCLETTLREMLGEEAAPSIVIKLASDGSGIGAALLAASHSQYLELEES  500



>gb|AAS60197.1| hexokinase 5 [Nicotiana tabacum]
Length=499

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR+C+E T+KELLG+ ++S+VIE SNDGSG+GAALLAA+ SQY + +ES
Sbjct  450  KFRNCLEETMKELLGDTADSIVIELSNDGSGVGAALLAASPSQYTDLEES  499



>gb|AAL60583.1|AF454961_1 hexokinase [Brassica oleracea]
Length=499

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +F +CMES+LKELLG EASES+ + HSNDGSG+GAALLAA+HSQYLE  E+
Sbjct  448  QFSECMESSLKELLGDEASESVEVIHSNDGSGVGAALLAASHSQYLEDSET  498



>emb|CDY03331.1| BnaC09g10170D [Brassica napus]
Length=499

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +F +CMES+LKELLG EASES+ + HSNDGSG+GAALLAA+HSQYLE  E+
Sbjct  448  QFSECMESSLKELLGDEASESVEVIHSNDGSGVGAALLAASHSQYLEDSET  498



>ref|XP_006408903.1| hypothetical protein EUTSA_v10001968mg [Eutrema salsugineum]
 gb|ESQ50356.1| hypothetical protein EUTSA_v10001968mg [Eutrema salsugineum]
Length=499

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +F +CMES+LKELLG EASES+ + HSNDGSG+GAALLAA+HSQYLE  E+
Sbjct  448  QFSECMESSLKELLGDEASESVEVIHSNDGSGVGAALLAASHSQYLEDSET  498



>gb|AID50967.1| hexokinase 1 [Malus domestica]
Length=498

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR  ME TLKELLG E +E + +EHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  449  FRTSMECTLKELLGDEVAEHISVEHSNDGSGIGAALLAASHSQYLEVEES  498



>ref|XP_008337603.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=498

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR  ME TLKELLG E +E + +EHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  449  FRTSMECTLKELLGDEVAEHISVEHSNDGSGIGAALLAASHSQYLEVEES  498



>ref|XP_002514221.1| hexokinase, putative [Ricinus communis]
 gb|EEF48175.1| hexokinase, putative [Ricinus communis]
Length=498

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            KFR C+EST++ELLG E SE++V+EHSNDGSGIGAALLAA+HS Y E  E
Sbjct  448  KFRVCLESTIEELLGKEVSENIVVEHSNDGSGIGAALLAASHSLYREVAE  497



>gb|KFK29465.1| hypothetical protein AALP_AA7G137600 [Arabis alpina]
Length=498

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +F +CMES+LKELLG EAS S+ + HSNDGSGIGAALLAA+HSQYLE ++S
Sbjct  448  QFSECMESSLKELLGDEASGSIEVIHSNDGSGIGAALLAASHSQYLELEDS  498



>ref|XP_002283574.1| PREDICTED: hexokinase-2 [Vitis vinifera]
Length=498

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            ++  C+E+TL+EL+GE  SESL IEH+NDGSGIGAALLAA+HSQY+  +ES
Sbjct  448  EYSKCLENTLRELVGEQVSESLFIEHANDGSGIGAALLAASHSQYIGVEES  498



>ref|XP_007135629.1| hypothetical protein PHAVU_010G144900g [Phaseolus vulgaris]
 gb|ESW07623.1| hypothetical protein PHAVU_010G144900g [Phaseolus vulgaris]
Length=495

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEA  281
            ++  C+E+T+KEL+G+  SES++IEHSNDGSGIGAALLAA+HSQYL+A
Sbjct  448  EYSKCLENTVKELVGDDVSESIIIEHSNDGSGIGAALLAASHSQYLDA  495



>gb|KHN27811.1| Hexokinase-1 [Glycine soja]
Length=433

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR  +ESTLKELLG EA E++ IEHSNDGSGIGAALLAA++SQYL   ES
Sbjct  383  KFRSSLESTLKELLGDEADETVGIEHSNDGSGIGAALLAASNSQYLGVQES  433



>gb|KHN40379.1| Hexokinase-2 [Glycine soja]
Length=503

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR  +ESTLKELLG EA+E + IE SNDGSGIGAALLAA+HSQYL   ES
Sbjct  453  KFRSSLESTLKELLGDEAAEMIGIEQSNDGSGIGAALLAASHSQYLGVPES  503



>ref|XP_003516783.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=496

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR  +ESTLKELLG EA+E + IE SNDGSGIGAALLAA+HSQYL   ES
Sbjct  446  KFRSSLESTLKELLGDEAAEMIGIEQSNDGSGIGAALLAASHSQYLGVPES  496



>ref|XP_003529000.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=498

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR  +ESTLKELLG EA E++ IEHSNDGSGIGAALLAA++SQYL   ES
Sbjct  448  KFRSSLESTLKELLGDEADETVGIEHSNDGSGIGAALLAASNSQYLGVQES  498



>gb|KJB70380.1| hypothetical protein B456_011G070700 [Gossypium raimondii]
Length=497

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            +R+C+E+TL ELLG E SE++V+E +NDGSGIGAA+LAA HS+YLE DE
Sbjct  449  YRNCLENTLNELLGKEVSETVVLELANDGSGIGAAILAACHSKYLETDE  497



>ref|XP_010047252.1| PREDICTED: hexokinase-2-like [Eucalyptus grandis]
 gb|KCW79118.1| hypothetical protein EUGRSUZ_C00559 [Eucalyptus grandis]
Length=508

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            KFR+C+E+TL+ELLG E +E+ VI  SNDGSGIGAALLAA+HSQYLE
Sbjct  460  KFRNCVEATLRELLGPEVAENTVIVLSNDGSGIGAALLAASHSQYLE  506



>emb|CDY48733.1| BnaA09g10080D [Brassica napus]
Length=499

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +F +CMES+LKELLG EAS S+ + HSNDGSG+GAALLAA+HSQYLE  E+
Sbjct  448  QFSECMESSLKELLGDEASGSVEVIHSNDGSGVGAALLAASHSQYLEDSET  498



>ref|XP_008778615.1| PREDICTED: hexokinase-2-like isoform X2 [Phoenix dactylifera]
Length=303

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            F +C+E+TL+E++GE A+ S+VI+ + DGSGIGA+LLAA+HSQYLE DES
Sbjct  254  FSNCLETTLREMIGEEAAASIVIKLATDGSGIGASLLAASHSQYLELDES  303



>gb|AIB55755.1| hexokinase, partial (chloroplast), partial (chloroplast) [Brassica 
rapa]
Length=203

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +F +CMES+LKELLG EAS S+ + HSNDGSG+GAALLAA+HSQYL+
Sbjct  151  QFSECMESSLKELLGDEASGSVEVIHSNDGSGVGAALLAASHSQYLD  197



>ref|XP_002867423.1| ATHXK1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43682.1| ATHXK1 [Arabidopsis lyrata subsp. lyrata]
Length=496

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +F DCMES+LKELLG EAS S+ + HSNDGSGIGAALLAA+HS YLE
Sbjct  448  QFSDCMESSLKELLGDEASGSIEVTHSNDGSGIGAALLAASHSLYLE  494



>ref|XP_003533038.1| PREDICTED: hexokinase-1-like isoform X1 [Glycine max]
 gb|KHN05328.1| Hexokinase-1 [Glycine soja]
Length=492

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEA  281
            +  C+E+TLKEL+GE  SES++IEH NDGSG+GAALLAA+HSQYL+A
Sbjct  446  YSKCLENTLKELVGEDISESIIIEHFNDGSGVGAALLAASHSQYLDA  492



>ref|XP_008789199.1| PREDICTED: hexokinase-2-like [Phoenix dactylifera]
Length=493

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -2

Query  418  FRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            F +C++ TL+ELLGEAS+S+VI+ +NDGSGIGAALLAA+HSQY E
Sbjct  444  FSECLDGTLRELLGEASQSVVIKLANDGSGIGAALLAASHSQYKE  488



>gb|KHG28915.1| Hexokinase-1 [Gossypium arboreum]
Length=497

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            +R+C+E+TL EL+G E SE++V+E +NDGSGIGAA+LAA HS+YLE DE
Sbjct  449  YRNCLENTLNELVGKEVSETVVLELANDGSGIGAAILAACHSKYLETDE  497



>ref|XP_010665886.1| PREDICTED: hexokinase-1-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=448

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR C+E TLKELLG+   E + IEH+NDGSGIGAALLAA+HS+YLE +E+
Sbjct  385  FRKCLEHTLKELLGDKVWERISIEHANDGSGIGAALLAASHSRYLEDNET  434



>ref|XP_008778614.1| PREDICTED: hexokinase-2-like isoform X1 [Phoenix dactylifera]
Length=366

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            F +C+E+TL+E++GE A+ S+VI+ + DGSGIGA+LLAA+HSQYLE DES
Sbjct  317  FSNCLETTLREMIGEEAAASIVIKLATDGSGIGASLLAASHSQYLELDES  366



>emb|CBI36049.3| unnamed protein product [Vitis vinifera]
Length=448

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYL  287
            ++  C+E+TL+EL+GE  SESL IEH+NDGSGIGAALLAA+HSQY+
Sbjct  387  EYSKCLENTLRELVGEQVSESLFIEHANDGSGIGAALLAASHSQYI  432



>ref|XP_004513053.1| PREDICTED: hexokinase-1-like [Cicer arietinum]
Length=499

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR CMESTLKELLG E ++++ IEHSNDGSGIGAALLAAA S+Y   +ES
Sbjct  449  KFRSCMESTLKELLGDEVAKTIGIEHSNDGSGIGAALLAAAQSKYSGGEES  499



>ref|XP_010665885.1| PREDICTED: hexokinase-1-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=513

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR C+E TLKELLG+   E + IEH+NDGSGIGAALLAA+HS+YLE +E+
Sbjct  450  FRKCLEHTLKELLGDKVWERISIEHANDGSGIGAALLAASHSRYLEDNET  499



>ref|XP_009352555.1| PREDICTED: hexokinase-1 [Pyrus x bretschneideri]
Length=498

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR  ME TLKELLG E +E + +EHSNDGSGIGAALLAA+HSQY E +ES
Sbjct  449  FRTSMECTLKELLGDEVAEHISVEHSNDGSGIGAALLAASHSQYHEVEES  498



>ref|XP_009112637.1| PREDICTED: hexokinase-1-like [Brassica rapa]
Length=499

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +F +CMES+LKELLG EAS S+ + HSNDGSG+GAALLAA+HSQYL+  E+
Sbjct  448  QFSECMESSLKELLGDEASGSVEVIHSNDGSGVGAALLAASHSQYLQDSET  498



>gb|AAL60584.1|AF454962_1 hexokinase [Brassica oleracea]
 emb|CDX82746.1| BnaC07g01200D [Brassica napus]
Length=499

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +F +CMES+LKELLG EAS+S+ + HSNDGSG+GAALLAA+HSQYL+
Sbjct  448  QFSECMESSLKELLGDEASDSVEVIHSNDGSGVGAALLAASHSQYLD  494



>ref|XP_010924444.1| PREDICTED: hexokinase-2-like isoform X2 [Elaeis guineensis]
Length=500

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            F +C+E+TL+E+LGE A+ S+VI+ ++DGSGIGAALLAA+HSQYLE +ES
Sbjct  451  FSNCLETTLREMLGEEATASIVIKLASDGSGIGAALLAASHSQYLELEES  500



>ref|XP_010924442.1| PREDICTED: hexokinase-2-like isoform X1 [Elaeis guineensis]
Length=526

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            F +C+E+TL+E+LGE A+ S+VI+ ++DGSGIGAALLAA+HSQYLE +ES
Sbjct  477  FSNCLETTLREMLGEEATASIVIKLASDGSGIGAALLAASHSQYLELEES  526



>ref|XP_010915190.1| PREDICTED: hexokinase-2-like [Elaeis guineensis]
Length=500

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            F +C+E+TLKE++GE A+ S+VI+ + DGSGIGAALLAA+HSQYLE +ES
Sbjct  451  FSNCLETTLKEMIGEEAAASIVIKLATDGSGIGAALLAASHSQYLELEES  500



>gb|KCW79624.1| hypothetical protein EUGRSUZ_C00983 [Eucalyptus grandis]
Length=456

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  287
            KFR+C+E+TL+ELLG E +ES +I  SNDGSGIGAALLAA+HSQYL
Sbjct  408  KFRNCVEATLRELLGPEVAESTLIVLSNDGSGIGAALLAASHSQYL  453



>ref|XP_010047667.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
Length=510

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  287
            KFR+C+E+TL+ELLG E +ES +I  SNDGSGIGAALLAA+HSQYL
Sbjct  462  KFRNCVEATLRELLGPEVAESTLIVLSNDGSGIGAALLAASHSQYL  507



>ref|XP_010526433.1| PREDICTED: hexokinase-1 [Tarenaya hassleriana]
Length=499

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +F   MESTLKELLGE  S+++ I HSNDGSGIGAALLAA+HSQYLE ++S
Sbjct  449  QFSASMESTLKELLGEEVSDNIEIIHSNDGSGIGAALLAASHSQYLEVEDS  499



>emb|CDY35895.1| BnaA07g00920D [Brassica napus]
Length=500

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +F +CMES+LKELLG EAS S+ + HSNDGSG+GAALLAA+HSQYL+
Sbjct  448  QFSECMESSLKELLGDEASGSVEVIHSNDGSGVGAALLAASHSQYLD  494



>ref|XP_003627048.1| Hexokinase [Medicago truncatula]
 gb|AET01524.1| hexokinase [Medicago truncatula]
Length=494

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +R C+E+TLKELLGE  S+S+++EHSNDGSG GAALLAA+HS YL+
Sbjct  448  YRKCLENTLKELLGEGVSDSVIVEHSNDGSGTGAALLAASHSFYLD  493



>ref|XP_009102132.1| PREDICTED: hexokinase-1 [Brassica rapa]
Length=500

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +F +CMES+LKELLG EAS S+ + HSNDGSG+GAALLAA+HSQYL+
Sbjct  448  QFSECMESSLKELLGDEASGSVEVIHSNDGSGVGAALLAASHSQYLD  494



>ref|XP_004287480.1| PREDICTED: hexokinase-1 [Fragaria vesca subsp. vesca]
Length=498

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR CMESTL ELLG+  +E + +EHSNDGSGIGAALLAA+HS YL  ++S
Sbjct  449  FRVCMESTLDELLGDDVAEHISVEHSNDGSGIGAALLAASHSHYLGVEDS  498



>ref|XP_010540986.1| PREDICTED: hexokinase-1-like [Tarenaya hassleriana]
Length=499

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            F   MESTLKELLG E S+++ I HSNDGSGIGAALLAA+HSQYLE ++S
Sbjct  450  FSASMESTLKELLGDEVSDNIEIIHSNDGSGIGAALLAASHSQYLEVEDS  499



>gb|AAA60333.1| hexokinase [Arabidopsis thaliana]
 prf||2118367A hexokinase
Length=435

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +F +CMES+LKELLG EAS S+ + HSNDGSGIGAALLAA+HS YLE
Sbjct  387  QFSECMESSLKELLGDEASGSVEVTHSNDGSGIGAALLAASHSLYLE  433



>ref|XP_008387327.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=498

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR  ME TLKELLG E +E + IE S+DGSGIGAALLAA+HSQYLE +ES
Sbjct  449  FRTSMEXTLKELLGDEVAEXISIELSSDGSGIGAALLAASHSQYLEVEES  498



>pdb|4QS7|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure In Glucose-bound 
Form
 pdb|4QS8|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure In Ligand-free 
Form
Length=474

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +F +CMES+LKELLG EAS S+ + HSNDGSGIGAALLAA+HS YLE
Sbjct  426  QFSECMESSLKELLGDEASGSVEVTHSNDGSGIGAALLAASHSLYLE  472



>pdb|4QS9|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Mutant S177a Structure 
In Glucose- Bound Form
Length=474

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +F +CMES+LKELLG EAS S+ + HSNDGSGIGAALLAA+HS YLE
Sbjct  426  QFSECMESSLKELLGDEASGSVEVTHSNDGSGIGAALLAASHSLYLE  472



>ref|NP_194642.1| hexokinase 1 [Arabidopsis thaliana]
 sp|Q42525.2|HXK1_ARATH RecName: Full=Hexokinase-1; AltName: Full=Protein GLUCOSE INSENSITIVE 
2 [Arabidopsis thaliana]
 gb|AAB49908.1| hexokinase 1 [Arabidopsis thaliana]
 emb|CAB43927.1| hexokinase [Arabidopsis thaliana]
 emb|CAB79671.1| hexokinase [Arabidopsis thaliana]
 gb|AAL77665.1| AT4g29130/F19B15_160 [Arabidopsis thaliana]
 gb|AAM70518.1| AT4g29130/F19B15_160 [Arabidopsis thaliana]
 dbj|BAF02067.1| hexokinase [Arabidopsis thaliana]
 gb|AEE85590.1| hexokinase 1 [Arabidopsis thaliana]
Length=496

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +F +CMES+LKELLG EAS S+ + HSNDGSGIGAALLAA+HS YLE
Sbjct  448  QFSECMESSLKELLGDEASGSVEVTHSNDGSGIGAALLAASHSLYLE  494



>ref|XP_007152969.1| hypothetical protein PHAVU_004G175500g [Phaseolus vulgaris]
 gb|ESW24963.1| hypothetical protein PHAVU_004G175500g [Phaseolus vulgaris]
Length=500

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  287
            +FR  +ESTLKELLG EAS+S+ IEHSNDGSGIGAALLAA +SQYL
Sbjct  450  EFRSSLESTLKELLGDEASDSVGIEHSNDGSGIGAALLAACNSQYL  495



>ref|XP_009803252.1| PREDICTED: hexokinase-1 [Nicotiana sylvestris]
 gb|AAS60192.1| hexokinase 1a [Nicotiana tabacum]
Length=497

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            ++R C+E+TLKELLG E + S+V EHSNDGSGIGAALLAA++S YLE
Sbjct  448  EYRTCLENTLKELLGDELATSIVFEHSNDGSGIGAALLAASNSMYLE  494



>ref|XP_009606563.1| PREDICTED: hexokinase-1 [Nicotiana tomentosiformis]
Length=497

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            ++R C+E+TLKELLG E + S+V EHSNDGSGIGAALLAA++S YLE
Sbjct  448  EYRTCLENTLKELLGDELATSIVFEHSNDGSGIGAALLAASNSMYLE  494



>gb|AAP40021.1| hexokinase [Nicotiana benthamiana]
Length=497

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            ++R C+E+TLKELLG E + S+V EHSNDGSGIGAALLAA++S YLE
Sbjct  448  EYRTCLENTLKELLGDELATSIVFEHSNDGSGIGAALLAASNSMYLE  494



>ref|XP_009406171.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=500

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            F +C+ ST+KE+LGE AS S+VI+ +NDGS IGAALLAA+HSQYL+ +ES
Sbjct  451  FSECLRSTVKEMLGEEASASVVIKLANDGSSIGAALLAASHSQYLDVEES  500



>ref|XP_004961448.1| PREDICTED: hexokinase-5-like [Setaria italica]
Length=507

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            KF  C+E+TL +LLGE AS S+V + +NDGSGIGAALLAA+HSQY EAD
Sbjct  459  KFSSCVETTLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQYAEAD  507



>gb|EYU21451.1| hypothetical protein MIMGU_mgv1a005070mg [Erythranthe guttata]
Length=498

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            ++R+C+ESTL EL+GE A+ ++V+EHSNDGSGIGAALLAA++S YL+
Sbjct  451  EYRECLESTLNELIGEEAAATIVVEHSNDGSGIGAALLAASNSLYLD  497



>dbj|BAJ93240.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEB00841.1| hexokinase 5 [Hordeum vulgare subsp. vulgare]
Length=507

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            KF  C+E+TL +LLGE AS SLV + +NDGSGIGAALLAA+HSQY E D
Sbjct  459  KFSSCLEATLSDLLGEEASSSLVAKLANDGSGIGAALLAASHSQYAEVD  507



>ref|XP_010447886.1| PREDICTED: hexokinase-1 [Camelina sativa]
 ref|XP_010447887.1| PREDICTED: hexokinase-1 [Camelina sativa]
 ref|XP_010447888.1| PREDICTED: hexokinase-1 [Camelina sativa]
Length=496

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +F +CMES+LKELLG EAS ++ + HSNDGSGIGAALLAA+HS YLE
Sbjct  448  QFSECMESSLKELLGDEASGTIEVIHSNDGSGIGAALLAASHSLYLE  494



>ref|XP_010438337.1| PREDICTED: hexokinase-1-like [Camelina sativa]
Length=499

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +F +CMES+LKELLG EAS ++ + HSNDGSGIGAALLAA+HS YLE
Sbjct  451  QFSECMESSLKELLGDEASGTIEVIHSNDGSGIGAALLAASHSLYLE  497



>ref|XP_010433133.1| PREDICTED: hexokinase-1-like [Camelina sativa]
 ref|XP_010433134.1| PREDICTED: hexokinase-1-like [Camelina sativa]
Length=499

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +F +CMES+LKELLG EAS ++ + HSNDGSGIGAALLAA+HS YLE
Sbjct  451  QFSECMESSLKELLGDEASGTIEVIHSNDGSGIGAALLAASHSLYLE  497



>gb|ABI18156.1| hexokinase [Helianthus annuus]
Length=498

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR  M+ T+ ELLGE  S+++++E SNDGSG+GAALLAA+HSQYLE  ES
Sbjct  447  KFRKTMQDTMNELLGEEISKNIIVELSNDGSGLGAALLAASHSQYLEYIES  497



>sp|Q9SEK2.1|HXK1_TOBAC RecName: Full=Hexokinase-1; AltName: Full=NtHxK1 [Nicotiana tabacum]
 gb|AAF18585.1|AF118133_1 chloroplast outer envelope hexokinase 1 [Nicotiana tabacum]
Length=497

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            ++R C+E+TLKELLG E + S+V EHSNDGSGIGAALLAA++S YLE
Sbjct  448  EYRMCLENTLKELLGDELATSIVFEHSNDGSGIGAALLAASNSMYLE  494



>gb|EMS60419.1| Hexokinase-9 [Triticum urartu]
Length=364

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            F +CME TL ++LGE  + S+VI+ +NDGSG+GAALLAA +SQYL+ADE
Sbjct  314  FSECMERTLSDMLGEDLAPSVVIKPANDGSGLGAALLAANYSQYLQADE  362



>gb|EMS52197.1| Hexokinase-8 [Triticum urartu]
Length=399

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQY  290
            KF  C+E+TL ELLGE+S+ +V++H++DGSGIGAAL+AA+ SQY
Sbjct  352  KFSKCLETTLNELLGESSKFIVVKHADDGSGIGAALIAASQSQY  395



>ref|XP_003568072.1| PREDICTED: LOW QUALITY PROTEIN: hexokinase-5-like [Brachypodium 
distachyon]
Length=506

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            KF  C+E+TL +LLGE AS S+V + +NDGSGIGAALLAA+HSQY E D
Sbjct  458  KFSSCLEATLADLLGEEASSSMVAKLANDGSGIGAALLAASHSQYAEVD  506



>ref|XP_010915379.1| PREDICTED: hexokinase-2-like [Elaeis guineensis]
Length=507

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -2

Query  418  FRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            F   ++STL+ELLGEAS S+VI+ +NDGSGIGAALL A+HSQY E
Sbjct  448  FSKSLDSTLRELLGEASPSVVIKLANDGSGIGAALLGASHSQYKE  492



>ref|XP_006643859.1| PREDICTED: hexokinase-8-like [Oryza brachyantha]
Length=462

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 1/44 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQ  293
            KFR+C+ESTL ELLG EAS+S+ ++H+NDGSGIGAAL+AA+ SQ
Sbjct  419  KFRECLESTLGELLGDEASKSVAVKHANDGSGIGAALIAASQSQ  462



>gb|AHY84731.1| hexokinase [Manihot esculenta]
Length=498

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIE-HSNDGSGIGaallaaAHSQYLEADES  272
            KFR  MESTLKELLGE     +I  HSNDGSGIGAALLAA+HSQYLE  E+
Sbjct  448  KFRSSMESTLKELLGEEISESIIIEHSNDGSGIGAALLAASHSQYLEVAEA  498



>ref|NP_001044214.1| Os01g0742500 [Oryza sativa Japonica Group]
 sp|Q8LQ68.1|HXK6_ORYSJ RecName: Full=Hexokinase-6; AltName: Full=Hexokinase-2 [Oryza 
sativa Japonica Group]
 dbj|BAB91930.1| putative hexokinase [Oryza sativa Japonica Group]
 gb|AAX68418.1| hexokinase 2 [Oryza sativa Japonica Group]
 gb|AAZ93623.1| hexokinase 6 [Oryza sativa Japonica Group]
 dbj|BAF06128.1| Os01g0742500 [Oryza sativa Japonica Group]
 gb|EAY75775.1| hypothetical protein OsI_03691 [Oryza sativa Indica Group]
 dbj|BAG89607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=506

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQY  290
            KFR C+E+TL +LLGE A+ S+V++ +NDGSGIGAALLAA+HSQY
Sbjct  458  KFRTCLEATLADLLGEEAASSVVVKLANDGSGIGAALLAASHSQY  502



>ref|XP_006285258.1| hypothetical protein CARUB_v10006629mg [Capsella rubella]
 gb|EOA18156.1| hypothetical protein CARUB_v10006629mg [Capsella rubella]
Length=496

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +F +CME +LKELLG EAS S+ + HSNDGSGIGAALLAA+HS YLE
Sbjct  448  QFSECMERSLKELLGNEASGSIEVIHSNDGSGIGAALLAASHSLYLE  494



>gb|EAZ13494.1| hypothetical protein OsJ_03410 [Oryza sativa Japonica Group]
Length=462

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQY  290
            KFR C+E+TL +LLGE A+ S+V++ +NDGSGIGAALLAA+HSQY
Sbjct  414  KFRTCLEATLADLLGEEAASSVVVKLANDGSGIGAALLAASHSQY  458



>ref|XP_009392524.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=500

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            FR+C+++T +E+LG EA+ S+VI+ +NDGSGIGAALLAA+HSQY E ++S
Sbjct  451  FRECLQATFEEMLGAEAAASVVIKLANDGSGIGAALLAASHSQYRELEQS  500



>ref|XP_004510315.1| PREDICTED: hexokinase-1-like [Cicer arietinum]
Length=495

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +R C+E+TLKEL+GE  S+S+V+EHSNDGSG GAALLAA+ S YL+
Sbjct  449  YRKCLENTLKELVGEDLSDSIVVEHSNDGSGTGAALLAASQSHYLD  494



>gb|EMT07302.1| Hexokinase-2 [Aegilops tauschii]
Length=446

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            F + +E+TL+E+LGE  S S+VI+ +NDGSGIGAALLAAAHSQYLEA+E
Sbjct  365  FSETLENTLREMLGEEVSSSVVIKLANDGSGIGAALLAAAHSQYLEAEE  413



>ref|NP_001056137.1| Os05g0532600 [Oryza sativa Japonica Group]
 dbj|BAF18051.1| Os05g0532600 [Oryza sativa Japonica Group]
Length=135

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            F +C+ESTL+++LGE  S ++VI+ + DGSGIGAALLAAAHSQY EA+E
Sbjct  86   FAECVESTLRDMLGEDVSSTIVIKLAKDGSGIGAALLAAAHSQYREAEE  134



>dbj|BAJ89593.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            F + +ESTL+E+LGE  S S+VI+ +NDGSGIGAALLAAAHSQYLEA+
Sbjct  447  FSETLESTLREMLGEEVSSSVVIKLANDGSGIGAALLAAAHSQYLEAE  494



>gb|AEB00838.1| hexokinase 2 [Hordeum vulgare subsp. vulgare]
Length=472

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            F + +ESTL+E+LGE  S S+VI+ +NDGSGIGAALLAAAHSQYLEA+
Sbjct  424  FSETLESTLREMLGEEVSSSVVIKLANDGSGIGAALLAAAHSQYLEAE  471



>ref|XP_008672063.1| PREDICTED: uncharacterized protein LOC100192075 isoform X2 [Zea 
mays]
 ref|XP_008672064.1| PREDICTED: uncharacterized protein LOC100192075 isoform X2 [Zea 
mays]
Length=512

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  290
            KFR C+E+TL ELLG EAS+++ I+H++DGSGIGAAL+AA+ SQY
Sbjct  427  KFRRCLETTLGELLGDEASKAVAIKHADDGSGIGAALIAASQSQY  471



>ref|XP_003567061.1| PREDICTED: hexokinase-9-like isoform X1 [Brachypodium distachyon]
Length=496

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADESL  269
            F  CMESTL+++LGE  + S+VI+  +DGSGIGAALLAA++SQYL+ DE L
Sbjct  445  FGQCMESTLRDMLGEEVASSIVIKPVDDGSGIGAALLAASYSQYLQDDEIL  495



>gb|ACG43712.1| hexokinase-1 [Zea mays]
Length=503

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  290
            KFR C+E+TL ELLG EAS+++ I+H++DGSGIGAAL+AA+ SQY
Sbjct  418  KFRRCLETTLGELLGDEASKAVAIKHADDGSGIGAALIAASQSQY  462



>ref|NP_001130970.1| uncharacterized protein LOC100192075 [Zea mays]
 ref|XP_008672065.1| PREDICTED: uncharacterized protein LOC100192075 isoform X1 [Zea 
mays]
 gb|ACF79378.1| unknown [Zea mays]
 gb|ACF87695.1| unknown [Zea mays]
 gb|ACF88447.1| unknown [Zea mays]
 gb|ACF81463.2| unknown [Zea mays]
 tpg|DAA53045.1| TPA: hexokinase-1 isoform 1 [Zea mays]
 tpg|DAA53046.1| TPA: hexokinase-1 isoform 2 [Zea mays]
 tpg|DAA53047.1| TPA: hexokinase-1 isoform 3 [Zea mays]
Length=503

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  290
            KFR C+E+TL ELLG EAS+++ I+H++DGSGIGAAL+AA+ SQY
Sbjct  418  KFRRCLETTLGELLGDEASKAVAIKHADDGSGIGAALIAASQSQY  462



>ref|XP_010232254.1| PREDICTED: hexokinase-9-like isoform X2 [Brachypodium distachyon]
Length=471

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADESL  269
            F  CMESTL+++LGE  + S+VI+  +DGSGIGAALLAA++SQYL+ DE L
Sbjct  420  FGQCMESTLRDMLGEEVASSIVIKPVDDGSGIGAALLAASYSQYLQDDEIL  470



>dbj|BAP47497.1| hexokinase [Gentiana triflora]
Length=497

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KFR C E TL+ELLG+  E++ +  S+DGSGIGAALLAA++SQY+  +ES
Sbjct  448  KFRQCFEGTLEELLGDVYETISVVQSHDGSGIGAALLAASYSQYIGLEES  497



>ref|XP_006646274.1| PREDICTED: LOW QUALITY PROTEIN: hexokinase-9-like [Oryza brachyantha]
Length=495

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            F  CMESTL +LLG E + S+VI+  NDGSG+GAALLAA++SQY +ADE
Sbjct  446  FSQCMESTLSDLLGQELASSVVIKPVNDGSGVGAALLAASYSQYRQADE  494



>ref|XP_010231125.1| PREDICTED: hexokinase-2 isoform X2 [Brachypodium distachyon]
Length=417

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            F + +ESTL+E+LGE  S S+VI+ +NDGSGIGAALLAAAHSQYL+A+E
Sbjct  368  FSESLESTLQEILGEEVSSSVVIKLANDGSGIGAALLAAAHSQYLDAEE  416



>ref|XP_003568034.1| PREDICTED: hexokinase-2 isoform X1 [Brachypodium distachyon]
Length=494

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            F + +ESTL+E+LGE  S S+VI+ +NDGSGIGAALLAAAHSQYL+A+E
Sbjct  445  FSESLESTLQEILGEEVSSSVVIKLANDGSGIGAALLAAAHSQYLDAEE  493



>ref|XP_009405075.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=534

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEA-SESLVIEHSNDGSGIGaallaaAHSQY  290
            KFR C++STL+ELLGE  SES VI+ +NDGS IGAAL+AA+HSQY
Sbjct  442  KFRRCVKSTLRELLGEDDSESAVIKLANDGSSIGAALVAASHSQY  486



>gb|KJB35041.1| hypothetical protein B456_006G096800 [Gossypium raimondii]
Length=496

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 2/50 (4%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            +R+ +E+ LKELLGE   +++ IEHSNDGSGIGAALLAA+HSQYL+ DES
Sbjct  448  YRNSLENCLKELLGEEVFKTIKIEHSNDGSGIGAALLAASHSQYLK-DES  496



>emb|CDO97969.1| unnamed protein product [Coffea canephora]
Length=495

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  290
            ++R C+E+TL ELLG + S S+  EHSNDGSGIGAALLAA+HSQY
Sbjct  446  EYRKCLENTLIELLGGDGSSSIAFEHSNDGSGIGAALLAASHSQY  490



>gb|AFW78822.1| hexokinase-2 [Zea mays]
Length=507

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            KF  C+E+TL +LLGE AS S+V + +NDGSGIGAALLAA+HSQY E+D
Sbjct  459  KFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQYGESD  507



>gb|EEC70091.1| hypothetical protein OsI_00720 [Oryza sativa Indica Group]
Length=471

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 1/44 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQ  293
            KFR+C+ESTL ELLG EAS+S+ ++H+NDGSGIGAAL+AA+ S+
Sbjct  428  KFRECLESTLGELLGEEASKSVAVKHANDGSGIGAALIAASQSR  471



>ref|XP_006654666.1| PREDICTED: hexokinase-5-like [Oryza brachyantha]
Length=437

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEA-SESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            KF  C+ESTL +LLG+A + S+V + +NDGSGIGAALLAA+HSQY E D
Sbjct  389  KFSSCLESTLTDLLGDAVASSVVTKLANDGSGIGAALLAASHSQYAEID  437



>gb|EEE54030.1| hypothetical protein OsJ_00699 [Oryza sativa Japonica Group]
Length=472

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 1/44 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQ  293
            KFR+C+ESTL ELLG EAS+S+ ++H+NDGSGIGAAL+AA+ S+
Sbjct  429  KFRECLESTLGELLGEEASKSVAVKHANDGSGIGAALIAASQSR  472



>sp|Q1WM15.2|HXK8_ORYSJ RecName: Full=Hexokinase-8; AltName: Full=Hexokinase-4 [Oryza 
sativa Japonica Group]
 dbj|BAD72221.1| putative hexokinase [Oryza sativa Japonica Group]
 gb|AAX68420.1| hexokinase 4 [Oryza sativa Japonica Group]
 dbj|BAG88962.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93936.1| unnamed protein product [Oryza sativa Japonica Group]
Length=458

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 1/44 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQ  293
            KFR+C+ESTL ELLG EAS+S+ ++H+NDGSGIGAAL+AA+ S+
Sbjct  415  KFRECLESTLGELLGEEASKSVAVKHANDGSGIGAALIAASQSR  458



>gb|AAZ93625.1| hexokinase 8 [Oryza sativa Japonica Group]
Length=458

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 1/44 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQ  293
            KFR+C+ESTL ELLG EAS+S+ ++H+NDGSGIGAAL+AA+ S+
Sbjct  415  KFRECLESTLGELLGEEASKSVAVKHANDGSGIGAALIAASQSR  458



>gb|EMT15586.1| Hexokinase-7 [Aegilops tauschii]
Length=430

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  287
            KFR C+ESTL ELLG EASE + ++ + DGSG+GAAL+AAAHSQYL
Sbjct  384  KFRQCLESTLVELLGKEASELVAVKLTKDGSGVGAALIAAAHSQYL  429



>ref|XP_004969912.1| PREDICTED: hexokinase-6-like [Setaria italica]
Length=505

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEA  281
            KF  C+E+TL +LLGE A+ S+V++ +NDGSGIGAALLAA+HSQY EA
Sbjct  457  KFSACLEATLTDLLGEEAASSVVVKLANDGSGIGAALLAASHSQYAEA  504



>ref|NP_001042264.1| Os01g0190400 [Oryza sativa Japonica Group]
 dbj|BAF04178.1| Os01g0190400, partial [Oryza sativa Japonica Group]
Length=491

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 1/44 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQ  293
            KFR+C+ESTL ELLG EAS+S+ ++H+NDGSGIGAAL+AA+ S+
Sbjct  448  KFRECLESTLGELLGEEASKSVAVKHANDGSGIGAALIAASQSR  491



>gb|KCW79125.1| hypothetical protein EUGRSUZ_C005692, partial [Eucalyptus grandis]
Length=102

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQ  293
            KFR+C+E+T +ELLG E +E+ VI   NDGSGIGAALLAA+HSQ
Sbjct  59   KFRNCVEATFRELLGSEVAENTVIVLLNDGSGIGAALLAASHSQ  102



>ref|XP_011072439.1| PREDICTED: hexokinase-1-like [Sesamum indicum]
Length=514

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            K+R+C+E TL+ELLG E + ++V+EH+NDGSGIGAALLAA++S Y   DE+
Sbjct  451  KYRECLEKTLQELLGTETAATIVVEHANDGSGIGAALLAASNSHY-RGDEA  500



>ref|NP_001233957.1| hexokinase [Solanum lycopersicum]
 emb|CAC81350.1| hexokinase [Solanum lycopersicum]
Length=498

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +R C+E++LK+LLGE  + S+V  HSNDGSGIGAALLAA+HS YLE
Sbjct  449  YRMCLENSLKDLLGEELATSIVFVHSNDGSGIGAALLAASHSMYLE  494



>ref|XP_010489125.1| PREDICTED: hexokinase-2-like [Camelina sativa]
Length=502

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            +F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE +E
Sbjct  448  QFSETMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLEPEE  497



>ref|XP_008675068.1| PREDICTED: hexokinase-6 [Zea mays]
 tpg|DAA57704.1| TPA: hypothetical protein ZEAMMB73_919197 [Zea mays]
Length=506

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEA  281
            KF  C+E+TL +LLGE  + S+V++ +NDGSGIGAALLAA+HSQY EA
Sbjct  458  KFSACLEATLTDLLGEEVASSVVVKLANDGSGIGAALLAASHSQYAEA  505



>gb|EMS52462.1| Hexokinase-2 [Triticum urartu]
Length=401

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            F + +E+TL+E+LGE  S S+VI+ +NDGSGIGAALLAAAHSQYLEA+
Sbjct  353  FSETLENTLREMLGEEVSSSVVIKLANDGSGIGAALLAAAHSQYLEAE  400



>ref|NP_001056082.1| Os05g0522500 [Oryza sativa Japonica Group]
 sp|Q5W676.1|HXK5_ORYSJ RecName: Full=Hexokinase-5; AltName: Full=Hexokinase I [Oryza 
sativa Japonica Group]
 gb|AAK51559.1|AF372831_1 hexokinase I [Oryza sativa]
 gb|AAV44032.1| hexokinase 1 [Oryza sativa Japonica Group]
 gb|AAV59322.1| hexokinase [Oryza sativa Japonica Group]
 gb|AAZ93622.1| hexokinase 5 [Oryza sativa Japonica Group]
 dbj|BAF17996.1| Os05g0522500 [Oryza sativa Japonica Group]
 gb|EEE64409.1| hypothetical protein OsJ_19253 [Oryza sativa Japonica Group]
Length=507

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            KF  C+ESTL +LLG+  S S+V + +NDGSGIGAALLAA+HSQY E D
Sbjct  459  KFSSCLESTLTDLLGDDVSSSVVTKLANDGSGIGAALLAASHSQYAEID  507



>gb|EMT08969.1| Hexokinase-5 [Aegilops tauschii]
Length=410

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  290
            KF  C+E+TL +LLG EAS SLV + +NDGSGIGAALLAA+HSQY
Sbjct  362  KFSSCLEATLSDLLGDEASSSLVAKLANDGSGIGAALLAASHSQY  406



>gb|EMS55979.1| Hexokinase-5 [Triticum urartu]
Length=410

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  290
            KF  C+E+TL +LLG EAS SLV + +NDGSGIGAALLAA+HSQY
Sbjct  362  KFSSCLEATLSDLLGDEASSSLVAKLANDGSGIGAALLAASHSQY  406



>sp|O64390.1|HXK1_SOLTU RecName: Full=Hexokinase-1; AltName: Full=StHK1 [Solanum tuberosum]
 emb|CAA63966.1| hexokinase [Solanum tuberosum]
Length=498

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +R C+E++LK+LLGE  + S+V  HSNDGSGIGAALL A+HS YLE
Sbjct  450  YRMCLENSLKDLLGEELATSIVFVHSNDGSGIGAALLRASHSMYLE  495



>gb|EAY98739.1| hypothetical protein OsI_20669 [Oryza sativa Indica Group]
Length=511

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            KF  C+ESTL +LLG+  S S+V + +NDGSGIGAALLAA+HSQY E D
Sbjct  463  KFSSCLESTLTDLLGDDVSSSVVTKLANDGSGIGAALLAASHSQYAEID  511



>ref|XP_006299465.1| hypothetical protein CARUB_v10015630mg [Capsella rubella]
 gb|EOA32363.1| hypothetical protein CARUB_v10015630mg [Capsella rubella]
Length=504

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            +F + M+S+LKELLG E +ES+ +  SNDGSG+GAALLAA+HSQYLE +E
Sbjct  448  QFSEAMKSSLKELLGDEVAESVEVILSNDGSGVGAALLAASHSQYLEPEE  497



>sp|Q2KNB9.1|HXK2_ORYSJ RecName: Full=Hexokinase-2; AltName: Full=Hexokinase-3 [Oryza 
sativa Japonica Group]
 gb|AAX68419.1| hexokinase 3 [Oryza sativa Japonica Group]
 gb|AAZ93619.1| hexokinase 2 [Oryza sativa Japonica Group]
 gb|EEE64471.1| hypothetical protein OsJ_19321 [Oryza sativa Japonica Group]
Length=494

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            F +C+ESTL+++LGE  S ++VI+ + DGSGIGAALLAAAHSQY EA+E
Sbjct  445  FAECVESTLRDMLGEDVSSTIVIKLAKDGSGIGAALLAAAHSQYREAEE  493



>ref|XP_009415191.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=498

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            F +C++ TLKE+LGE AS S+V++ ++DGSGIGAALLAA+HSQYL+
Sbjct  449  FSECLQCTLKEMLGEEASSSVVVKLASDGSGIGAALLAASHSQYLQ  494



>gb|EPS70676.1| hexokinase 1a, partial [Genlisea aurea]
Length=490

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -2

Query  421  KFRDCMESTLKELLG--EASESLVIEHSNDGSGIGaallaaAHSQYL  287
            ++R  +ESTL+EL+G  EA E +V EHSNDGSGIGAALLAA+HS YL
Sbjct  444  EYRTRLESTLRELIGGGEAGEHIVFEHSNDGSGIGAALLAASHSLYL  490



>ref|XP_010416617.1| PREDICTED: hexokinase-2-like [Camelina sativa]
Length=502

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            +F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE  E
Sbjct  448  QFSEIMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLEPGE  497



>ref|XP_006343033.1| PREDICTED: hexokinase-1-like [Solanum tuberosum]
Length=497

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEA-SESLVIEHSNDGSGIGaallaaAHSQYLE  284
            ++R C+E++LK+LLGE  + S+V  HSNDGSGIGAALLAA+HS YLE
Sbjct  448  EYRMCLENSLKDLLGEELATSIVFVHSNDGSGIGAALLAASHSMYLE  494



>gb|ACG44289.1| hexokinase-2 [Zea mays]
Length=507

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            KF  C+E+TL +LLGE AS S+V + +NDGSGIGAALLAA+HSQY ++D
Sbjct  459  KFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQYGKSD  507



>gb|AAT77515.1| hexokinase 7 [Nicotiana tabacum]
Length=497

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEA-SESLVIEHSNDGSGIGaallaaAHSQYLE  284
            ++R C+E++LK+LLGE  + S+V  HSNDGSGIGAALLAA+HS YLE
Sbjct  448  EYRMCLENSLKDLLGEELATSIVFVHSNDGSGIGAALLAASHSMYLE  494



>gb|EAY98804.1| hypothetical protein OsI_20748 [Oryza sativa Indica Group]
Length=494

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            F +C+ESTL+++LGE  S ++VI+ + DGSGIGAALLAAAHSQY EA+E
Sbjct  445  FAECVESTLRDVLGEEVSSTIVIKLAKDGSGIGAALLAAAHSQYREAEE  493



>ref|XP_010467922.1| PREDICTED: hexokinase-2 isoform X1 [Camelina sativa]
Length=502

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            +F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE  E
Sbjct  448  QFSESMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLEPGE  497



>ref|XP_010467923.1| PREDICTED: hexokinase-2 isoform X2 [Camelina sativa]
Length=412

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            +F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE  E
Sbjct  358  QFSESMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLEPGE  407



>ref|XP_004968460.1| PREDICTED: hexokinase-8-like [Setaria italica]
Length=468

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQY  290
            KFR+C+E TL ELL E AS+S+ ++H++DGSGIGAAL+AA+ SQY
Sbjct  420  KFRECLEITLGELLAEYASKSVAVKHADDGSGIGAALIAASQSQY  464



>gb|KHN39258.1| Hexokinase-1 [Glycine soja]
Length=338

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 1/34 (3%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIG  323
            ++ +C+E+TLKEL+GE  SES++IEHSNDGSGIG
Sbjct  297  EYTECLENTLKELVGEDISESIIIEHSNDGSGIG  330



>gb|AFU82542.1| hexokinase, partial [Artemisia tridentata]
Length=196

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            KF   +++ + ELLGE AS++++IE SNDGSG+GAALLAA+HSQY   DES
Sbjct  146  KFSIALQNAMDELLGEEASKNMIIELSNDGSGLGAALLAASHSQYATYDES  196



>gb|EYU45835.1| hypothetical protein MIMGU_mgv1a005054mg [Erythranthe guttata]
Length=498

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +R C+E+T+ EL+G E+S ++  EHSNDGSGIGAALLAA+HS YL+
Sbjct  448  YRKCLENTVGELIGDESSSAITFEHSNDGSGIGAALLAASHSLYLD  493



>gb|KDP40854.1| hypothetical protein JCGZ_24853 [Jatropha curcas]
Length=501

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            ++  CME+TL ELLGE  S+++ I HSNDGSGIGAALLAA+HS+YL+ DE+
Sbjct  449  EYSKCMENTLNELLGEEVSKNIEIVHSNDGSGIGAALLAASHSRYLK-DET  498



>ref|NP_001123599.1| hexokinase2 [Zea mays]
 gb|ACD93189.1| hexokinase [Zea mays]
Length=507

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            KF  C+E+TL +LLGE AS S+V + +NDGSGIGAALLAA+HSQY  +D
Sbjct  459  KFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQYGASD  507



>gb|ACG47843.1| hexokinase-1 [Zea mays]
Length=503

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  290
            KFR C+E+TL ELLG EAS+++ I+H++DGSGIGAAL+AA+ SQ+
Sbjct  418  KFRRCLETTLGELLGDEASKAVAIKHADDGSGIGAALIAASQSQH  462



>ref|XP_006646311.1| PREDICTED: hexokinase-6-like [Oryza brachyantha]
Length=513

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQY  290
            KFR C+E+TL +LLG+ A+ S+V++ +NDGSGIGAALLAA+HSQY
Sbjct  465  KFRTCLEATLTDLLGDDAASSVVVKLANDGSGIGAALLAASHSQY  509



>ref|XP_003569773.1| PREDICTED: hexokinase-6 [Brachypodium distachyon]
Length=505

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            KF  C+E+TL +LLG EA+ S+V++ +NDGSGIGAALLAA+HSQY  A+
Sbjct  457  KFSSCVEATLADLLGKEAASSVVVKMANDGSGIGAALLAASHSQYAIAE  505



>ref|XP_009622660.1| PREDICTED: hexokinase-2 [Nicotiana tomentosiformis]
Length=497

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +R C+E+TL ELLGE  + S+V EH+NDGSGIGAALLAA++S Y+E
Sbjct  449  YRKCLENTLVELLGEEMATSIVFEHANDGSGIGAALLAASNSLYVE  494



>gb|AAS60194.1| hexokinase 3 [Nicotiana tabacum]
Length=497

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +R C+E+TL ELLGE  + S+V EH+NDGSGIGAALLAA++S Y+E
Sbjct  449  YRKCLENTLVELLGEEMATSIVFEHANDGSGIGAALLAASNSLYVE  494



>ref|XP_009777315.1| PREDICTED: hexokinase-2 [Nicotiana sylvestris]
Length=497

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            +R C+E+TL ELLGE  + S+V EH+NDGSGIGAALLAA++S Y+E
Sbjct  449  YRKCLENTLVELLGEEMATSIVFEHANDGSGIGAALLAASNSLYVE  494



>ref|XP_002440104.1| hypothetical protein SORBIDRAFT_09g026080 [Sorghum bicolor]
 gb|EES18534.1| hypothetical protein SORBIDRAFT_09g026080 [Sorghum bicolor]
Length=507

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEA  281
            KF  C+E+TL +LLGE AS S+V + +NDGSGIGAALLAA+HSQY E+
Sbjct  459  KFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQYGES  506



>gb|ACN35115.1| unknown [Zea mays]
Length=439

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQY  290
            KF  C+E+TL +LLGE AS S+V + +NDGSGIGAALLAA+HSQY
Sbjct  389  KFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQY  433



>gb|EAY75659.1| hypothetical protein OsI_03566 [Oryza sativa Indica Group]
Length=502

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            F  CMESTL ++LG E + S++I+H NDGSG+GAALLAA++SQY +A+ +
Sbjct  450  FSQCMESTLSDMLGQELAPSVMIKHVNDGSGVGAALLAASYSQYHQAESA  499



>sp|Q2KNB7.1|HXK9_ORYSJ RecName: Full=Hexokinase-9; AltName: Full=Hexokinase-5 [Oryza 
sativa Japonica Group]
 gb|AAX68421.1| hexokinase 5 [Oryza sativa Japonica Group]
 gb|AAZ93626.1| hexokinase 9 [Oryza sativa Japonica Group]
 gb|EAZ13381.1| hypothetical protein OsJ_03300 [Oryza sativa Japonica Group]
Length=502

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  272
            F  CMESTL ++LG E + S++I+H NDGSG+GAALLAA++SQY +A+ +
Sbjct  450  FSQCMESTLSDMLGQELAPSVMIKHVNDGSGVGAALLAASYSQYHQAESA  499



>ref|NP_001105529.1| LOC542510 [Zea mays]
 gb|AAM80479.1| hexokinase [Zea mays]
Length=509

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQY  290
            KF  C+E+TL +LLGE AS S+V + +NDGSGIGAALLAA+HSQY
Sbjct  459  KFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQY  503



>gb|AFW82530.1| hexokinase [Zea mays]
Length=509

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQY  290
            KF  C+E+TL +LLGE AS S+V + +NDGSGIGAALLAA+HSQY
Sbjct  459  KFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQY  503



>gb|AHY84734.1| hexokinase [Manihot esculenta]
Length=494

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQY  290
            ++  CME TL ELLGE  S+S+ I HSNDGSGIGAALLAA+HS Y
Sbjct  449  EYSKCMEDTLNELLGEEVSKSIEIVHSNDGSGIGAALLAASHSHY  493



>ref|XP_002455027.1| hypothetical protein SORBIDRAFT_03g003190 [Sorghum bicolor]
 gb|EES00147.1| hypothetical protein SORBIDRAFT_03g003190 [Sorghum bicolor]
Length=515

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  290
            KFR C+E+TL ELLG EAS+++ ++H++DGSGIGAAL+AA+ S Y
Sbjct  418  KFRQCLETTLGELLGDEASKAVAVKHADDGSGIGAALIAASQSLY  462



>gb|AAO24584.1| At2g19860 [Arabidopsis thaliana]
 dbj|BAE99655.1| hexokinase [Arabidopsis thaliana]
Length=502

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            +F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE ++
Sbjct  448  QFSESMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLELED  497



>ref|NP_179576.1| hexokinase 2 [Arabidopsis thaliana]
 sp|P93834.1|HXK2_ARATH RecName: Full=Hexokinase-2 [Arabidopsis thaliana]
 gb|AAB49911.1| hexokinase 2 [Arabidopsis thaliana]
 gb|AAC62130.1| hexokinase (ATHXK2) [Arabidopsis thaliana]
 gb|AEC06934.1| hexokinase 2 [Arabidopsis thaliana]
Length=502

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            +F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE ++
Sbjct  448  QFSESMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLELED  497



>ref|NP_001077921.1| hexokinase 2 [Arabidopsis thaliana]
 gb|AEC06935.1| hexokinase 2 [Arabidopsis thaliana]
Length=393

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            +F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE ++
Sbjct  339  QFSESMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLELED  388



>ref|XP_002886018.1| ATHXK2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62277.1| ATHXK2 [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  275
            +F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE ++
Sbjct  448  QFSESMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLELED  497



>ref|XP_004972151.1| PREDICTED: hexokinase-9-like [Setaria italica]
Length=133

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  278
            F  CMESTL++LLG E + S+VI+ + DGSG GAALLAA++SQ L+ D
Sbjct  86   FAQCMESTLRDLLGEEVASSVVIKQAEDGSGTGAALLAASYSQCLQVD  133



>ref|XP_009394175.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=493

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            FR+C+   L E+LG EAS S+V+  +NDGSG+GA+LLAA+HS+YLE
Sbjct  446  FRECLHGALNEMLGDEASSSVVVNLTNDGSGLGASLLAASHSRYLE  491



>ref|XP_001754148.1| hexokinase protein HXK7 [Physcomitrella patens]
 gb|EDQ81049.1| hexokinase protein HXK7 [Physcomitrella patens]
Length=521

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -2

Query  421  KFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYL  287
            KFR+ M+  + ELLGE S+++VIE S DGSGIGAALLAA+H++Y+
Sbjct  475  KFRNYMQEAVVELLGEGSKNVVIELSKDGSGIGAALLAASHAEYV  519



>ref|XP_002299739.1| hypothetical protein POPTR_0001s19130g [Populus trichocarpa]
 gb|EEE84544.1| hypothetical protein POPTR_0001s19130g [Populus trichocarpa]
Length=494

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYL  287
            +  C+E+TL ELLGE  S+++ IEH+NDGSG+GAALLAA+HS YL
Sbjct  450  YSKCLENTLNELLGEEVSKTISIEHANDGSGLGAALLAASHSLYL  494



>ref|XP_011000949.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=494

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = -2

Query  418  FRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYL  287
            +  C+E+TL ELLGE  S+++ IEH+NDGSG+GAALLAA+HS YL
Sbjct  450  YSKCLENTLNELLGEEVSKTISIEHANDGSGLGAALLAASHSLYL  494



>ref|XP_002515958.1| hexokinase, putative [Ricinus communis]
 gb|EEF46378.1| hexokinase, putative [Ricinus communis]
Length=494

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYL  287
            ++  CME+TL ELLGE   +S+ I HSNDGSGIGAALLAA+HS YL
Sbjct  449  EYSKCMENTLNELLGEDVPKSIEIVHSNDGSGIGAALLAASHSLYL  494



>ref|XP_002458467.1| hypothetical protein SORBIDRAFT_03g034230 [Sorghum bicolor]
 gb|EES03587.1| hypothetical protein SORBIDRAFT_03g034230 [Sorghum bicolor]
Length=506

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLE  284
            KF  C+E+TL +LLGE  + S+V++ +NDGSGIGAALLAA+HSQY E
Sbjct  458  KFSACLEATLTDLLGEEVASSVVVKLANDGSGIGAALLAASHSQYAE  504



>gb|EMT13168.1| Hexokinase-8 [Aegilops tauschii]
Length=450

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = -2

Query  421  KFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQY  290
            KF  C+E+TL ELLGE +S+ +V++H++DGSGIGAAL+AA+ SQY
Sbjct  402  KFSKCLEATLIELLGEESSKFVVVKHADDGSGIGAALIAASQSQY  446



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557844602525