BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF047C07

Length=386
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009597091.1|  PREDICTED: 40S ribosomal protein S4-like           100   6e-23   Nicotiana tomentosiformis
ref|XP_009784493.1|  PREDICTED: 40S ribosomal protein S4-like           100   7e-23   Nicotiana sylvestris
ref|XP_009609731.1|  PREDICTED: 40S ribosomal protein S4-like           100   7e-23   Nicotiana tomentosiformis
ref|XP_009794044.1|  PREDICTED: 40S ribosomal protein S4-like           100   7e-23   Nicotiana sylvestris
ref|XP_009595443.1|  PREDICTED: 40S ribosomal protein S4-like           100   7e-23   Nicotiana tomentosiformis
ref|XP_004233134.1|  PREDICTED: 40S ribosomal protein S4-like         98.6    3e-22   Solanum lycopersicum
ref|XP_010316939.1|  PREDICTED: 40S ribosomal protein S4-like         98.6    3e-22   Solanum lycopersicum
ref|XP_009766580.1|  PREDICTED: 40S ribosomal protein S4              98.6    4e-22   Nicotiana sylvestris
ref|XP_009600336.1|  PREDICTED: 40S ribosomal protein S4              98.6    4e-22   Nicotiana tomentosiformis
ref|XP_004148191.1|  PREDICTED: 40S ribosomal protein S4-like         97.4    4e-22   
ref|XP_010087529.1|  40S ribosomal protein S4                         98.6    6e-22   
ref|NP_001275093.1|  40S ribosomal protein S4-like                    97.8    6e-22   Solanum tuberosum [potatoes]
ref|XP_011097305.1|  PREDICTED: 40S ribosomal protein S4-like         97.8    7e-22   Sesamum indicum [beniseed]
emb|CBI18118.3|  unnamed protein product                              96.7    7e-22   Vitis vinifera
ref|XP_009781828.1|  PREDICTED: 40S ribosomal protein S4-like         97.8    7e-22   Nicotiana sylvestris
ref|XP_011084586.1|  PREDICTED: 40S ribosomal protein S4              97.8    7e-22   Sesamum indicum [beniseed]
gb|ACU24295.1|  unknown                                               97.8    7e-22   Glycine max [soybeans]
gb|KHN48586.1|  40S ribosomal protein S4-2                            97.8    8e-22   Glycine soja [wild soybean]
gb|KJB38001.1|  hypothetical protein B456_006G231800                  96.3    8e-22   Gossypium raimondii
ref|XP_003544057.1|  PREDICTED: 40S ribosomal protein S4-1            97.4    8e-22   Glycine max [soybeans]
ref|XP_004163526.1|  PREDICTED: 40S ribosomal protein S4-like         97.4    9e-22   
ref|XP_004240421.1|  PREDICTED: 40S ribosomal protein S4              97.4    1e-21   Solanum lycopersicum
ref|XP_008461503.1|  PREDICTED: 40S ribosomal protein S4-3-like       97.4    1e-21   Cucumis melo [Oriental melon]
ref|XP_006352979.1|  PREDICTED: 40S ribosomal protein S4-like         97.1    1e-21   Solanum tuberosum [potatoes]
ref|XP_006352980.1|  PREDICTED: 40S ribosomal protein S4-like         97.1    1e-21   Solanum tuberosum [potatoes]
emb|CBI25428.3|  unnamed protein product                              96.7    1e-21   Vitis vinifera
gb|KCW49428.1|  hypothetical protein EUGRSUZ_K02962                   95.5    1e-21   Eucalyptus grandis [rose gum]
gb|ACU21243.1|  unknown                                               94.0    1e-21   Glycine max [soybeans]
ref|XP_004233133.1|  PREDICTED: 40S ribosomal protein S4-like         96.7    2e-21   Solanum lycopersicum
ref|XP_004150397.1|  PREDICTED: 40S ribosomal protein S4-like         96.7    2e-21   Cucumis sativus [cucumbers]
ref|XP_002268192.1|  PREDICTED: 40S ribosomal protein S4-3-like       96.7    2e-21   Vitis vinifera
gb|KJB38000.1|  hypothetical protein B456_006G231800                  96.3    2e-21   Gossypium raimondii
ref|XP_007156131.1|  hypothetical protein PHAVU_003G261200g           95.5    2e-21   Phaseolus vulgaris [French bean]
ref|XP_002276986.1|  PREDICTED: 40S ribosomal protein S4-1            96.3    2e-21   Vitis vinifera
ref|NP_001275148.1|  40S ribosomal protein S4                         96.3    3e-21   Solanum tuberosum [potatoes]
ref|XP_008454823.1|  PREDICTED: 40S ribosomal protein S4-3            96.3    3e-21   Cucumis melo [Oriental melon]
ref|XP_008461463.1|  PREDICTED: 40S ribosomal protein S4-3-like       95.9    3e-21   Cucumis melo [Oriental melon]
gb|KJB37999.1|  hypothetical protein B456_006G231800                  95.9    4e-21   Gossypium raimondii
dbj|BAE20168.1|  ribosomal protein S4                                 95.9    4e-21   Panax ginseng [Asiatic ginseng]
gb|KHN38535.1|  40S ribosomal protein S4-1                            95.9    4e-21   Glycine soja [wild soybean]
gb|KHN10552.1|  40S ribosomal protein S4                              94.7    4e-21   Glycine soja [wild soybean]
gb|KGN44410.1|  hypothetical protein Csa_7G281390                     95.5    4e-21   Cucumis sativus [cucumbers]
ref|XP_003547932.1|  PREDICTED: 40S ribosomal protein S4-1            95.5    4e-21   Glycine max [soybeans]
gb|ACU24626.1|  unknown                                               95.5    4e-21   Glycine max [soybeans]
ref|NP_001242281.1|  uncharacterized protein LOC100812132             95.5    4e-21   Glycine max [soybeans]
ref|XP_004150395.1|  PREDICTED: 40S ribosomal protein S4-like         95.5    4e-21   
ref|NP_001235826.1|  40S ribosomal S4 protein                         95.5    4e-21   Glycine max [soybeans]
gb|KJB36905.1|  hypothetical protein B456_006G184600                  95.1    4e-21   Gossypium raimondii
ref|XP_006344073.1|  PREDICTED: 40S ribosomal protein S4-like         95.5    5e-21   
gb|KJB77064.1|  hypothetical protein B456_012G118500                  95.1    5e-21   Gossypium raimondii
gb|KJB77063.1|  hypothetical protein B456_012G118500                  95.1    6e-21   Gossypium raimondii
ref|XP_010037684.1|  PREDICTED: 40S ribosomal protein S4-3-like       95.1    6e-21   Eucalyptus grandis [rose gum]
gb|KCW60005.1|  hypothetical protein EUGRSUZ_H02737                   94.0    6e-21   Eucalyptus grandis [rose gum]
gb|KHN00473.1|  40S ribosomal protein S4-1                            95.5    6e-21   Glycine soja [wild soybean]
ref|XP_007156130.1|  hypothetical protein PHAVU_003G261200g           94.7    9e-21   Phaseolus vulgaris [French bean]
emb|CBI15899.3|  unnamed protein product                              94.4    9e-21   Vitis vinifera
gb|KJB71672.1|  hypothetical protein B456_011G136800                  94.7    9e-21   Gossypium raimondii
gb|KHG02041.1|  40S ribosomal S4                                      94.7    1e-20   Gossypium arboreum [tree cotton]
gb|KHG26321.1|  40S ribosomal S4                                      94.7    1e-20   Gossypium arboreum [tree cotton]
gb|KHG02126.1|  40S ribosomal S4                                      94.7    1e-20   Gossypium arboreum [tree cotton]
gb|KHG30713.1|  40S ribosomal S4                                      94.7    1e-20   Gossypium arboreum [tree cotton]
ref|XP_007050962.1|  Ribosomal protein S4 (RPS4A) family protein      94.4    1e-20   Theobroma cacao [chocolate]
ref|XP_010023674.1|  PREDICTED: 40S ribosomal protein S4-3            94.4    1e-20   Eucalyptus grandis [rose gum]
ref|XP_002275063.1|  PREDICTED: 40S ribosomal protein S4              94.4    1e-20   Vitis vinifera
ref|XP_007026596.1|  Ribosomal protein S4 (RPS4A) family protein      94.0    1e-20   
ref|XP_003516980.1|  PREDICTED: 40S ribosomal protein S4              94.0    2e-20   Glycine max [soybeans]
gb|KHN03095.1|  40S ribosomal protein S4                              94.0    2e-20   Glycine soja [wild soybean]
ref|XP_006576177.1|  PREDICTED: uncharacterized protein LOC100500...  94.0    2e-20   Glycine max [soybeans]
ref|XP_010251772.1|  PREDICTED: 40S ribosomal protein S4-like         92.8    2e-20   Nelumbo nucifera [Indian lotus]
gb|KJB29916.1|  hypothetical protein B456_005G123400                  93.6    2e-20   Gossypium raimondii
ref|XP_010529053.1|  PREDICTED: 40S ribosomal protein S4-3-like       93.6    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_008233807.1|  PREDICTED: 40S ribosomal protein S4-1            93.6    2e-20   Prunus mume [ume]
ref|XP_006374217.1|  40S ribosomal protein S4                         93.6    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011035547.1|  PREDICTED: 40S ribosomal protein S4-1            93.6    3e-20   Populus euphratica
ref|XP_006576176.1|  PREDICTED: uncharacterized protein LOC100500...  93.2    3e-20   
emb|CDP06439.1|  unnamed protein product                              93.2    3e-20   Coffea canephora [robusta coffee]
emb|CDP16509.1|  unnamed protein product                              90.1    3e-20   Coffea canephora [robusta coffee]
gb|KJB29915.1|  hypothetical protein B456_005G123400                  93.2    3e-20   Gossypium raimondii
gb|KHG30303.1|  40S ribosomal S4                                      93.2    4e-20   Gossypium arboreum [tree cotton]
ref|XP_006399188.1|  hypothetical protein EUTSA_v10014417mg           93.2    4e-20   Eutrema salsugineum [saltwater cress]
ref|XP_006401084.1|  hypothetical protein EUTSA_v10014163mg           93.2    4e-20   
ref|XP_007218753.1|  hypothetical protein PRUPE_ppa009337mg           93.2    4e-20   
gb|KJB17111.1|  hypothetical protein B456_002G266000                  91.7    4e-20   Gossypium raimondii
ref|XP_010036744.1|  PREDICTED: 40S ribosomal protein S4-3-like       92.8    5e-20   Eucalyptus grandis [rose gum]
gb|KJB17112.1|  hypothetical protein B456_002G266000                  92.4    5e-20   Gossypium raimondii
ref|XP_003604568.1|  40S ribosomal protein S4                         92.8    5e-20   Medicago truncatula
ref|XP_010553232.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...  92.8    5e-20   Tarenaya hassleriana [spider flower]
ref|XP_009345329.1|  PREDICTED: 40S ribosomal protein S4              90.9    5e-20   
ref|XP_010553233.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...  92.4    5e-20   Tarenaya hassleriana [spider flower]
dbj|BAH57121.1|  AT5G07090                                            91.3    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529903.1|  PREDICTED: 40S ribosomal protein S4-3-like       92.0    7e-20   Tarenaya hassleriana [spider flower]
ref|XP_002318967.2|  hypothetical protein POPTR_0013s01230g           92.0    8e-20   Populus trichocarpa [western balsam poplar]
gb|KFK27370.1|  hypothetical protein AALP_AA8G374100                  92.0    8e-20   Arabis alpina [alpine rockcress]
ref|XP_002884052.1|  40S ribosomal protein S4                         92.0    9e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_006409322.1|  hypothetical protein EUTSA_v10022813mg           92.0    9e-20   Eutrema salsugineum [saltwater cress]
emb|CDP12458.1|  unnamed protein product                              88.2    9e-20   Coffea canephora [robusta coffee]
gb|KFK36724.1|  hypothetical protein AALP_AA4G161500                  92.0    9e-20   Arabis alpina [alpine rockcress]
sp|P46299.1|RS4_GOSHI  RecName: Full=40S ribosomal protein S4         92.0    1e-19   Gossypium hirsutum [American cotton]
ref|XP_006411034.1|  hypothetical protein EUTSA_v10017036mg           92.0    1e-19   
ref|XP_010509192.1|  PREDICTED: 40S ribosomal protein S4-3-like       91.3    1e-19   Camelina sativa [gold-of-pleasure]
gb|ACJ84252.1|  unknown                                               90.5    1e-19   Medicago truncatula
ref|NP_001031846.1|  40S ribosomal protein S4-2                       91.3    1e-19   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10257.1|  ribosomal protein S4                                 91.3    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934423.1|  PREDICTED: 40S ribosomal protein S4-3-like       91.7    1e-19   Elaeis guineensis
emb|CDY58877.1|  BnaA03g55550D                                        91.3    2e-19   Brassica napus [oilseed rape]
ref|XP_011023749.1|  PREDICTED: 40S ribosomal protein S4-2-like       91.3    2e-19   Populus euphratica
ref|XP_009368564.1|  PREDICTED: 40S ribosomal protein S4-3-like       91.3    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_009130977.1|  PREDICTED: 40S ribosomal protein S4-1-like       91.3    2e-19   
emb|CDX70008.1|  BnaA10g23570D                                        91.3    2e-19   
ref|XP_009122377.1|  PREDICTED: 40S ribosomal protein S4-1            91.3    2e-19   Brassica rapa
ref|XP_002515668.1|  40S ribosomal protein S4, putative               91.3    2e-19   Ricinus communis
emb|CDX81032.1|  BnaC03g02860D                                        91.3    2e-19   
ref|XP_009132054.1|  PREDICTED: 40S ribosomal protein S4-2-like       91.3    2e-19   Brassica rapa
ref|XP_009125675.1|  PREDICTED: 40S ribosomal protein S4-1            90.9    2e-19   Brassica rapa
gb|KFK25102.1|  hypothetical protein AALP_AA8G066400                  90.9    2e-19   Arabis alpina [alpine rockcress]
ref|XP_006288484.1|  hypothetical protein CARUB_v10001743mg           90.9    2e-19   Capsella rubella
ref|XP_010517120.1|  PREDICTED: 40S ribosomal protein S4-3-like       90.9    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010515129.1|  PREDICTED: 40S ribosomal protein S4-1            90.9    2e-19   Camelina sativa [gold-of-pleasure]
ref|NP_565414.1|  40S ribosomal protein S4-1                          90.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CDX99006.1|  BnaC09g48290D                                        91.3    2e-19   
ref|NP_568179.1|  40S ribosomal protein S4-2                          90.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAL49933.1|  AT5g58420/mqj2_10                                     90.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491309.1|  PREDICTED: 40S ribosomal protein S4-3-like       90.9    2e-19   Camelina sativa [gold-of-pleasure]
dbj|BAB11167.1|  40S ribosomal protein S4                             90.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CDY14056.1|  BnaC02g01730D                                        91.3    2e-19   Brassica napus [oilseed rape]
ref|NP_200650.1|  40S ribosomal protein S4-3                          90.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011046821.1|  PREDICTED: 40S ribosomal protein S4-3            90.9    2e-19   Populus euphratica
emb|CDY60025.1|  BnaAnng16450D                                        91.3    2e-19   Brassica napus [oilseed rape]
ref|XP_002323021.2|  hypothetical protein POPTR_0016s13210g           90.9    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_002871248.1|  40S ribosomal protein S4                         90.9    2e-19   Arabidopsis lyrata subsp. lyrata
emb|CDY69841.1|  BnaAnng31720D                                        91.3    2e-19   Brassica napus [oilseed rape]
ref|XP_002322175.1|  hypothetical protein POPTR_0015s09110g           90.9    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_008809054.1|  PREDICTED: 40S ribosomal protein S4-like         89.7    2e-19   Phoenix dactylifera
gb|EYU19705.1|  hypothetical protein MIMGU_mgv1a012053mg              90.5    3e-19   Erythranthe guttata [common monkey flower]
gb|EPS63485.1|  hypothetical protein M569_11297                       90.5    3e-19   Genlisea aurea
emb|CDY57385.1|  BnaCnng31910D                                        90.5    3e-19   Brassica napus [oilseed rape]
ref|XP_010938423.1|  PREDICTED: 40S ribosomal protein S4-3            90.5    3e-19   Elaeis guineensis
ref|XP_006280972.1|  hypothetical protein CARUB_v10026972mg           90.5    3e-19   Capsella rubella
ref|XP_010443578.1|  PREDICTED: 40S ribosomal protein S4-3-like i...  90.5    3e-19   
ref|XP_004307685.1|  PREDICTED: 40S ribosomal protein S4-like         90.5    4e-19   Fragaria vesca subsp. vesca
emb|CDY32700.1|  BnaA02g07620D                                        90.5    4e-19   Brassica napus [oilseed rape]
ref|XP_011046165.1|  PREDICTED: 40S ribosomal protein S4-2-like       90.1    4e-19   Populus euphratica
ref|XP_006298349.1|  hypothetical protein CARUB_v10014418mg           90.1    4e-19   Capsella rubella
ref|XP_009126753.1|  PREDICTED: 40S ribosomal protein S4-1-like i...  90.5    5e-19   
gb|KHG11751.1|  40S ribosomal S4                                      89.7    5e-19   Gossypium arboreum [tree cotton]
emb|CDY02821.1|  BnaC02g10680D                                        89.7    5e-19   
ref|XP_009126752.1|  PREDICTED: 40S ribosomal protein S4-1-like i...  90.1    6e-19   
ref|XP_008789926.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...  89.7    6e-19   
ref|XP_004294780.1|  PREDICTED: 40S ribosomal protein S4-3            89.7    6e-19   Fragaria vesca subsp. vesca
ref|XP_002512717.1|  40S ribosomal protein S4, putative               89.4    7e-19   Ricinus communis
ref|XP_010243101.1|  PREDICTED: 40S ribosomal protein S4-3-like       89.4    7e-19   Nelumbo nucifera [Indian lotus]
ref|XP_009120350.1|  PREDICTED: 40S ribosomal protein S4-1            89.4    7e-19   Brassica rapa
emb|CDY32986.1|  BnaA10g11920D                                        89.7    7e-19   Brassica napus [oilseed rape]
gb|ABK92450.1|  unknown                                               89.4    8e-19   Populus trichocarpa [western balsam poplar]
ref|XP_002864574.1|  40S ribosomal protein S4                         89.4    8e-19   Arabidopsis lyrata subsp. lyrata
gb|EYU41945.1|  hypothetical protein MIMGU_mgv1a012043mg              89.4    8e-19   Erythranthe guttata [common monkey flower]
gb|KDO67007.1|  hypothetical protein CISIN_1g024108mg                 88.2    1e-18   Citrus sinensis [apfelsine]
ref|XP_008778562.1|  PREDICTED: 40S ribosomal protein S4-3-like       88.6    1e-18   Phoenix dactylifera
ref|XP_010483440.1|  PREDICTED: 40S ribosomal protein S4-3-like       88.6    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010453688.1|  PREDICTED: 40S ribosomal protein S4-3-like       88.6    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008789925.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...  88.6    2e-18   Phoenix dactylifera
emb|CDY05015.1|  BnaAnng01970D                                        88.6    2e-18   
ref|XP_010921843.1|  PREDICTED: 40S ribosomal protein S4-3-like       87.8    2e-18   Elaeis guineensis
gb|KDO67006.1|  hypothetical protein CISIN_1g024108mg                 88.2    2e-18   Citrus sinensis [apfelsine]
emb|CDX91445.1|  BnaC04g07050D                                        86.7    2e-18   
gb|KDP30648.1|  hypothetical protein JCGZ_16213                       88.2    2e-18   Jatropha curcas
ref|XP_006488578.1|  PREDICTED: 40S ribosomal protein S4-like         87.8    3e-18   Citrus sinensis [apfelsine]
gb|KDO67004.1|  hypothetical protein CISIN_1g024108mg                 87.8    3e-18   Citrus sinensis [apfelsine]
ref|XP_009391002.1|  PREDICTED: 40S ribosomal protein S4-3            87.0    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907826.1|  PREDICTED: 40S ribosomal protein S4-3-like       87.0    6e-18   Elaeis guineensis
ref|XP_009385022.1|  PREDICTED: 40S ribosomal protein S4-1-like       86.7    8e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010423256.1|  PREDICTED: 40S ribosomal protein S4-3-like       86.7    8e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009402521.1|  PREDICTED: 40S ribosomal protein S4-3-like       86.7    8e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010276734.1|  PREDICTED: 40S ribosomal protein S4-3            86.7    8e-18   Nelumbo nucifera [Indian lotus]
ref|XP_008356229.1|  PREDICTED: 40S ribosomal protein S4-3-like       86.7    9e-18   
ref|XP_009369565.1|  PREDICTED: 40S ribosomal protein S4-3-like       86.3    9e-18   Pyrus x bretschneideri [bai li]
ref|XP_009381027.1|  PREDICTED: 40S ribosomal protein S4-like         86.3    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009354210.1|  PREDICTED: 40S ribosomal protein S4-3-like       86.3    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_010243078.1|  PREDICTED: 40S ribosomal protein S4-3-like       86.3    1e-17   Nelumbo nucifera [Indian lotus]
ref|XP_004492491.1|  PREDICTED: 40S ribosomal protein S4-2-like       86.3    1e-17   Cicer arietinum [garbanzo]
ref|XP_011019071.1|  PREDICTED: 40S ribosomal protein S4-3-like       85.9    1e-17   Populus euphratica
ref|XP_002308235.1|  hypothetical protein POPTR_0006s10460g           85.9    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_004293830.1|  PREDICTED: 40S ribosomal protein S4-3            85.5    2e-17   Fragaria vesca subsp. vesca
ref|XP_007211867.1|  hypothetical protein PRUPE_ppa010094mg           85.1    2e-17   Prunus persica
ref|XP_009393217.1|  PREDICTED: 40S ribosomal protein S4-1-like       85.1    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009369212.1|  PREDICTED: 40S ribosomal protein S4-3            84.3    4e-17   Pyrus x bretschneideri [bai li]
ref|XP_008801072.1|  PREDICTED: 40S ribosomal protein S4-like         83.6    4e-17   Phoenix dactylifera
gb|EPS70681.1|  hypothetical protein M569_04077                       84.3    5e-17   Genlisea aurea
sp|O81363.1|RS4_PRUAR  RecName: Full=40S ribosomal protein S4         84.3    5e-17   Prunus armeniaca
ref|XP_008234249.1|  PREDICTED: 40S ribosomal protein S4              84.3    5e-17   Prunus mume [ume]
ref|XP_008343651.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  82.8    5e-17   
ref|XP_002455616.1|  hypothetical protein SORBIDRAFT_03g014423        79.7    1e-16   
ref|XP_008374283.1|  PREDICTED: 40S ribosomal protein S4 isoform X2   82.0    1e-16   
gb|ACF79718.1|  unknown                                               80.5    1e-16   Zea mays [maize]
ref|XP_010666843.1|  PREDICTED: 40S ribosomal protein S4-1            82.8    2e-16   
ref|XP_010685909.1|  PREDICTED: 40S ribosomal protein S4-1            82.8    2e-16   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX91447.1|  BnaC04g07030D                                        78.6    2e-16   
ref|XP_008659461.1|  PREDICTED: 40S ribosomal protein S4-like         79.3    3e-16   Zea mays [maize]
ref|XP_008374276.1|  PREDICTED: 40S ribosomal protein S4 isoform X1   80.9    3e-16   
ref|XP_003568916.1|  PREDICTED: 40S ribosomal protein S4              81.6    4e-16   Brachypodium distachyon [annual false brome]
gb|ACL51789.1|  putative ribosomal protein S4                         78.2    4e-16   Picea abies
dbj|BAJ94984.1|  predicted protein                                    81.6    4e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008678574.1|  PREDICTED: 40S ribosomal protein S4-like         81.6    4e-16   
ref|XP_003623356.1|  40S ribosomal protein S4                         81.3    5e-16   Medicago truncatula
ref|XP_006646768.1|  PREDICTED: 40S ribosomal protein S4-like         81.3    6e-16   Oryza brachyantha
ref|XP_004960263.1|  PREDICTED: 40S ribosomal protein S4-like         81.3    6e-16   Setaria italica
ref|XP_010676809.1|  PREDICTED: 40S ribosomal protein S4-1-like       81.3    6e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001045624.1|  Os02g0105900                                     81.3    6e-16   
ref|XP_002439678.1|  hypothetical protein SORBIDRAFT_09g018320        80.9    8e-16   Sorghum bicolor [broomcorn]
dbj|BAD22763.1|  ribosomal protein                                    80.9    9e-16   Bromus inermis [awnless brome grass]
ref|XP_007157713.1|  hypothetical protein PHAVU_002G092000g           79.3    9e-16   Phaseolus vulgaris [French bean]
gb|ACJ70374.1|  putative ribosomal protein S4                         77.4    9e-16   Pinus sylvestris [Scotch pine]
ref|XP_002463552.1|  hypothetical protein SORBIDRAFT_01g001850        80.5    1e-15   Sorghum bicolor [broomcorn]
ref|NP_001266498.1|  40S ribosomal protein S4                         80.5    1e-15   Zea mays [maize]
gb|AAT38019.1|  putative 40S ribosomal protein S4                     80.5    1e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AAS48726.1|  ribosomal protein S4                                  80.5    1e-15   Zea mays [maize]
gb|KDP45131.1|  hypothetical protein JCGZ_17463                       80.5    1e-15   Jatropha curcas
ref|XP_006851828.1|  hypothetical protein AMTR_s00041p00058440        80.5    1e-15   
ref|NP_001055342.1|  Os05g0368300                                     80.1    2e-15   
gb|EAY97774.1|  hypothetical protein OsI_19685                        80.1    2e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001043015.1|  Os01g0358400                                     79.7    2e-15   
ref|NP_001288485.1|  40S ribosomal protein S4-like                    79.7    2e-15   Zea mays [maize]
ref|XP_006644163.1|  PREDICTED: 40S ribosomal protein S4-like         79.7    2e-15   Oryza brachyantha
ref|XP_006645886.1|  PREDICTED: 40S ribosomal protein S4-like         79.3    3e-15   
ref|XP_007141735.1|  hypothetical protein PHAVU_008G221000g           79.0    3e-15   Phaseolus vulgaris [French bean]
ref|XP_004962295.1|  PREDICTED: 40S ribosomal protein S4-like         79.0    3e-15   Setaria italica
ref|XP_002455614.1|  hypothetical protein SORBIDRAFT_03g014380        79.0    3e-15   Sorghum bicolor [broomcorn]
gb|ABK22322.1|  unknown                                               79.0    4e-15   Picea sitchensis
gb|ABK21170.1|  unknown                                               79.0    4e-15   Picea sitchensis
gb|EEE63465.1|  hypothetical protein OsJ_18278                        80.1    4e-15   Oryza sativa Japonica Group [Japonica rice]
dbj|BAN18309.1|  40S ribosomal protein S4                             77.0    4e-15   Schiedea helleri
dbj|BAN18292.1|  40S ribosomal protein S4                             77.0    5e-15   Schiedea spergulina
ref|XP_001759850.1|  predicted protein                                78.6    5e-15   
gb|KDO63240.1|  hypothetical protein CISIN_1g023289mg                 78.6    6e-15   Citrus sinensis [apfelsine]
gb|KDO63243.1|  hypothetical protein CISIN_1g023289mg                 77.8    6e-15   Citrus sinensis [apfelsine]
dbj|BAM15885.1|  putative 40S ribosomal protein S4                    75.9    6e-15   Pyrus pyrifolia var. culta [Asian pear]
ref|XP_002972484.1|  hypothetical protein SELMODRAFT_148442           78.2    6e-15   Selaginella moellendorffii
ref|XP_002984314.1|  hypothetical protein SELMODRAFT_271698           78.2    6e-15   Selaginella moellendorffii
gb|KDO63241.1|  hypothetical protein CISIN_1g023289mg                 78.2    6e-15   Citrus sinensis [apfelsine]
ref|XP_001759591.1|  predicted protein                                78.2    7e-15   
ref|XP_004491013.1|  PREDICTED: 40S ribosomal protein S4-2-like       78.2    7e-15   Cicer arietinum [garbanzo]
gb|KDO63242.1|  hypothetical protein CISIN_1g023289mg                 78.2    7e-15   Citrus sinensis [apfelsine]
ref|XP_001785339.1|  predicted protein                                78.2    8e-15   
ref|XP_008383247.1|  PREDICTED: 40S ribosomal protein S4              78.2    8e-15   Malus domestica [apple tree]
ref|XP_004511996.1|  PREDICTED: 40S ribosomal protein S4-1-like       78.2    8e-15   Cicer arietinum [garbanzo]
ref|XP_006429477.1|  hypothetical protein CICLE_v10012499mg           77.8    9e-15   Citrus clementina [clementine]
ref|XP_001780588.1|  predicted protein                                77.4    1e-14   
ref|XP_007205728.1|  hypothetical protein PRUPE_ppa010072mg           77.4    1e-14   Prunus persica
dbj|BAN18311.1|  40S ribosomal protein S4                             75.9    1e-14   Schiedea jacobii
dbj|BAN18315.1|  40S ribosomal protein S4                             75.9    1e-14   Schiedea stellarioides
gb|ABD98758.1|  putative ribosomal protein S4e                        77.0    2e-14   Graphocephala atropunctata
ref|XP_001751877.1|  predicted protein                                76.6    2e-14   
gb|ABG74702.1|  ribosomal protein S4-like protein                     74.3    3e-14   Diaphorina citri
gb|KDR20779.1|  40S ribosomal protein S4                              75.9    4e-14   Zootermopsis nevadensis
ref|XP_001766039.1|  predicted protein                                76.3    5e-14   
gb|EMT14698.1|  40S ribosomal protein S4                              75.9    5e-14   
ref|XP_002599076.1|  hypothetical protein BRAFLDRAFT_81739            75.9    5e-14   Branchiostoma floridae
emb|CAF89133.1|  unnamed protein product                              74.7    7e-14   Tetraodon nigroviridis
emb|CAF89132.1|  unnamed protein product                              74.7    7e-14   Tetraodon nigroviridis
emb|CAA75242.1|  ribosomal protein S4                                 75.1    9e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003611879.1|  40S ribosomal protein S4                         75.1    1e-13   Medicago truncatula
gb|ACV70143.1|  putative 40S ribosomal protein S4                     74.7    1e-13   Jatropha curcas
emb|CAF90008.1|  unnamed protein product                              74.7    1e-13   Tetraodon nigroviridis
ref|XP_003966899.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  74.3    1e-13   Takifugu rubripes [tiger puffer]
ref|XP_010846887.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    1e-13   Bison bison bison
ref|XP_011503007.1|  PREDICTED: 40S ribosomal protein S4              74.3    2e-13   Ceratosolen solmsi marchali
emb|CAJ17168.1|  ribosomal protein S4e                                74.3    2e-13   Mycetophagus quadripustulatus
gb|ABW90374.1|  putative ribosomal protein S4                         71.2    2e-13   Sipunculus nudus
gb|ADK97882.1|  40S ribosomal protein S4-like protein                 72.8    2e-13   Schiedea globosa
ref|XP_969262.1|  PREDICTED: 40S ribosomal protein S4                 73.9    2e-13   Tribolium castaneum [rust-red flour beetle]
gb|ADK97883.1|  40S ribosomal protein S4-like protein                 72.8    2e-13   Schiedea globosa
gb|ADK97878.1|  40S ribosomal protein S4-like protein                 72.8    2e-13   Schiedea globosa
ref|XP_008554239.1|  PREDICTED: 40S ribosomal protein S4 isoform X2   73.9    2e-13   Microplitis demolitor
ref|XP_008554238.1|  PREDICTED: 40S ribosomal protein S4 isoform X1   73.6    3e-13   Microplitis demolitor
ref|XP_006806979.1|  PREDICTED: 40S ribosomal protein S4-like         73.2    3e-13   Neolamprologus brichardi [lyretail cichlid]
gb|ACM41869.1|  40S ribosomal protein S4                              72.8    3e-13   Epinephelus coioides [estuary cod]
emb|CAM34499.1|  putative ribosomal protein S4                        73.2    3e-13   Cotesia congregata
gb|AAN05593.1|  ribosomal protein S4                                  73.2    4e-13   Argopecten irradians
ref|XP_005750964.1|  PREDICTED: 40S ribosomal protein S4-like         73.2    4e-13   Pundamilia nyererei
ref|XP_003457778.1|  PREDICTED: 40S ribosomal protein S4-like         73.2    4e-13   
emb|CDQ91819.1|  unnamed protein product                              73.2    4e-13   
gb|AFM87450.1|  40S ribosomal protein S4                              73.2    4e-13   
gb|ACN10029.1|  40S ribosomal protein S4                              72.8    4e-13   
ref|XP_010010561.1|  PREDICTED: 40S ribosomal protein S4              72.8    4e-13   
gb|EMP39148.1|  40S ribosomal protein S4                              72.8    5e-13   
ref|XP_008300595.1|  PREDICTED: 40S ribosomal protein S4 isoform X2   72.8    5e-13   
ref|XP_010078274.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.8    5e-13   
gb|ADW09574.1|  putative 40S ribosomal protein S4-like protein        71.6    5e-13   
gb|EKC32468.1|  40S ribosomal protein S4, X isoform                   72.8    5e-13   
gb|ADW09573.1|  putative 40S ribosomal protein S4-like protein        71.6    5e-13   
ref|XP_011212693.1|  PREDICTED: 40S ribosomal protein S4              72.8    5e-13   
ref|XP_005147776.1|  PREDICTED: 40S ribosomal protein S4-like iso...  72.8    5e-13   
ref|XP_002094667.1|  RpS4                                             72.8    5e-13   
ref|XP_001972620.1|  GG15623                                          72.8    5e-13   
ref|XP_004526806.1|  PREDICTED: 40S ribosomal protein S4-like         72.8    5e-13   
ref|NP_729871.1|  ribosomal protein S4, isoform A                     72.8    5e-13   
gb|AFM86794.1|  40S ribosomal protein S4                              72.8    5e-13   
dbj|BAA03786.1|  ribosomal protein S4                                 72.8    6e-13   
ref|XP_001353585.1|  GA10883                                          72.8    6e-13   
ref|NP_001290866.1|  ribosomal protein S4, X-linked                   72.8    6e-13   
gb|AIC59238.1|  RPS4X                                                 72.4    6e-13   
gb|AGH92536.1|  ribosomal protein S4                                  72.8    6e-13   
gb|AFM86700.1|  40S ribosomal protein S4                              72.8    6e-13   
gb|ACI69349.1|  40S ribosomal protein S4                              72.8    6e-13   
gb|AFM89946.1|  40S ribosomal protein S4                              72.8    6e-13   
gb|AFM87393.1|  40S ribosomal protein S4                              72.8    6e-13   
gb|AFM89445.1|  40S ribosomal protein S4                              72.8    6e-13   
gb|ACH85337.1|  40S ribosomal protein S4                              72.8    6e-13   
gb|AFM90836.1|  40S ribosomal protein S4                              72.8    6e-13   
gb|ELK23579.1|  40S ribosomal protein S4                              72.4    6e-13   
gb|ACI67685.1|  40S ribosomal protein S4                              72.8    6e-13   
gb|AFM90857.1|  40S ribosomal protein S4                              72.8    6e-13   
gb|AFM86071.1|  40S ribosomal protein S4                              72.8    6e-13   
gb|ACH85370.1|  40S ribosomal protein S4                              72.8    6e-13   
dbj|BAF45892.1|  ribosomal protein S4                                 72.8    6e-13   
ref|XP_006124705.1|  PREDICTED: 40S ribosomal protein S4-like         72.8    6e-13   
ref|XP_005313894.1|  PREDICTED: 40S ribosomal protein S4 isoform X2   72.8    6e-13   
ref|NP_001005589.1|  40S ribosomal protein S4, X isoform              72.8    6e-13   
ref|XP_002432788.1|  40S ribosomal protein S4, putative               72.4    6e-13   
gb|KFO21995.1|  40S ribosomal protein S4                              72.4    6e-13   
gb|AFM88708.1|  40S ribosomal protein S4                              72.8    6e-13   
ref|XP_007889271.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.8    6e-13   
ref|XP_008318659.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.8    6e-13   
gb|AFM90735.1|  40S ribosomal protein S4                              72.8    6e-13   
gb|AFM86034.1|  40S ribosomal protein S4                              72.8    6e-13   
gb|AFM85695.1|  40S ribosomal protein S4                              72.8    6e-13   
tpe|CAL69092.1|  TPA: putative 40S ribosomal protein S4               72.4    6e-13   
gb|AFM90740.1|  40S ribosomal protein S4                              72.4    6e-13   
gb|AFM89018.1|  40S ribosomal protein S4                              72.4    6e-13   
gb|AFM87833.1|  40S ribosomal protein S4                              72.4    7e-13   
ref|XP_005313893.1|  PREDICTED: 40S ribosomal protein S4 isoform X1   72.8    7e-13   
gb|ERE63485.1|  40S ribosomal protein S4                              72.4    7e-13   
gb|AFM88094.1|  40S ribosomal protein S4                              72.4    7e-13   
gb|ELK15681.1|  40S ribosomal protein S4                              72.4    7e-13   
ref|XP_011433431.1|  PREDICTED: 40S ribosomal protein S4-like         72.4    7e-13   
ref|XP_007185527.1|  PREDICTED: 40S ribosomal protein S4-like         72.4    7e-13   
ref|XP_008300594.1|  PREDICTED: 40S ribosomal protein S4 isoform X1   72.4    7e-13   
gb|ABQ18253.1|  ribosomal protein S4e                                 72.4    7e-13   
ref|XP_009930575.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.4    7e-13   
ref|XP_010306572.1|  PREDICTED: 40S ribosomal protein S4              72.4    7e-13   
ref|XP_008999395.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.4    7e-13   
ref|XP_006193300.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.4    7e-13   
ref|XP_010747631.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.4    7e-13   
gb|AER42698.1|  40S ribosomal protein S4                              72.4    7e-13   
ref|XP_010078273.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.4    7e-13   
ref|XP_008945582.1|  PREDICTED: 40S ribosomal protein S4              72.4    7e-13   
emb|CDQ70618.1|  unnamed protein product                              72.8    7e-13   
gb|AAA36597.1|  scar protein                                          72.4    7e-13   
ref|XP_010202370.1|  PREDICTED: 40S ribosomal protein S4              72.4    7e-13   
ref|XP_004080003.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.4    7e-13   
gb|EDL27273.1|  mCG127176                                             72.4    7e-13   
gb|AAH07308.2|  RPS4X protein                                         72.4    7e-13   
ref|XP_009705067.1|  PREDICTED: 40S ribosomal protein S4              72.4    7e-13   
ref|XP_008919034.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.4    7e-13   
ref|XP_001985577.1|  GH17143                                          72.4    7e-13   
ref|XP_010216162.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.4    7e-13   
ref|XP_006873465.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.4    7e-13   
ref|XP_002062215.1|  GK17425                                          72.4    8e-13   
ref|XP_002047468.1|  GJ13462                                          72.4    8e-13   
ref|XP_009644675.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.4    8e-13   
ref|XP_005428838.1|  PREDICTED: 40S ribosomal protein S4-like         72.4    8e-13   
gb|ADG29131.1|  40S ribosomal protein S4                              72.4    8e-13   
ref|XP_010140642.1|  PREDICTED: 40S ribosomal protein S4              72.4    8e-13   
ref|XP_009330287.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.4    8e-13   
ref|XP_009557978.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.4    8e-13   
ref|XP_007433627.1|  PREDICTED: 40S ribosomal protein S4-like         72.4    8e-13   
ref|XP_007954963.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  71.6    8e-13   
ref|XP_009881746.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.4    8e-13   
ref|XP_002008552.1|  GI11752                                          72.4    8e-13   
gb|EOA93329.1|  40S ribosomal protein S4                              72.0    8e-13   
ref|XP_009480425.1|  PREDICTED: 40S ribosomal protein S4              72.0    8e-13   
gb|EPY74423.1|  40S ribosomal protein S4                              72.0    8e-13   
ref|XP_009682020.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    8e-13   
ref|XP_623050.1|  PREDICTED: 40S ribosomal protein S4-like isoform 1  72.4    8e-13   
ref|XP_006057394.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    8e-13   
ref|XP_009074657.1|  PREDICTED: 40S ribosomal protein S4              72.0    8e-13   
gb|EHB08523.1|  40S ribosomal protein S4                              72.0    8e-13   
ref|XP_009923536.1|  PREDICTED: 40S ribosomal protein S4              72.0    8e-13   
ref|XP_010001756.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    9e-13   
ref|XP_009282877.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.4    9e-13   
ref|XP_005641046.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    9e-13   
ref|XP_007969102.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    9e-13   
ref|XP_003398498.1|  PREDICTED: 40S ribosomal protein S4-like iso...  72.0    9e-13   
ref|XP_008639287.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    9e-13   
ref|XP_009866762.1|  PREDICTED: 40S ribosomal protein S4              72.0    9e-13   
ref|XP_005992934.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    9e-13   
ref|XP_006025231.1|  PREDICTED: 40S ribosomal protein S4-like         72.4    9e-13   
ref|XP_005701152.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    9e-13   
ref|XP_009902618.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    1e-12   
ref|XP_004573481.1|  PREDICTED: 40S ribosomal protein S4-like         73.2    1e-12   
ref|XP_005189699.1|  PREDICTED: 40S ribosomal protein S4              72.0    1e-12   
gb|EGW14036.1|  40S ribosomal protein S4                              73.2    1e-12   
ref|XP_007955750.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  72.0    1e-12   
ref|NP_001158523.1|  40S ribosomal protein S4, X isoform              72.0    1e-12   
ref|XP_006888343.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_004798077.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    1e-12   
ref|XP_004758473.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  72.0    1e-12   
ref|XP_006908610.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    1e-12   
ref|XP_003941964.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_004679117.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_010606265.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    1e-12   
ref|XP_008054194.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_002708125.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_003898985.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|NP_001233602.1|  40S ribosomal protein S4                         72.0    1e-12   
ref|XP_003471039.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    1e-12   
ref|XP_003706904.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    1e-12   
ref|XP_004605913.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_004396498.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_009204777.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_003764080.1|  PREDICTED: 40S ribosomal protein S4, Y isofo...  72.0    1e-12   
ref|XP_009002753.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_006910196.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_005964326.1|  PREDICTED: 40S ribosomal protein S4-like iso...  72.0    1e-12   
ref|XP_005885533.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    1e-12   
dbj|BAE22507.1|  unnamed protein product                              72.0    1e-12   
prf||1617101C  ribosomal protein S4                                   72.0    1e-12
ref|XP_003803397.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    1e-12   
ref|XP_003785255.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|NP_001084941.1|  40S ribosomal protein S4                         72.0    1e-12   
gb|AAB01670.1|  ribosomal protein S4                                  72.0    1e-12   
ref|XP_008498268.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    1e-12   
dbj|BAB29207.1|  unnamed protein product                              72.0    1e-12   
ref|NP_001028160.1|  40S ribosomal protein S4, Y isoform 1            72.0    1e-12   
ref|NP_000998.1|  40S ribosomal protein S4, X isoform X isoform       72.0    1e-12   
ref|XP_008069053.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    1e-12   
gb|ACN09853.1|  40S ribosomal protein S4                              72.0    1e-12   
ref|NP_001090472.1|  40S ribosomal protein S4                         72.0    1e-12   
ref|XP_006082927.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_005902065.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    1e-12   
ref|XP_005700707.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    1e-12   
gb|EHH60989.1|  Single copy abundant mRNA protein                     72.0    1e-12   
ref|XP_004887478.1|  PREDICTED: 40S ribosomal protein S4-like iso...  72.0    1e-12   
gb|EFB14527.1|  hypothetical protein PANDA_015068                     72.0    1e-12   
ref|NP_001075891.1|  40S ribosomal protein S4                         72.0    1e-12   
ref|XP_006865002.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    1e-12   
ref|XP_005974427.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    1e-12   
ref|XP_010330703.1|  PREDICTED: 40S ribosomal protein S4, X isoform   71.6    1e-12   
ref|XP_010565368.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    1e-12   
ref|XP_005403497.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_003472052.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
gb|ELW69939.1|  40S ribosomal protein S4                              72.0    1e-12   
ref|XP_008835836.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    1e-12   
ref|XP_010372927.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_004581137.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_004887479.1|  PREDICTED: 40S ribosomal protein S4-like iso...  72.0    1e-12   
dbj|BAD96199.1|  ribosomal protein S4, X-linked X isoform variant     72.0    1e-12   
ref|XP_004887477.1|  PREDICTED: 40S ribosomal protein S4-like iso...  72.0    1e-12   
ref|NP_001232240.1|  putative ribosomal protein S4                    72.0    1e-12   
ref|NP_990439.1|  40S ribosomal protein S4                            72.0    1e-12   
gb|ACO07465.1|  40S ribosomal protein S4                              72.0    1e-12   
gb|ETE69702.1|  40S ribosomal protein S4                              72.0    1e-12   
ref|XP_004394286.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_003766510.1|  PREDICTED: 40S ribosomal protein S4-like iso...  72.0    1e-12   
ref|XP_001365342.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    1e-12   
ref|XP_009463285.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    1e-12   
ref|XP_007528658.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_003228681.1|  PREDICTED: 40S ribosomal protein S4              72.0    1e-12   
gb|EHH30841.1|  Single copy abundant mRNA protein                     72.0    1e-12   
ref|XP_004853269.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_002752965.2|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|XP_010989591.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    1e-12   
ref|XP_004893287.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  72.0    1e-12   
ref|NP_988912.1|  40S ribosomal protein S4                            71.6    1e-12   
ref|NP_001279537.1|  ribosomal protein S4, X-linked                   71.6    1e-12   
ref|XP_006876642.1|  PREDICTED: 40S ribosomal protein S4-like         71.6    1e-12   
ref|XP_008558436.1|  PREDICTED: 40S ribosomal protein S4              71.6    1e-12   
ref|XP_002749534.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  71.6    1e-12   
ref|XP_010798474.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  71.6    1e-12   
ref|XP_006767373.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  70.9    1e-12   
ref|XP_005199960.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  71.6    1e-12   
ref|XP_009251197.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  71.6    1e-12   
ref|XP_001599933.1|  PREDICTED: 40S ribosomal protein S4              71.6    2e-12   
ref|XP_011380547.1|  PREDICTED: 40S ribosomal protein S4-like         71.6    2e-12   
ref|XP_006923115.1|  PREDICTED: 40S ribosomal protein S4-like iso...  71.6    2e-12   
ref|XP_005228099.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  71.6    2e-12   
ref|XP_005435883.1|  PREDICTED: 40S ribosomal protein S4-like         72.0    2e-12   
ref|XP_005030976.1|  PREDICTED: 40S ribosomal protein S4-like         71.6    2e-12   
ref|XP_007242077.1|  PREDICTED: 40S ribosomal protein S4-like         71.6    2e-12   
emb|CCA19147.1|  40S ribosomal protein S4 putative                    71.2    2e-12   
ref|XP_004715961.1|  PREDICTED: 40S ribosomal protein S4, X isoform   72.0    2e-12   
ref|XP_001957453.1|  GF24027                                          71.2    2e-12   
emb|CEG70587.1|  Putative 40S ribosomal protein S4-A                  71.2    2e-12   
ref|XP_007169373.1|  PREDICTED: 40S ribosomal protein S4-like         71.2    2e-12   
emb|CAJ17169.1|  ribosomal protein S4e                                71.2    2e-12   
dbj|BAN20754.1|  ribosomal protein S4                                 71.2    2e-12   
ref|XP_010792965.1|  PREDICTED: 40S ribosomal protein S4              71.2    2e-12   
gb|AFM90173.1|  40S ribosomal protein S4                              71.2    2e-12   
gb|ACY66573.1|  ribosomal protein S4                                  68.9    2e-12   
emb|CEG70586.1|  Putative 40S ribosomal protein S4-A                  71.2    2e-12   
ref|XP_008954190.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  70.9    2e-12   
ref|XP_005360594.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  70.9    2e-12   
ref|XP_009439348.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...  72.4    2e-12   
ref|XP_006885447.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  70.9    2e-12   
ref|XP_006275921.1|  PREDICTED: 40S ribosomal protein S4-like         72.4    2e-12   
ref|XP_006877763.1|  PREDICTED: 40S ribosomal protein S4, X isofo...  70.9    3e-12   
sp|Q56FH2.1|RS4_LYSTE  RecName: Full=40S ribosomal protein S4         70.9    3e-12   
ref|XP_006632866.1|  PREDICTED: 40S ribosomal protein S4-like         71.2    3e-12   
gb|AFM90738.1|  40S ribosomal protein S4                              70.9    3e-12   
gb|AAT92168.1|  ribosomal protein S4                                  68.6    3e-12   



>ref|XP_009597091.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQSATTA
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQSATTA  264



>ref|XP_009784493.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQSATTA
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQSATTA  264



>ref|XP_009609731.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
 ref|XP_009764136.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQSATTA
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQSATTA  264



>ref|XP_009794044.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQSATTA
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQSATTA  264



>ref|XP_009595443.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQSATTA
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQSATTA  264



>ref|XP_004233134.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233136.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233137.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKG+KPWVSLPKGKGIKLSIIEEA+KR+AAQSATTA
Sbjct  215  GHEFATRLGNVFTLGKGSKPWVSLPKGKGIKLSIIEEARKRMAAQSATTA  264



>ref|XP_010316939.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKG+KPWVSLPKGKGIKLSIIEEA+KR+AAQSATTA
Sbjct  215  GHEFATRLGNVFTLGKGSKPWVSLPKGKGIKLSIIEEARKRMAAQSATTA  264



>ref|XP_009766580.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana sylvestris]
Length=264

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQSAT A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQSATAA  264



>ref|XP_009600336.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana tomentosiformis]
Length=264

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQSAT A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQSATAA  264



>ref|XP_004148191.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
Length=216

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEA+KRLA+QSA TA
Sbjct  167  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEARKRLASQSAVTA  216



>ref|XP_010087529.1| 40S ribosomal protein S4 [Morus notabilis]
 gb|EXB29260.1| 40S ribosomal protein S4 [Morus notabilis]
Length=318

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPW+SLPKGKGIKLSIIEEAKKRLAAQ+A+TA
Sbjct  269  GHEFATRLGNVFTIGKGTKPWLSLPKGKGIKLSIIEEAKKRLAAQAASTA  318



>ref|NP_001275093.1| 40S ribosomal protein S4-like [Solanum tuberosum]
 gb|ABB72798.1| 40S ribosomal protein S4-like protein [Solanum tuberosum]
Length=264

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEAKKRLAAQSAT A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEAKKRLAAQSATPA  264



>ref|XP_011097305.1| PREDICTED: 40S ribosomal protein S4-like [Sesamum indicum]
Length=263

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQSAT
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQSAT  262



>emb|CBI18118.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWV+LPKGKGIKLSIIEEAKKRLAAQ++ TA
Sbjct  156  GHEFATRLGNVFTIGKGTKPWVTLPKGKGIKLSIIEEAKKRLAAQASATA  205



>ref|XP_009781828.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=259

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSI EEA+KRLAAQSATTA
Sbjct  210  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLSINEEARKRLAAQSATTA  259



>ref|XP_011084586.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
 ref|XP_011095064.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
Length=263

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQSAT
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQSAT  262



>gb|ACU24295.1| unknown [Glycine max]
Length=264

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEEA+KR+AAQ ATTA
Sbjct  215  GHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRIAAQQATTA  264



>gb|KHN48586.1| 40S ribosomal protein S4-2 [Glycine soja]
Length=264

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEEA+KR+AAQ ATTA
Sbjct  215  GHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRIAAQQATTA  264



>gb|KJB38001.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=191

 Score = 96.3 bits (238),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQSA
Sbjct  144  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQSA  190



>ref|XP_003544057.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
Length=264

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEEA+KR+AAQ ATTA
Sbjct  215  GHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRIAAQQATTA  264



>ref|XP_004163526.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN50688.1| hypothetical protein Csa_5G212590 [Cucumis sativus]
 gb|KGN50692.1| hypothetical protein Csa_5G215120 [Cucumis sativus]
Length=264

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEA+KRLA+QSA TA
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEARKRLASQSAVTA  264



>ref|XP_004240421.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRLAAQSAT A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLAAQSATPA  264



>ref|XP_008461503.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLA+Q+A TA
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLASQAAVTA  264



>ref|XP_006352979.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKG+KPWVSLPKGKGIKLSIIEEA+KR+A QSATTA
Sbjct  215  GHEFATRLGNVFTLGKGSKPWVSLPKGKGIKLSIIEEARKRMATQSATTA  264



>ref|XP_006352980.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKG+KPWVSLPKGKGIKLSIIEEA+KR+A QSATTA
Sbjct  215  GHEFATRLGNVFTLGKGSKPWVSLPKGKGIKLSIIEEARKRMATQSATTA  264



>emb|CBI25428.3| unnamed protein product [Vitis vinifera]
Length=246

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVF IGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQ+A++A
Sbjct  197  GHEFATRLGNVFIIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQAASSA  246



>gb|KCW49428.1| hypothetical protein EUGRSUZ_K02962 [Eucalyptus grandis]
Length=187

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVF IGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ++ TA
Sbjct  138  GHEFATRLGNVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQASATA  187



>gb|ACU21243.1| unknown [Glycine max]
Length=123

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVF IGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+ T A
Sbjct  74   GHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQNETVA  123



>ref|XP_004233133.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKG+KPWVSLPKGKGIKLSIIEEA+KR+AAQSAT A
Sbjct  215  GHEFATRLGNVFTLGKGSKPWVSLPKGKGIKLSIIEEARKRMAAQSATAA  264



>ref|XP_004150397.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160251.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN44413.1| hypothetical protein Csa_7G282410 [Cucumis sativus]
Length=264

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEEA+KRLA+Q+A TA
Sbjct  215  GHEFATRLGNVFTVGKGTKPWVSLPKGKGIKLSIIEEARKRLASQAAVTA  264



>ref|XP_002268192.1| PREDICTED: 40S ribosomal protein S4-3-like [Vitis vinifera]
Length=264

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWV+LPKGKGIKLSIIEEAKKRLAAQ++ TA
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVTLPKGKGIKLSIIEEAKKRLAAQASATA  264



>gb|KJB38000.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=244

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQSA
Sbjct  197  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQSA  243



>ref|XP_007156131.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
 gb|ESW28125.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
Length=199

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KR++AQ +T A
Sbjct  150  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRISAQQSTAA  199



>ref|XP_002276986.1| PREDICTED: 40S ribosomal protein S4-1 [Vitis vinifera]
Length=264

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVF IGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQ+A++A
Sbjct  215  GHEFATRLGNVFIIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQAASSA  264



>ref|NP_001275148.1| 40S ribosomal protein S4 [Solanum tuberosum]
 sp|P46300.1|RS4_SOLTU RecName: Full=40S ribosomal protein S4 [Solanum tuberosum]
 emb|CAA54095.1| ribosomal protein S4 [Solanum tuberosum]
Length=264

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIE+A+KRLAAQSAT A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEDARKRLAAQSATPA  264



>ref|XP_008454823.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
 ref|XP_008454824.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
Length=264

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEA+KRLA+Q+A TA
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEARKRLASQAAVTA  264



>ref|XP_008461463.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVS+PKGKGIKLSIIEEA+KRLA+Q+A TA
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSVPKGKGIKLSIIEEARKRLASQAAVTA  264



>gb|KJB37999.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=262

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQSA
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQSA  261



>dbj|BAE20168.1| ribosomal protein S4 [Panax ginseng]
Length=264

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEA+KR  AQSATTA
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEARKRNVAQSATTA  264



>gb|KHN38535.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEEA+KR+AAQ AT A
Sbjct  215  GHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRIAAQQATAA  264



>gb|KHN10552.1| 40S ribosomal protein S4 [Glycine soja]
Length=199

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVF IGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+ T A
Sbjct  150  GHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQNETVA  199



>gb|KGN44410.1| hypothetical protein Csa_7G281390 [Cucumis sativus]
Length=264

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLA+Q+  TA
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLASQATVTA  264



>ref|XP_003547932.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
 gb|KHN01598.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEEA+KR+AAQ AT A
Sbjct  215  GHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRIAAQQATAA  264



>gb|ACU24626.1| unknown [Glycine max]
Length=264

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEEA+KR+AAQ AT A
Sbjct  215  GHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRIAAQQATAA  264



>ref|NP_001242281.1| uncharacterized protein LOC100812132 [Glycine max]
 gb|ACU23059.1| unknown [Glycine max]
Length=264

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEEA+KR+AAQ AT A
Sbjct  215  GHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRIAAQQATAA  264



>ref|XP_004150395.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160252.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
Length=264

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLA+Q+  TA
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLASQATVTA  264



>ref|NP_001235826.1| 40S ribosomal S4 protein [Glycine max]
 gb|AAM93434.1| 40S ribosomal S4 protein [Glycine max]
 gb|ACU21252.1| unknown [Glycine max]
Length=264

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEEA+KR+AAQ AT A
Sbjct  215  GHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRIAAQQATAA  264



>gb|KJB36905.1| hypothetical protein B456_006G184600 [Gossypium raimondii]
Length=237

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+A
Sbjct  190  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQNA  236



>ref|XP_006344073.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+K+LAAQSAT A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKKLAAQSATPA  264



>gb|KJB77064.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=244

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+A
Sbjct  197  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQNA  243



>gb|KJB77063.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=251

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+A
Sbjct  204  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQNA  250



>ref|XP_010037684.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW49427.1| hypothetical protein EUGRSUZ_K02962 [Eucalyptus grandis]
Length=264

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVF IGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ++ TA
Sbjct  215  GHEFATRLGNVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQASATA  264



>gb|KCW60005.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=197

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNV+ IGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ++ TA
Sbjct  148  GHEFATRLGNVYMIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQASATA  197



>gb|KHN00473.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=296

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVFTIGKGTKPW+SLPKGKGIKLSIIEEA+KR+AAQ AT A
Sbjct  247  GHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRIAAQQATAA  296



>ref|XP_007156130.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
 gb|ESW28124.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
Length=264

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KR++AQ +T A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRISAQQSTAA  264



>emb|CBI15899.3| unnamed protein product [Vitis vinifera]
Length=246

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVF IGKGTKPWV+LPKGKGIKLSIIEEA+KRLAAQ+A++A
Sbjct  197  GHEFATRLGNVFIIGKGTKPWVTLPKGKGIKLSIIEEAQKRLAAQAASSA  246



>gb|KJB71672.1| hypothetical protein B456_011G136800 [Gossypium raimondii]
Length=262

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQAA  261



>gb|KHG02041.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQAA  261



>gb|KHG26321.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQNA  261



>gb|KHG02126.1| 40S ribosomal S4 [Gossypium arboreum]
 gb|KJB36904.1| hypothetical protein B456_006G184600 [Gossypium raimondii]
 gb|KJB77062.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=262

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQNA  261



>gb|KHG30713.1| 40S ribosomal S4 [Gossypium arboreum]
Length=268

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+A
Sbjct  221  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQNA  267



>ref|XP_007050962.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOX95119.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQAA  261



>ref|XP_010023674.1| PREDICTED: 40S ribosomal protein S4-3 [Eucalyptus grandis]
 gb|KCW60003.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=264

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNV+ IGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ++ TA
Sbjct  215  GHEFATRLGNVYMIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQASATA  264



>ref|XP_002275063.1| PREDICTED: 40S ribosomal protein S4 [Vitis vinifera]
Length=264

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVF IGKGTKPWV+LPKGKGIKLSIIEEA+KRLAAQ+A++A
Sbjct  215  GHEFATRLGNVFIIGKGTKPWVTLPKGKGIKLSIIEEAQKRLAAQAASSA  264



>ref|XP_007026596.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOY07098.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLS+IEEA+KRLAAQ+A 
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSVIEEARKRLAAQNAV  262



>ref|XP_003516980.1| PREDICTED: 40S ribosomal protein S4 [Glycine max]
Length=264

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVF IGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+ T A
Sbjct  215  GHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQNETVA  264



>gb|KHN03095.1| 40S ribosomal protein S4 [Glycine soja]
Length=246

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVF IGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ  T A
Sbjct  197  GHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQKETVA  246



>ref|XP_006576177.1| PREDICTED: uncharacterized protein LOC100500000 isoform X2 [Glycine 
max]
Length=248

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVF IGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ  T A
Sbjct  199  GHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQKETVA  248



>ref|XP_010251772.1| PREDICTED: 40S ribosomal protein S4-like [Nelumbo nucifera]
Length=200

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKLSIIEEA+KR+ A +A+TA
Sbjct  151  GHEFATRLGNVFTMGKGTKPWVSLPKGKGIKLSIIEEARKRITATAASTA  200



>gb|KJB29916.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=244

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+  
Sbjct  197  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQATV  244



>ref|XP_010529053.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ A
Sbjct  215  GHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQQA  261



>ref|XP_008233807.1| PREDICTED: 40S ribosomal protein S4-1 [Prunus mume]
Length=264

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRL NVFTIGKGTKPWVSLPKGKGIKL+IIEEAKKR AAQ A+TA
Sbjct  215  GHEFATRLANVFTIGKGTKPWVSLPKGKGIKLTIIEEAKKRQAAQQASTA  264



>ref|XP_006374217.1| 40S ribosomal protein S4 [Populus trichocarpa]
 gb|ERP52014.1| 40S ribosomal protein S4 [Populus trichocarpa]
Length=263

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATRLGNVFTIGKGTKPW+SLPKGKGIKLSIIEEA+KRLAA  AT
Sbjct  215  GHEFATRLGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRLAASQAT  262



>ref|XP_011035547.1| PREDICTED: 40S ribosomal protein S4-1 [Populus euphratica]
Length=263

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATRLGNVFTIGKGTKPW+SLPKGKGIKLSIIEEA+KRLAA  AT
Sbjct  215  GHEFATRLGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRLAASQAT  262



>ref|XP_006576176.1| PREDICTED: uncharacterized protein LOC100500000 isoform X1 [Glycine 
max]
Length=264

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVF IGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ  T A
Sbjct  215  GHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQKETVA  264



>emb|CDP06439.1| unnamed protein product [Coffea canephora]
Length=246

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVF IGKG KPWVSLPKGKGIKLS+IEE +KR+AAQ+ATTA
Sbjct  197  GHEFATRLGNVFIIGKGAKPWVSLPKGKGIKLSVIEEQRKRIAAQAATTA  246



>emb|CDP16509.1| unnamed protein product [Coffea canephora]
Length=105

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVF IGKG KPWVSLPKGK IKLS+IEE +KR+AAQ+ATTA
Sbjct  56   GHEFATRLGNVFIIGKGAKPWVSLPKGKCIKLSVIEEQRKRIAAQAATTA  105



>gb|KJB29915.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=262

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+  
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQATV  262



>gb|KHG30303.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAAQ+  
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAQATV  262



>ref|XP_006399188.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
 gb|ESQ40641.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
Length=262

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRL+AQ A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLSAQQA  261



>ref|XP_006401084.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
 gb|ESQ42537.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
Length=312

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEA+KRLAAQ A
Sbjct  265  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEARKRLAAQQA  311



>ref|XP_007218753.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
 gb|EMJ19952.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
Length=296

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRL NVFTIGKGTKPWVSLPKGKGIKL+IIEEAKKR AAQ A+TA
Sbjct  247  GHEFATRLANVFTIGKGTKPWVSLPKGKGIKLTIIEEAKKRQAAQQASTA  296



>gb|KJB17111.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=191

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPK KGIKLSIIEEA+KRLAAQ+A
Sbjct  144  GHEFATRLGNVFTIGKGTKPWVSLPKRKGIKLSIIEEARKRLAAQNA  190



>ref|XP_010036744.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW88215.1| hypothetical protein EUGRSUZ_A00608 [Eucalyptus grandis]
Length=264

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVF IGKG+KPW+SLPKGKGIKLSIIEEA+KRLAAQ++ TA
Sbjct  215  GHEFATRLGNVFIIGKGSKPWLSLPKGKGIKLSIIEEARKRLAAQASATA  264



>gb|KJB17112.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=237

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPK KGIKLSIIEEA+KRLAAQ+A
Sbjct  190  GHEFATRLGNVFTIGKGTKPWVSLPKRKGIKLSIIEEARKRLAAQNA  236



>ref|XP_003604568.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES86765.1| 40S ribosomal S4-like protein [Medicago truncatula]
Length=264

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL++IEEA+KR AAQ+ T A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTVIEEARKRQAAQNVTAA  264



>ref|XP_010553232.1| PREDICTED: 40S ribosomal protein S4-3 isoform X1 [Tarenaya hassleriana]
Length=263

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLA+Q A
Sbjct  216  GHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLASQQA  262



>ref|XP_009345329.1| PREDICTED: 40S ribosomal protein S4 [Pyrus x bretschneideri]
Length=171

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEAKKR AA  A TA
Sbjct  122  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEAKKRQAALQAATA  171



>ref|XP_010553233.1| PREDICTED: 40S ribosomal protein S4-3 isoform X2 [Tarenaya hassleriana]
Length=262

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLA+Q A
Sbjct  215  GHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLASQQA  261



>dbj|BAH57121.1| AT5G07090 [Arabidopsis thaliana]
Length=197

 Score = 91.3 bits (225),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEEA+KRLA+Q A
Sbjct  150  GHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKRLASQQA  196



>ref|XP_010529903.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRL AQ A
Sbjct  215  GHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLVAQQA  261



>ref|XP_002318967.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
 gb|ABK94293.1| unknown [Populus trichocarpa]
 gb|EEE94890.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
Length=263

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPW+SLPKGKGIKLSIIEEAKKRLAA  A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWISLPKGKGIKLSIIEEAKKRLAASQA  261



>gb|KFK27370.1| hypothetical protein AALP_AA8G374100 [Arabis alpina]
Length=262

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRLAAQ A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLAAQQA  261



>ref|XP_002884052.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60311.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=261

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  261



>ref|XP_006409322.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 ref|XP_006411040.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
 gb|ESQ50775.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 gb|ESQ52493.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
Length=262

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  261



>emb|CDP12458.1| unnamed protein product [Coffea canephora]
Length=83

 Score = 88.2 bits (217),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GH+FATRLGNVF IGKG KPWVSLPKGKGIKLS+IEE +KR+AAQ+A TA
Sbjct  34   GHKFATRLGNVFIIGKGAKPWVSLPKGKGIKLSVIEEQRKRIAAQAAITA  83



>gb|KFK36724.1| hypothetical protein AALP_AA4G161500 [Arabis alpina]
Length=262

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  261



>sp|P46299.1|RS4_GOSHI RecName: Full=40S ribosomal protein S4 [Gossypium hirsutum]
 emb|CAA55882.1| ribosomal protein, small subunit 4e (RS4e) [Gossypium hirsutum]
 gb|KJB17110.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=262

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPK KGIKLSIIEEA+KRLAAQ+A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKRKGIKLSIIEEARKRLAAQNA  261



>ref|XP_006411034.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
 gb|ESQ52487.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
Length=288

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  241  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  287



>ref|XP_010509192.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=244

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  197  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  243



>gb|ACJ84252.1| unknown [Medicago truncatula]
Length=196

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGN FTIGKGTKPWVSLPKGKGIKL++IEEA+KR AAQ+ T A
Sbjct  147  GHEFATRLGNAFTIGKGTKPWVSLPKGKGIKLTVIEEARKRQAAQNVTAA  196



>ref|NP_001031846.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 gb|AED91108.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=244

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEEA+KRLA+Q A
Sbjct  197  GHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKRLASQQA  243



>dbj|BAB10257.1| ribosomal protein S4 [Arabidopsis thaliana]
Length=244

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEEA+KRLA+Q A
Sbjct  197  GHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKRLASQQA  243



>ref|XP_010934423.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAA  A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAASGA  261



>emb|CDY58877.1| BnaA03g55550D [Brassica napus]
Length=279

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  232  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  278



>ref|XP_011023749.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPW+SLPKGKGIKLSIIEEA+KRLAA  A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRLAASQA  261



>ref|XP_009368564.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPW+SLPKGKGIKL+IIEEAKKR A Q+  TA
Sbjct  215  GHEFATRLGNVFTIGKGTKPWISLPKGKGIKLTIIEEAKKRAAGQATATA  264



>ref|XP_009130977.1| PREDICTED: 40S ribosomal protein S4-1-like [Brassica rapa]
Length=262

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  261



>emb|CDX70008.1| BnaA10g23570D [Brassica napus]
Length=269

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  222  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  268



>ref|XP_009122377.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  261



>ref|XP_002515668.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF46720.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAA  A 
Sbjct  215  GHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAAAQAV  262



>emb|CDX81032.1| BnaC03g02860D [Brassica napus]
Length=279

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  232  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  278



>ref|XP_009132054.1| PREDICTED: 40S ribosomal protein S4-2-like [Brassica rapa]
Length=262

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEAKKRLA Q A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEAKKRLAGQQA  261



>ref|XP_009125675.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  261



>gb|KFK25102.1| hypothetical protein AALP_AA8G066400 [Arabis alpina]
Length=262

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  261



>ref|XP_006288484.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
 ref|XP_010452659.1| PREDICTED: 40S ribosomal protein S4-3 [Camelina sativa]
 gb|EOA21382.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
Length=262

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRLA+Q A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLASQQA  261



>ref|XP_010517120.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  261



>ref|XP_010515129.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010467507.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010489362.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
Length=262

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  261



>ref|NP_565414.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
 sp|Q93VH9.1|RS41_ARATH RecName: Full=40S ribosomal protein S4-1 [Arabidopsis thaliana]
 gb|AAK43846.1|AF370469_1 Unknown protein [Arabidopsis thaliana]
 gb|AAK59636.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL34157.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL47338.1| unknown protein [Arabidopsis thaliana]
 gb|AAM60830.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AEC06616.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
Length=261

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  215  GHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  261



>emb|CDX99006.1| BnaC09g48290D [Brassica napus]
Length=288

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  241  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  287



>ref|NP_568179.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 sp|P49204.4|RS42_ARATH RecName: Full=40S ribosomal protein S4-2 [Arabidopsis thaliana]
 emb|CAB87265.1| ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAK93610.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL50106.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAL85148.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAM10339.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAM61755.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AED91107.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=262

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEEA+KRLA+Q A
Sbjct  215  GHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKRLASQQA  261



>gb|AAL49933.1| AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAN28773.1| At5g58420/mqj2_10 [Arabidopsis thaliana]
Length=262

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEEA+KRLA+Q A
Sbjct  215  GHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKRLASQQA  261



>ref|XP_010491309.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRLA+Q A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLASQQA  261



>dbj|BAB11167.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
Length=263

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEEA+KRLA+Q A
Sbjct  216  GHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKRLASQQA  262



>emb|CDY14056.1| BnaC02g01730D [Brassica napus]
Length=291

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  244  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  290



>ref|NP_200650.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
 sp|Q8VYK6.2|RS43_ARATH RecName: Full=40S ribosomal protein S4-3 [Arabidopsis thaliana]
 gb|AAL16117.1|AF428285_1 AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAM64284.1| ribosomal protein S4-like [Arabidopsis thaliana]
 gb|AED97051.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
Length=262

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEEA+KRLA+Q A
Sbjct  215  GHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKRLASQQA  261



>ref|XP_011046821.1| PREDICTED: 40S ribosomal protein S4-3 [Populus euphratica]
Length=263

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKG+KPW+SLPKGKGIKLSIIEEAKKRLAA  A
Sbjct  215  GHEFATRLGNVFTIGKGSKPWISLPKGKGIKLSIIEEAKKRLAASQA  261



>emb|CDY60025.1| BnaAnng16450D [Brassica napus]
Length=285

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEAKKRLA Q A
Sbjct  238  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEAKKRLAGQQA  284



>ref|XP_002323021.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
 gb|EEF04782.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
Length=263

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKG+KPW+SLPKGKGIKLSIIEEAKKRLAA  A
Sbjct  215  GHEFATRLGNVFTIGKGSKPWISLPKGKGIKLSIIEEAKKRLAASQA  261



>ref|XP_002871248.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47507.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPW+SLPKGKGIKL+IIEEA+KRLA+Q A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWMSLPKGKGIKLTIIEEARKRLASQQA  261



>emb|CDY69841.1| BnaAnng31720D [Brassica napus]
Length=311

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEAKKRLA Q A
Sbjct  264  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEAKKRLAGQQA  310



>ref|XP_002322175.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
 gb|EEF06302.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
Length=263

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQS  248
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAA  
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAASQ  260



>ref|XP_008809054.1| PREDICTED: 40S ribosomal protein S4-like [Phoenix dactylifera]
Length=200

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRL NVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAA  A
Sbjct  150  GHEFATRLANVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAASGA  196



>gb|EYU19705.1| hypothetical protein MIMGU_mgv1a012053mg [Erythranthe guttata]
Length=263

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATRLGNV+TIGKG+KPWVSLPKGKGIKL+IIEEA+KR+ +QSAT
Sbjct  215  GHEFATRLGNVYTIGKGSKPWVSLPKGKGIKLTIIEEARKRITSQSAT  262



>gb|EPS63485.1| hypothetical protein M569_11297, partial [Genlisea aurea]
Length=262

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATRLGNVF IGKGTKPWVSLPKGKGIKLSIIEEA+KR+AA SA+
Sbjct  214  GHEFATRLGNVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRIAAPSAS  261



>emb|CDY57385.1| BnaCnng31910D [Brassica napus]
Length=298

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRLA Q A
Sbjct  251  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLAGQQA  297



>ref|XP_010938423.1| PREDICTED: 40S ribosomal protein S4-3 [Elaeis guineensis]
Length=265

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAA  A
Sbjct  215  GHEFATRIGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAASGA  261



>ref|XP_006280972.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
 gb|EOA13870.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
Length=262

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRLA Q A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLAGQQA  261



>ref|XP_010443578.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X1 [Camelina 
sativa]
 ref|XP_010443579.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X2 [Camelina 
sativa]
Length=262

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRLA Q A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLAGQQA  261



>ref|XP_004307685.1| PREDICTED: 40S ribosomal protein S4-like [Fragaria vesca subsp. 
vesca]
Length=264

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKG+GIKLSIIEEA+KR AA  A+ A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGRGIKLSIIEEARKRQAALQASAA  264



>emb|CDY32700.1| BnaA02g07620D [Brassica napus]
Length=301

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQ  251
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRLAAQ
Sbjct  257  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLAAQ  301



>ref|XP_011046165.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 1/50 (2%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAA S T A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAA-SQTAA  263



>ref|XP_006298349.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
 gb|EOA31247.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
Length=262

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ +
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQS  261



>ref|XP_009126753.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X2 [Brassica 
rapa]
Length=319

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQ  251
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRLAAQ
Sbjct  275  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLAAQ  319



>gb|KHG11751.1| 40S ribosomal S4 [Gossypium arboreum]
Length=244

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTK WV LPKGKGIKLSIIEEA+KRLAAQSA
Sbjct  197  GHEFATRLGNVFTIGKGTKLWVLLPKGKGIKLSIIEEARKRLAAQSA  243



>emb|CDY02821.1| BnaC02g10680D [Brassica napus]
Length=275

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQ  251
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRLAAQ
Sbjct  231  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLAAQ  275



>ref|XP_009126752.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X1 [Brassica 
rapa]
Length=348

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQ  251
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRLAAQ
Sbjct  304  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLAAQ  348



>ref|XP_008789926.1| PREDICTED: 40S ribosomal protein S4-1 isoform X2 [Phoenix dactylifera]
Length=263

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATT  239
            GHEFATR+GNVFT+GKGTKPWVSLPKGKGIKLSIIEEA+KRLAA +   
Sbjct  215  GHEFATRIGNVFTVGKGTKPWVSLPKGKGIKLSIIEEARKRLAASACCN  263



>ref|XP_004294780.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEA+KR AA    TA
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEARKRQAALQTATA  264



>ref|XP_002512717.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF50169.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 1/50 (2%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLAA S T A
Sbjct  215  GHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAA-SQTAA  263



>ref|XP_010243101.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=264

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KR+AA +A+TA
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRIAAAAASTA  264



>ref|XP_009120350.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+ Q A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSGQQA  261



>emb|CDY32986.1| BnaA10g11920D [Brassica napus]
Length=288

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+ Q A
Sbjct  241  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSGQQA  287



>gb|ABK92450.1| unknown [Populus trichocarpa]
Length=263

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKG+KPW+SLPKGKGIKLSIIEEAK+RLAA  A
Sbjct  215  GHEFATRLGNVFTIGKGSKPWISLPKGKGIKLSIIEEAKERLAASQA  261



>ref|XP_002864574.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40833.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEA+KRLA Q  
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEARKRLAGQQV  261



>gb|EYU41945.1| hypothetical protein MIMGU_mgv1a012043mg [Erythranthe guttata]
Length=263

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            G+EFATRL NV+TIGKGTKPWVSLPKGKGIK +IIEEA+KRLAAQSAT
Sbjct  215  GNEFATRLSNVYTIGKGTKPWVSLPKGKGIKFTIIEEARKRLAAQSAT  262



>gb|KDO67007.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
 gb|KDO67008.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=200

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KR A  ++  A
Sbjct  150  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRQALATSAAA  199



>ref|XP_008778562.1| PREDICTED: 40S ribosomal protein S4-3-like [Phoenix dactylifera]
Length=247

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFTIGKGTK WVSLPKGKGIKLSIIEEA+KRLAA  A
Sbjct  197  GHEFATRLGNVFTIGKGTKAWVSLPKGKGIKLSIIEEARKRLAASGA  243



>ref|XP_010483440.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL  Q A 
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLGDQQAV  262



>ref|XP_010453688.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL  Q A
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLGDQQA  261



>ref|XP_008789925.1| PREDICTED: 40S ribosomal protein S4-1 isoform X1 [Phoenix dactylifera]
Length=319

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAA  254
            GHEFATR+GNVFT+GKGTKPWVSLPKGKGIKLSIIEEA+KRLAA
Sbjct  215  GHEFATRIGNVFTVGKGTKPWVSLPKGKGIKLSIIEEARKRLAA  258



>emb|CDY05015.1| BnaAnng01970D [Brassica napus]
Length=305

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA KRL+AQ A
Sbjct  258  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEAWKRLSAQQA  304



>ref|XP_010921843.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=209

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATRLGNVFTIGKGTKPWVSLPKGKG+KLSII+E +KRLAA   T
Sbjct  159  GHEFATRLGNVFTIGKGTKPWVSLPKGKGVKLSIIKEDRKRLAASGVT  206


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 2/42 (5%)
 Frame = -2

Query  337  GTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA*MHCRLSS  212
            GTKPWVSLPK K +KLSII+E +KRLAA  A  A M C++ S
Sbjct  32   GTKPWVSLPKRKSVKLSIIKEDRKRLAASGA--AAMLCKVRS  71



>gb|KDO67006.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=247

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KR A  ++  A
Sbjct  197  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRQALATSAAA  246



>emb|CDX91445.1| BnaC04g07050D [Brassica napus]
Length=162

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFATRLGNVFT+GKGTKPW SLPKGKGIKL+IIEEA+KRL+ Q A
Sbjct  115  GHEFATRLGNVFTLGKGTKPWASLPKGKGIKLTIIEEARKRLSTQQA  161



>gb|KDP30648.1| hypothetical protein JCGZ_16213 [Jatropha curcas]
Length=263

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAA  254
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRLA 
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRLAT  258



>ref|XP_006488578.1| PREDICTED: 40S ribosomal protein S4-like [Citrus sinensis]
 gb|KDO67005.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=265

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KR A  ++  A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRQALATSAAA  264



>gb|KDO67004.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=272

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KR A  ++  A
Sbjct  222  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRQALATSAAA  271



>ref|XP_009391002.1| PREDICTED: 40S ribosomal protein S4-3 [Musa acuminata subsp. 
malaccensis]
Length=265

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRL  260
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRL
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRL  256



>ref|XP_010907826.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRL  260
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRL
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRL  256



>ref|XP_009385022.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRL  260
            GHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRL
Sbjct  215  GHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRL  256



>ref|XP_010423256.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=258

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/44 (91%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAA  254
            GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRLA+
Sbjct  215  GHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLAS  258



>ref|XP_009402521.1| PREDICTED: 40S ribosomal protein S4-3-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRL  260
            GHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRL
Sbjct  215  GHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRL  256



>ref|XP_010276734.1| PREDICTED: 40S ribosomal protein S4-3 [Nelumbo nucifera]
Length=267

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRL  260
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KR+
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRI  256



>ref|XP_008356229.1| PREDICTED: 40S ribosomal protein S4-3-like [Malus domestica]
Length=269

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/41 (100%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR
Sbjct  219  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  259



>ref|XP_009369565.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/41 (100%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  255



>ref|XP_009381027.1| PREDICTED: 40S ribosomal protein S4-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRL  260
            GHEFATR+GNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KRL
Sbjct  215  GHEFATRMGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRL  256



>ref|XP_009354210.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=265

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/41 (100%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  255



>ref|XP_010243078.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=265

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRL  260
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KR+
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRI  256



>ref|XP_004492491.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=264

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            G+EFATRL NVFTIGKGTKPWVSLPKG+GIKL++IEEA+KR+AAQ    A
Sbjct  215  GNEFATRLSNVFTIGKGTKPWVSLPKGRGIKLTVIEEARKRIAAQQVAAA  264



>ref|XP_011019071.1| PREDICTED: 40S ribosomal protein S4-3-like [Populus euphratica]
Length=263

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 1/50 (2%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKG+KPW+SLPKGKGIKLSIIEEA+KR AA S T A
Sbjct  215  GHEFATRLGNVFTIGKGSKPWISLPKGKGIKLSIIEEARKRQAA-SQTAA  263



>ref|XP_002308235.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
 gb|EEE91758.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
Length=263

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 1/50 (2%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKG+KPW+SLPKGKGIKLSIIEEA+KR AA S T A
Sbjct  215  GHEFATRLGNVFTIGKGSKPWISLPKGKGIKLSIIEEARKRQAA-SQTAA  263



>ref|XP_004293830.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/41 (98%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEAKKR
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEAKKR  255



>ref|XP_007211867.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
 ref|XP_008225941.1| PREDICTED: 40S ribosomal protein S4-like [Prunus mume]
 gb|EMJ13066.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
Length=264

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/41 (98%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEEAKKR
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEAKKR  255



>ref|XP_009393217.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRL  260
            GHEFATRLGNVFTIGK TKPWVSLPKGKGIKLSIIEEA+KRL
Sbjct  215  GHEFATRLGNVFTIGKATKPWVSLPKGKGIKLSIIEEARKRL  256



>ref|XP_009369212.1| PREDICTED: 40S ribosomal protein S4-3 [Pyrus x bretschneideri]
Length=264

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATRLGNVFTIGKGTKPWVSLPKG+GIKL+IIEEAKKR
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGRGIKLTIIEEAKKR  255



>ref|XP_008801072.1| PREDICTED: 40S ribosomal protein S4-like [Phoenix dactylifera]
Length=195

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GHEFAT LGNVFTIGKGTKPWVSLPKGK IKLSIIEEA+K+LAA  A
Sbjct  145  GHEFATCLGNVFTIGKGTKPWVSLPKGKCIKLSIIEEARKQLAASGA  191



>gb|EPS70681.1| hypothetical protein M569_04077, partial [Genlisea aurea]
Length=256

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/43 (93%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLA  257
            GHEFATRLGNVF IGKGTKPWVSLPKGKGIKLSIIEEA+KR+A
Sbjct  214  GHEFATRLGNVFIIGKGTKPWVSLPKGKGIKLSIIEEARKRVA  256



>sp|O81363.1|RS4_PRUAR RecName: Full=40S ribosomal protein S4 [Prunus armeniaca]
 gb|AAC24585.1| 40S ribosomal protein S4 [Prunus armeniaca]
Length=261

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+I+EEAKKR
Sbjct  211  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTILEEAKKR  251



>ref|XP_008234249.1| PREDICTED: 40S ribosomal protein S4 [Prunus mume]
Length=265

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+I+EEAKKR
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTILEEAKKR  255



>ref|XP_008343651.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S4-like, 
partial [Malus domestica]
Length=152

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATRLGNVFTIGKG KPWVSLPKGKGIKL+IIEEAKKR
Sbjct  103  GHEFATRLGNVFTIGKGGKPWVSLPKGKGIKLTIIEEAKKR  143



>ref|XP_002455616.1| hypothetical protein SORBIDRAFT_03g014423 [Sorghum bicolor]
 gb|EES00736.1| hypothetical protein SORBIDRAFT_03g014423 [Sorghum bicolor]
Length=67

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR-LAAQSA  245
            GH FATR+GNVFTIGKG KPWVSLPKGKGIKLSIIEE +KR  AAQ+A
Sbjct  20   GHAFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKRDAAAQTA  67



>ref|XP_008374283.1| PREDICTED: 40S ribosomal protein S4 isoform X2 [Malus domestica]
 ref|XP_008374289.1| PREDICTED: 40S ribosomal protein S4 isoform X2 [Malus domestica]
 ref|XP_008374295.1| PREDICTED: 40S ribosomal protein S4 isoform X2 [Malus domestica]
Length=159

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATRLGNVFTIGKG KPWVSLPKG GIKL+IIEEAKKR
Sbjct  110  GHEFATRLGNVFTIGKGXKPWVSLPKGXGIKLTIIEEAKKR  150



>gb|ACF79718.1| unknown [Zea mays]
Length=102

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH+FATR+GNVFTIGKG KPWVSLPKGKGIKLSIIEE +KR
Sbjct  52   GHQFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKR  92



>ref|XP_010666843.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 1/48 (2%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATR+GNVF IGKGTKPWVSLPKGKGIKL+IIEEA+KR A ++AT
Sbjct  215  GHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLTIIEEARKR-AEKTAT  261



>ref|XP_010685909.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 1/48 (2%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATR+GNVF IGKGTKPWVSLPKGKGIKL+IIEEA+KR A ++AT
Sbjct  215  GHEFATRMGNVFIIGKGTKPWVSLPKGKGIKLTIIEEARKR-AEKTAT  261



>emb|CDX91447.1| BnaC04g07030D [Brassica napus]
Length=49

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  370  TRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            TRLGNVFT+GKGTKPWVSLPKGKGIKL+IIEEA+KRL+AQ A
Sbjct  7    TRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA  48



>ref|XP_008659461.1| PREDICTED: 40S ribosomal protein S4-like [Zea mays]
Length=96

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR-LAAQSATTA  236
            GH+FATR+GNVFTIGKG KPWVSLPKG GIKLSIIEE ++R   AQ+   A
Sbjct  46   GHQFATRMGNVFTIGKGNKPWVSLPKGNGIKLSIIEEQRRRDFIAQATANA  96



>ref|XP_008374276.1| PREDICTED: 40S ribosomal protein S4 isoform X1 [Malus domestica]
Length=171

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATRLGNVFTIGKG KPWVSLPKG GIKL+IIEEAKKR
Sbjct  122  GHEFATRLGNVFTIGKGXKPWVSLPKGXGIKLTIIEEAKKR  162



>ref|XP_003568916.1| PREDICTED: 40S ribosomal protein S4 [Brachypodium distachyon]
Length=265

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH+FATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE +KR
Sbjct  215  GHQFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEQRKR  255



>gb|ACL51789.1| putative ribosomal protein S4, partial [Picea abies]
 gb|ACL51790.1| putative ribosomal protein S4, partial [Picea glauca]
Length=71

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            G EFATR GNVFTIGKGTKPWVSLPKGKG+KLSIIEEA+KR
Sbjct  23   GQEFATRQGNVFTIGKGTKPWVSLPKGKGVKLSIIEEARKR  63



>dbj|BAJ94984.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS49926.1| 40S ribosomal protein S4 [Triticum urartu]
 gb|EMT30796.1| 40S ribosomal protein S4 [Aegilops tauschii]
Length=265

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH+FATRLGNVFTIGKGTKPWVSLPKGKGIKL+IIEE +KR
Sbjct  215  GHQFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEEQRKR  255



>ref|XP_008678574.1| PREDICTED: 40S ribosomal protein S4-like [Zea mays]
Length=249

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR-LAAQSATTA  236
            GH+FAT++GNVFTIGKG KPWVSLPKG+GIKLSIIEE ++R   AQ+A  A
Sbjct  199  GHQFATQMGNVFTIGKGNKPWVSLPKGRGIKLSIIEEQRRRDFIAQAAANA  249



>ref|XP_003623356.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES79574.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AFK36229.1| unknown [Medicago truncatula]
Length=265

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRL  260
            GHEFATRLGNVFTIG+G KPWVSLPKG+GIKL++IEEA+KR+
Sbjct  215  GHEFATRLGNVFTIGRGPKPWVSLPKGRGIKLTVIEEARKRM  256



>ref|XP_006646768.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH+FATRLGNVFTIGKG KPWVSLPKGKGIKLSIIEE +KR
Sbjct  215  GHQFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKR  255



>ref|XP_004960263.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=265

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH+FATRLGNVFTIGKG KPWVSLPKGKGIKLSIIEE +KR
Sbjct  215  GHQFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKR  255



>ref|XP_010676809.1| PREDICTED: 40S ribosomal protein S4-1-like [Beta vulgaris subsp. 
vulgaris]
Length=263

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATR GNVF IGKGTKPWVS+PKGKGIKL+IIEEA+KR   + ATTA
Sbjct  215  GHEFATRQGNVFIIGKGTKPWVSVPKGKGIKLTIIEEARKR-QQKEATTA  263



>ref|NP_001045624.1| Os02g0105900 [Oryza sativa Japonica Group]
 sp|P49398.3|RS4_ORYSJ RecName: Full=40S ribosomal protein S4; AltName: Full=SCAR protein 
SS620 [Oryza sativa Japonica Group]
 pdb|3J60|E Chain E, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD28085.1| putative ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF07538.1| Os02g0105900 [Oryza sativa Japonica Group]
 gb|EAY84111.1| hypothetical protein OsI_05494 [Oryza sativa Indica Group]
 gb|EAZ21423.1| hypothetical protein OsJ_05027 [Oryza sativa Japonica Group]
 gb|ACA50490.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAG96339.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95549.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86872.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=265

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH+FATRLGNVFTIGKG KPWVSLPKGKGIKLSIIEE +KR
Sbjct  215  GHQFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKR  255



>ref|XP_002439678.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
 gb|EES18108.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
Length=263

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GH+FATR+GNVFTIGK  KPWVSLPKGKGIKLSIIEEA+KR A  +A
Sbjct  215  GHQFATRMGNVFTIGKDKKPWVSLPKGKGIKLSIIEEARKRNAEAAA  261



>dbj|BAD22763.1| ribosomal protein [Bromus inermis]
Length=265

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH+FATRLGNVFTIGKGTKPWV+LPKGKGIKL+IIEE +KR
Sbjct  215  GHQFATRLGNVFTIGKGTKPWVTLPKGKGIKLTIIEEQRKR  255



>ref|XP_007157713.1| hypothetical protein PHAVU_002G092000g [Phaseolus vulgaris]
 gb|ESW29707.1| hypothetical protein PHAVU_002G092000g [Phaseolus vulgaris]
Length=143

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 2/48 (4%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            GHEFATRLGNVFTIGKGT+  VSLPKGKGI+LSIIEEA+K+++AQ AT
Sbjct  96   GHEFATRLGNVFTIGKGTR--VSLPKGKGIELSIIEEARKKISAQQAT  141



>gb|ACJ70374.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70375.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70376.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70377.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70378.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70379.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70380.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70381.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70382.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70383.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70384.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70385.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70386.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70387.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70388.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70389.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70390.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70391.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70392.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70393.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70394.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70395.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70396.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70397.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70398.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70399.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70400.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70401.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70402.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70403.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70404.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70405.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70406.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70407.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70408.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70409.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70410.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70411.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70412.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACJ70413.1| putative ribosomal protein S4, partial [Pinus sylvestris]
 gb|ACL51784.1| putative ribosomal protein S4, partial [Pinus contorta]
 gb|ACL51785.1| putative ribosomal protein S4, partial [Pinus nigra]
 gb|ACL51786.1| putative ribosomal protein S4, partial [Pinus pinaster]
 gb|ACL51787.1| putative ribosomal protein S4, partial [Pinus ponderosa]
 gb|ACL51788.1| putative ribosomal protein S4, partial [Pinus resinosa]
Length=71

 Score = 77.4 bits (189),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            G EFATR GNVFTIGKGTKPWVSLPKGKG+KLSII+EA+KR
Sbjct  23   GQEFATRQGNVFTIGKGTKPWVSLPKGKGVKLSIIDEARKR  63



>ref|XP_002463552.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
 gb|EER90550.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
Length=264

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH+FATR+GNVFTIGKG KPWVSLPKGKGIKLSIIEE +KR
Sbjct  215  GHQFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKR  255



>ref|NP_001266498.1| 40S ribosomal protein S4 [Zea mays]
 sp|O22424.1|RS4_MAIZE RecName: Full=40S ribosomal protein S4 [Zea mays]
 gb|AAB66899.1| ribosomal protein S4 type I [Zea mays]
 gb|ACF83328.1| unknown [Zea mays]
 gb|ACG30922.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG34655.1| 40S ribosomal protein S4 [Zea mays]
 gb|AFW67028.1| putative ribosomal protein S4 (RPS4A) family protein [Zea mays]
Length=265

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH+FATR+GNVFTIGKG KPWVSLPKGKGIKLSIIEE +KR
Sbjct  215  GHQFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKR  255



>gb|AAT38019.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=245

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GH+FATR+GNVFTIGK  KPWVSLPKGKGIKLSIIEEA+KR A  +A
Sbjct  197  GHQFATRMGNVFTIGKERKPWVSLPKGKGIKLSIIEEARKRNAEAAA  243



>gb|AAS48726.1| ribosomal protein S4 [Zea mays]
Length=265

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH+FATR+GNVFTIGKG KPWVSLPKGKGIKLSIIEE +KR
Sbjct  215  GHQFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKR  255



>gb|KDP45131.1| hypothetical protein JCGZ_17463 [Jatropha curcas]
Length=264

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSATTA  236
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEA+KR AA + T A
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEARKRQAAAAQTVA  264



>ref|XP_006851828.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
 gb|ERN13295.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
Length=268

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  382  HEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            HEFATRLGNVFTIGK +KPWVSLPKGKGIKLSIIEEA+KR
Sbjct  220  HEFATRLGNVFTIGKASKPWVSLPKGKGIKLSIIEEARKR  259



>ref|NP_001055342.1| Os05g0368300 [Oryza sativa Japonica Group]
 dbj|BAF17256.1| Os05g0368300 [Oryza sativa Japonica Group]
Length=263

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GH+FATR+GNVFTIGK  KPWVSLPKGKGIKLSIIEEA+KR A  +A
Sbjct  215  GHQFATRMGNVFTIGKERKPWVSLPKGKGIKLSIIEEARKRNAEAAA  261



>gb|EAY97774.1| hypothetical protein OsI_19685 [Oryza sativa Indica Group]
Length=279

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GH+FATR+GNVFTIGK  KPWVSLPKGKGIKLSIIEEA+KR A  +A
Sbjct  231  GHQFATRMGNVFTIGKERKPWVSLPKGKGIKLSIIEEARKRNAEAAA  277



>ref|NP_001043015.1| Os01g0358400 [Oryza sativa Japonica Group]
 dbj|BAD52963.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF04929.1| Os01g0358400 [Oryza sativa Japonica Group]
 gb|EAY74000.1| hypothetical protein OsI_01884 [Oryza sativa Indica Group]
 gb|EAZ11863.1| hypothetical protein OsJ_01737 [Oryza sativa Japonica Group]
 gb|ABR25672.1| 40S ribosomal protein S4 [Oryza sativa Indica Group]
 dbj|BAG88133.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH FATRLGNVFTIGKG KPWVSLPKGKGIKLSIIEE +KR
Sbjct  215  GHAFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKR  255



>ref|NP_001288485.1| 40S ribosomal protein S4-like [Zea mays]
 gb|AAB67831.1| ribsomal protein S4 [Zea mays]
 gb|ACF87994.1| unknown [Zea mays]
 gb|ACG25377.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG45984.1| 40S ribosomal protein S4 [Zea mays]
 tpg|DAA52405.1| TPA: ribosomal protein S4 [Zea mays]
Length=265

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH+FATR+GNVFTIGKG KPWVSLPKGKGIKLSIIEE ++R
Sbjct  215  GHQFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRRR  255



>ref|XP_006644163.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH FATRLGNVFTIGKG KPWVSLPKGKGIKLSIIEE +KR
Sbjct  215  GHAFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKR  255



>ref|XP_006645886.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=285

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH FATRLGNVFTIGKG KPWVSLPKGKGIKLSIIEE +KR
Sbjct  235  GHAFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKR  275



>ref|XP_007141735.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 ref|XP_007141738.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
 gb|ESW13729.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 gb|ESW13732.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
Length=264

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATRL NVFTIGKGTKP +SLPKGKGIKLSIIEEA+KR
Sbjct  215  GHEFATRLANVFTIGKGTKPLISLPKGKGIKLSIIEEARKR  255



>ref|XP_004962295.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=262

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLA  257
            GH+FATR+GNVFTIGK  KPWVSLPKGKGIKLSIIEEA+KR A
Sbjct  215  GHQFATRMGNVFTIGKDKKPWVSLPKGKGIKLSIIEEARKRNA  257



>ref|XP_002455614.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
 gb|EES00734.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
Length=265

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GH FATR+GNVFTIGKG KPWVSLPKGKGIKLSIIEE +KR
Sbjct  215  GHAFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKR  255



>gb|ABK22322.1| unknown [Picea sitchensis]
 gb|ABK22679.1| unknown [Picea sitchensis]
 gb|ACN39835.1| unknown [Picea sitchensis]
 gb|ACN40504.1| unknown [Picea sitchensis]
 gb|ACN40833.1| unknown [Picea sitchensis]
Length=263

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            G EFATR GNVFTIGKGTKPWVSLPKGKG+KLSIIEEA+KR
Sbjct  215  GQEFATRQGNVFTIGKGTKPWVSLPKGKGVKLSIIEEARKR  255



>gb|ABK21170.1| unknown [Picea sitchensis]
 gb|ABK22318.1| unknown [Picea sitchensis]
 gb|ABR17884.1| unknown [Picea sitchensis]
Length=263

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            G EFATR GNVFTIGKGTKPWVSLPKGKG+KLSIIEEA+KR
Sbjct  215  GQEFATRQGNVFTIGKGTKPWVSLPKGKGVKLSIIEEARKR  255



>gb|EEE63465.1| hypothetical protein OsJ_18278 [Oryza sativa Japonica Group]
Length=398

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            GH+FATR+GNVFTIGK  KPWVSLPKGKGIKLSIIEEA+KR A  +A
Sbjct  350  GHQFATRMGNVFTIGKERKPWVSLPKGKGIKLSIIEEARKRNAEAAA  396



>dbj|BAN18309.1| 40S ribosomal protein S4, partial [Schiedea helleri]
Length=135

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATR GNVF +GKGT+PWVSLPKGKGIKL+IIEEA+KR
Sbjct  95   GHEFATRQGNVFIVGKGTRPWVSLPKGKGIKLTIIEEARKR  135



>dbj|BAN18292.1| 40S ribosomal protein S4, partial [Schiedea spergulina]
 dbj|BAN18293.1| 40S ribosomal protein S4, partial [Schiedea kealiae]
 dbj|BAN18294.1| 40S ribosomal protein S4, partial [Schiedea mannii]
 dbj|BAN18295.1| 40S ribosomal protein S4, partial [Schiedea adamantis]
 dbj|BAN18296.1| 40S ribosomal protein S4, partial [Schiedea menziesii]
 dbj|BAN18297.1| 40S ribosomal protein S4, partial [Schiedea hookeri]
 dbj|BAN18298.1| 40S ribosomal protein S4, partial [Schiedea sarmentosa]
 dbj|BAN18299.1| 40S ribosomal protein S4, partial [Schiedea lydgatei]
 dbj|BAN18300.1| 40S ribosomal protein S4, partial [Schiedea haleakalensis]
 dbj|BAN18301.1| 40S ribosomal protein S4, partial [Schiedea ligustrina]
 dbj|BAN18302.1| 40S ribosomal protein S4, partial [Schiedea salicaria]
 dbj|BAN18303.1| 40S ribosomal protein S4, partial [Schiedea globosa]
 dbj|BAN18304.1| 40S ribosomal protein S4, partial [Schiedea verticillata]
 dbj|BAN18305.1| 40S ribosomal protein S4, partial [Schiedea viscosa]
 dbj|BAN18306.1| 40S ribosomal protein S4, partial [Schiedea trinervis]
 dbj|BAN18307.1| 40S ribosomal protein S4, partial [Schiedea obovata]
 dbj|BAN18308.1| 40S ribosomal protein S4, partial [Schiedea membranacea]
 dbj|BAN18310.1| 40S ribosomal protein S4, partial [Schiedea apokremnos]
Length=135

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATR GNVF +GKGT+PWVSLPKGKGIKL+IIEEA+KR
Sbjct  95   GHEFATRQGNVFIVGKGTRPWVSLPKGKGIKLTIIEEARKR  135



>ref|XP_001759850.1| predicted protein [Physcomitrella patens]
 gb|EDQ75354.1| predicted protein [Physcomitrella patens]
Length=263

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSAT  242
            G +FATR+GNVFT+G+GTKPW++LP+GKGIKLSI+EEAKKR  A  A+
Sbjct  215  GQQFATRMGNVFTVGQGTKPWITLPRGKGIKLSIVEEAKKRTQALKAS  262



>gb|KDO63240.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=284

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  275
            GHEFATRLGNVFTIGKG+KPWVSLPKGKGIKLSIIEE
Sbjct  237  GHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEE  273



>gb|KDO63243.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=187

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  275
            GHEFATRLGNVFTIGKG+KPWVSLPKGKGIKLSIIEE
Sbjct  140  GHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEE  176



>dbj|BAM15885.1| putative 40S ribosomal protein S4, partial [Pyrus pyrifolia var. 
culta]
Length=90

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  275
            GHEFATRLGNVFTIGKGTKPW+SLPKGKGIKL+IIEE
Sbjct  41   GHEFATRLGNVFTIGKGTKPWISLPKGKGIKLTIIEE  77



>ref|XP_002972484.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
 gb|EFJ26570.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
Length=258

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRL  260
            G +FATR+GNVFTIG+GTKPWVSLPKGKGIKLSI+EEA+KR+
Sbjct  215  GQDFATRMGNVFTIGQGTKPWVSLPKGKGIKLSIVEEARKRV  256



>ref|XP_002984314.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
 gb|EFJ14824.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
Length=258

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRL  260
            G +FATR+GNVFTIG+GTKPWVSLPKGKGIKLSI+EEA+KR+
Sbjct  215  GQDFATRMGNVFTIGQGTKPWVSLPKGKGIKLSIVEEARKRV  256



>gb|KDO63241.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=254

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  275
            GHEFATRLGNVFTIGKG+KPWVSLPKGKGIKLSIIEE
Sbjct  207  GHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEE  243



>ref|XP_001759591.1| predicted protein [Physcomitrella patens]
 gb|EDQ75503.1| predicted protein [Physcomitrella patens]
Length=263

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQSA  245
            G +FATR+GNVFT+G+GTKPW++LP+GKGIKLSI+EEAKKR  A  A
Sbjct  215  GQQFATRMGNVFTVGQGTKPWITLPRGKGIKLSIVEEAKKRTQALKA  261



>ref|XP_004491013.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=265

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  275
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL++IEE
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTVIEE  251



>gb|KDO63242.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=244

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  275
            GHEFATRLGNVFTIGKG+KPWVSLPKGKGIKLSIIEE
Sbjct  197  GHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEE  233



>ref|XP_001785339.1| predicted protein [Physcomitrella patens]
 gb|EDQ49851.1| predicted protein [Physcomitrella patens]
Length=263

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQ  251
            G++FATR+GNVFTIG+GTKPW++LP+GKGIKLSI+EEAKKR A +
Sbjct  215  GNQFATRMGNVFTIGQGTKPWITLPRGKGIKLSIVEEAKKRKATE  259



>ref|XP_008383247.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_008364235.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_009363280.1| PREDICTED: 40S ribosomal protein S4 [Pyrus x bretschneideri]
Length=264

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  275
            GHEFATRLGNVFTIGKGTKPW+SLPKGKGIKL+IIEE
Sbjct  215  GHEFATRLGNVFTIGKGTKPWISLPKGKGIKLTIIEE  251



>ref|XP_004511996.1| PREDICTED: 40S ribosomal protein S4-1-like [Cicer arietinum]
Length=264

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  275
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL++IEE
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTVIEE  251



>ref|XP_006429477.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 ref|XP_006481102.1| PREDICTED: 40S ribosomal protein S4-2-like [Citrus sinensis]
 gb|ESR42717.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 gb|KDO63239.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=262

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  275
            GHEFATRLGNVFTIGKG+KPWVSLPKGKGIKLSIIEE
Sbjct  215  GHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEE  251



>ref|XP_001780588.1| predicted protein [Physcomitrella patens]
 gb|EDQ54571.1| predicted protein [Physcomitrella patens]
Length=263

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKRLAAQS  248
            G++FATR+GNVFTIG+GTKPW++LP+GKGIKLSI+EEAKKR A  +
Sbjct  215  GNQFATRMGNVFTIGQGTKPWITLPRGKGIKLSIVEEAKKRKAVTN  260



>ref|XP_007205728.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
 gb|EMJ06927.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
Length=265

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE  275
            GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+I+EE
Sbjct  215  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTILEE  251



>dbj|BAN18311.1| 40S ribosomal protein S4, partial [Schiedea jacobii]
 dbj|BAN18312.1| 40S ribosomal protein S4, partial [Schiedea nuttallii]
 dbj|BAN18313.1| 40S ribosomal protein S4, partial [Schiedea pentandra]
 dbj|BAN18314.1| 40S ribosomal protein S4, partial [Schiedea kauaiensis]
 dbj|BAN18316.1| 40S ribosomal protein S4, partial [Schiedea perlmanii]
 dbj|BAN18317.1| 40S ribosomal protein S4, partial [Schiedea kaalae]
 dbj|BAN18318.1| 40S ribosomal protein S4, partial [Schiedea laui]
Length=135

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATR GNVF +GKG++PWVSLPKGKGIKL+IIEEA+KR
Sbjct  95   GHEFATRQGNVFIVGKGSRPWVSLPKGKGIKLTIIEEARKR  135



>dbj|BAN18315.1| 40S ribosomal protein S4, partial [Schiedea stellarioides]
Length=135

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  385  GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEEAKKR  263
            GHEFATR GNVF +GKG++PWVSLPKGKGIKL+IIEEA+KR
Sbjct  95   GHEFATRQGNVFIVGKGSRPWVSLPKGKGIKLTIIEEARKR  135



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565581808380