BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF046K07

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAK19067.1|  GIGANTEA                                               177   3e-47   Ipomoea nil [qian niu]
ref|XP_006359039.1|  PREDICTED: protein GIGANTEA-like isoform X1        123   3e-28   Solanum tuberosum [potatoes]
ref|XP_006359040.1|  PREDICTED: protein GIGANTEA-like isoform X2        122   4e-28   Solanum tuberosum [potatoes]
ref|XP_007019604.1|  Gigantea protein isoform 4                         120   2e-27   
ref|XP_007019603.1|  Gigantea protein isoform 3                         120   2e-27   
ref|XP_007019601.1|  Gigantea protein isoform 1                         120   2e-27   
ref|XP_003556164.1|  PREDICTED: protein GIGANTEA isoformX1              120   4e-27   
gb|ACJ65312.1|  GI1 protein                                             120   4e-27   Glycine max [soybeans]
dbj|BAJ22595.1|  GIGANTEA                                               119   4e-27   Glycine max [soybeans]
ref|XP_004237832.1|  PREDICTED: protein GIGANTEA                        119   1e-26   Solanum lycopersicum
ref|XP_004290483.1|  PREDICTED: protein GIGANTEA                        118   1e-26   Fragaria vesca subsp. vesca
gb|KHN46389.1|  Protein GIGANTEA                                        118   1e-26   Glycine soja [wild soybean]
dbj|BAN82586.1|  gigantea                                               117   3e-26   Glycine max [soybeans]
dbj|BAN82581.1|  gigantea                                               117   3e-26   Glycine max [soybeans]
ref|NP_001239995.1|  uncharacterized protein LOC100800578               117   3e-26   
dbj|BAN82589.1|  gigantea                                               117   3e-26   Glycine max [soybeans]
emb|CDP11443.1|  unnamed protein product                                117   3e-26   Coffea canephora [robusta coffee]
ref|XP_006588466.1|  PREDICTED: uncharacterized protein LOC100800...    117   3e-26   Glycine max [soybeans]
gb|KHN17039.1|  Protein GIGANTEA                                        117   3e-26   Glycine soja [wild soybean]
gb|AEK05861.1|  gigantea-5                                              109   7e-26   Populus balsamifera [balsam poplar]
ref|XP_011074106.1|  PREDICTED: protein GIGANTEA-like isoform X2        115   2e-25   
ref|XP_011074103.1|  PREDICTED: protein GIGANTEA-like isoform X1        115   2e-25   Sesamum indicum [beniseed]
ref|XP_008237480.1|  PREDICTED: protein GIGANTEA                        115   2e-25   
ref|XP_009772049.1|  PREDICTED: protein GIGANTEA-like                   114   2e-25   Nicotiana sylvestris
gb|AJC01622.1|  gigantea                                                114   2e-25   Prunus dulcis [sweet almond]
gb|AEK05881.1|  gigantea-5                                              107   2e-25   Populus balsamifera [balsam poplar]
ref|XP_008386373.1|  PREDICTED: protein GIGANTEA-like                   114   2e-25   
ref|XP_009335139.1|  PREDICTED: protein GIGANTEA-like                   114   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_007199688.1|  hypothetical protein PRUPE_ppa000556mg             114   2e-25   
ref|XP_011100590.1|  PREDICTED: protein GIGANTEA-like                   114   3e-25   Sesamum indicum [beniseed]
ref|XP_009631435.1|  PREDICTED: protein GIGANTEA-like isoform X6        114   3e-25   Nicotiana tomentosiformis
gb|AFK37980.1|  unknown                                                 110   3e-25   Lotus japonicus
ref|XP_009631436.1|  PREDICTED: protein GIGANTEA-like isoform X7        114   4e-25   Nicotiana tomentosiformis
ref|XP_009631429.1|  PREDICTED: protein GIGANTEA-like isoform X1        114   5e-25   Nicotiana tomentosiformis
ref|XP_009631433.1|  PREDICTED: protein GIGANTEA-like isoform X4        114   5e-25   Nicotiana tomentosiformis
ref|XP_009631434.1|  PREDICTED: protein GIGANTEA-like isoform X5        113   5e-25   Nicotiana tomentosiformis
ref|XP_002524341.1|  Protein GIGANTEA, putative                         113   5e-25   
ref|XP_009631432.1|  PREDICTED: protein GIGANTEA-like isoform X3        113   5e-25   Nicotiana tomentosiformis
ref|XP_009631431.1|  PREDICTED: protein GIGANTEA-like isoform X2        113   5e-25   Nicotiana tomentosiformis
gb|AEK05816.1|  gigantea-5                                              106   7e-25   Populus balsamifera [balsam poplar]
ref|XP_011042897.1|  PREDICTED: protein GIGANTEA-like                   112   1e-24   Populus euphratica
ref|XP_010314472.1|  PREDICTED: protein GIGANTEA-like isoform X2        112   1e-24   
ref|XP_004252566.1|  PREDICTED: protein GIGANTEA-like isoform X1        112   1e-24   Solanum lycopersicum
ref|XP_010097648.1|  hypothetical protein L484_023788                   112   2e-24   
ref|XP_009802612.1|  PREDICTED: protein GIGANTEA-like                   112   2e-24   Nicotiana sylvestris
ref|XP_008381855.1|  PREDICTED: protein GIGANTEA-like                   111   4e-24   
ref|XP_007143577.1|  hypothetical protein PHAVU_007G083500g             110   9e-24   Phaseolus vulgaris [French bean]
ref|XP_009610493.1|  PREDICTED: protein GIGANTEA-like                   110   9e-24   Nicotiana tomentosiformis
ref|XP_002307516.1|  GIGANTEA family protein                            110   1e-23   
gb|AII99806.1|  gigantea                                                109   1e-23   Dimocarpus longan [longan]
gb|ABP81863.1|  LATE BLOOMER 1                                          109   1e-23   Pisum sativum [garden pea]
ref|XP_003592047.1|  Protein GIGANTEA                                   108   1e-23   
ref|XP_003592046.1|  Protein GIGANTEA                                   109   1e-23   
gb|AES62299.2|  gigantea protein 1B                                     109   1e-23   Medicago truncatula
ref|XP_004496436.1|  PREDICTED: protein GIGANTEA-like isoform X2        109   1e-23   
ref|XP_003592048.1|  Protein GIGANTEA                                   109   2e-23   
ref|XP_004496435.1|  PREDICTED: protein GIGANTEA-like isoform X1        109   2e-23   Cicer arietinum [garbanzo]
gb|AEK26576.1|  gigantea 5                                              102   2e-23   Populus tremula [European aspen]
ref|XP_006361617.1|  PREDICTED: protein GIGANTEA-like isoform X2        108   3e-23   Solanum tuberosum [potatoes]
ref|XP_006361616.1|  PREDICTED: protein GIGANTEA-like isoform X1        108   3e-23   Solanum tuberosum [potatoes]
gb|KJB59490.1|  hypothetical protein B456_009G258800                    108   3e-23   Gossypium raimondii
ref|XP_009336496.1|  PREDICTED: protein GIGANTEA-like                   108   3e-23   Pyrus x bretschneideri [bai li]
gb|KJB59494.1|  hypothetical protein B456_009G258800                    108   4e-23   Gossypium raimondii
gb|KJB59489.1|  hypothetical protein B456_009G258800                    107   4e-23   Gossypium raimondii
ref|XP_006386299.1|  hypothetical protein POPTR_0002s06490g             107   7e-23   
ref|XP_002300901.2|  GIGANTEA family protein                            107   7e-23   
ref|XP_011044276.1|  PREDICTED: protein GIGANTEA-like                   107   8e-23   Populus euphratica
gb|KDP36552.1|  hypothetical protein JCGZ_08319                         106   1e-22   Jatropha curcas
ref|XP_006473108.1|  PREDICTED: protein GIGANTEA-like                   102   1e-22   Citrus sinensis [apfelsine]
ref|XP_002264755.1|  PREDICTED: protein GIGANTEA                        106   2e-22   
emb|CAN81809.1|  hypothetical protein VITISV_032939                     106   2e-22   Vitis vinifera
ref|XP_004169554.1|  PREDICTED: protein GIGANTEA-like                 98.2    3e-22   
gb|AGW52153.1|  GI                                                      104   6e-22   Populus tomentosa [Chinese white poplar]
gb|AGM20686.1|  GI1-2                                                   104   7e-22   Populus tomentosa [Chinese white poplar]
ref|XP_006434519.1|  hypothetical protein CICLE_v10004044mg             103   2e-21   
ref|XP_006473104.1|  PREDICTED: protein GIGANTEA-like isoform X1        102   4e-21   Citrus sinensis [apfelsine]
gb|KDO83806.1|  hypothetical protein CISIN_1g001216mg                   102   5e-21   Citrus sinensis [apfelsine]
ref|XP_004173921.1|  PREDICTED: protein GIGANTEA-like                 95.1    8e-21   
emb|CAJ38396.1|  photoperiodic response / GIGANTEA                    95.5    2e-20   Plantago major [cart-track plant]
gb|KGN44456.1|  hypothetical protein Csa_7G293740                     99.0    4e-20   Cucumis sativus [cucumbers]
ref|XP_004139688.1|  PREDICTED: protein GIGANTEA-like                 99.0    5e-20   
ref|XP_010477546.1|  PREDICTED: protein GIGANTEA-like isoform X4      98.2    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010477545.1|  PREDICTED: protein GIGANTEA-like isoform X3      98.2    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010477544.1|  PREDICTED: protein GIGANTEA-like isoform X2      98.2    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010477543.1|  PREDICTED: protein GIGANTEA-like isoform X1      98.2    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006306336.1|  hypothetical protein CARUB_v10012213mg           97.8    1e-19   Capsella rubella
ref|XP_010462850.1|  PREDICTED: protein GIGANTEA-like                 97.8    1e-19   Camelina sativa [gold-of-pleasure]
gb|KFK44368.1|  gigantea                                              97.4    2e-19   Arabis alpina [alpine rockcress]
ref|XP_002890532.1|  hypothetical protein ARALYDRAFT_889789           97.1    2e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_004140955.1|  PREDICTED: protein GIGANTEA-like                 96.3    4e-19   Cucumis sativus [cucumbers]
ref|XP_010498761.1|  PREDICTED: protein GIGANTEA                      96.3    5e-19   Camelina sativa [gold-of-pleasure]
gb|AFK65758.1|  GIGANTEA                                              96.3    5e-19   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010062087.1|  PREDICTED: protein GIGANTEA isoform X1           95.9    6e-19   Eucalyptus grandis [rose gum]
gb|KCW69153.1|  hypothetical protein EUGRSUZ_F02686                   95.9    6e-19   Eucalyptus grandis [rose gum]
ref|XP_010062090.1|  PREDICTED: protein GIGANTEA isoform X2           95.9    6e-19   Eucalyptus grandis [rose gum]
gb|KHN00736.1|  Protein GIGANTEA                                      90.5    6e-19   Glycine soja [wild soybean]
dbj|BAM67030.1|  gigantea-like                                        95.9    7e-19   Chrysanthemum seticuspe f. boreale
gb|AGL61504.1|  gigantea-like protein                                 95.9    7e-19   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_008456743.1|  PREDICTED: protein GIGANTEA-like                 95.9    7e-19   Cucumis melo [Oriental melon]
gb|ABP96481.1|  GIGANTEA                                              95.1    1e-18   Arabidopsis lyrata subsp. petraea
gb|AAF00023.1|  GIGANTEA                                              92.4    8e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAT97404.1|  gigantea                                              92.4    8e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ABR26000.1|  gigantea protein                                      87.4    8e-18   Oryza sativa Indica Group [Indian rice]
gb|ABP96496.1|  GIGANTEA                                              92.4    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564180.1|  protein GIGANTEA                                    92.4    8e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAT80910.1|  GIGANTEA                                              92.4    8e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96485.1|  GIGANTEA                                              92.4    8e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CAA72908.1|  hypothetical protein                                 92.4    8e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96488.1|  GIGANTEA                                              92.4    9e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96484.1|  GIGANTEA                                              92.4    9e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96498.1|  GIGANTEA                                              92.4    9e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96483.1|  GIGANTEA                                              92.4    9e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96497.1|  GIGANTEA                                              92.4    9e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96482.1|  GIGANTEA                                              92.4    9e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KJB28962.1|  hypothetical protein B456_005G077100                  92.4    1e-17   Gossypium raimondii
gb|KJB28961.1|  hypothetical protein B456_005G077100                  92.0    1e-17   Gossypium raimondii
gb|KHN41309.1|  Protein GIGANTEA                                      92.0    1e-17   Glycine soja [wild soybean]
ref|XP_006416159.1|  hypothetical protein EUTSA_v10006603mg           92.0    1e-17   
gb|ACJ65314.1|  GI3 protein                                           92.0    1e-17   Glycine max [soybeans]
ref|XP_010681263.1|  PREDICTED: protein GIGANTEA                      92.0    1e-17   
ref|XP_010261025.1|  PREDICTED: protein GIGANTEA-like isoform X2      91.3    2e-17   Nelumbo nucifera [Indian lotus]
dbj|BAD68053.1|  putative gigantea                                    87.8    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010261024.1|  PREDICTED: protein GIGANTEA-like isoform X1      91.3    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_008461914.1|  PREDICTED: protein GIGANTEA-like isoform X3      90.9    2e-17   
ref|XP_008461912.1|  PREDICTED: protein GIGANTEA-like isoform X1      90.9    3e-17   Cucumis melo [Oriental melon]
ref|XP_008461913.1|  PREDICTED: protein GIGANTEA-like isoform X2      90.9    3e-17   
gb|EEE54000.1|  hypothetical protein OsJ_00641                        88.6    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042220.1|  Os01g0182600                                     88.6    2e-16   
gb|EEC70061.1|  hypothetical protein OsI_00663                        88.6    2e-16   Oryza sativa Indica Group [Indian rice]
gb|AEK05790.1|  gigantea 2                                            87.8    3e-16   Populus balsamifera [balsam poplar]
gb|AEK05802.1|  gigantea 2                                            87.8    3e-16   Populus balsamifera [balsam poplar]
gb|AEK05807.1|  gigantea 2                                            87.8    3e-16   Populus balsamifera [balsam poplar]
gb|AEK05801.1|  gigantea 2                                            87.8    3e-16   Populus balsamifera [balsam poplar]
gb|AEK05799.1|  gigantea 2                                            87.8    3e-16   Populus balsamifera [balsam poplar]
gb|AEK05795.1|  gigantea 2                                            87.8    3e-16   Populus balsamifera [balsam poplar]
gb|AEK05793.1|  gigantea 2                                            87.8    3e-16   Populus balsamifera [balsam poplar]
gb|AEK05791.1|  gigantea 2                                            87.8    3e-16   Populus balsamifera [balsam poplar]
gb|EYU30283.1|  hypothetical protein MIMGU_mgv1a000455mg              87.8    3e-16   Erythranthe guttata [common monkey flower]
gb|ACF84482.1|  unknown                                               86.3    4e-16   Zea mays [maize]
gb|ABZ81992.1|  gigantea                                              87.4    5e-16   Zea mays [maize]
ref|NP_001288586.1|  gigantea like1a                                  87.0    5e-16   Zea mays [maize]
ref|XP_010915066.1|  PREDICTED: protein GIGANTEA-like                 87.0    6e-16   Elaeis guineensis
emb|CAB56058.1|  gigantea homologue                                   86.3    1e-15   Oryza sativa [red rice]
ref|XP_008672375.1|  PREDICTED: uncharacterized protein LOC100272...  86.3    1e-15   Zea mays [maize]
ref|NP_001140728.1|  uncharacterized protein LOC100272803             86.3    1e-15   
ref|XP_010535090.1|  PREDICTED: protein GIGANTEA                      85.5    2e-15   Tarenaya hassleriana [spider flower]
ref|XP_006643836.1|  PREDICTED: protein GIGANTEA-like isoform X1      85.1    3e-15   Oryza brachyantha
gb|AEK05803.1|  gigantea 2                                            84.7    3e-15   Populus balsamifera [balsam poplar]
ref|XP_009115601.1|  PREDICTED: protein GIGANTEA                      84.3    4e-15   Brassica rapa
ref|XP_008793464.1|  PREDICTED: protein GIGANTEA-like                 84.3    5e-15   Phoenix dactylifera
emb|CDY21388.1|  BnaA09g30390D                                        84.3    5e-15   Brassica napus [oilseed rape]
ref|NP_001288824.1|  protein GIGANTEA                                 84.3    5e-15   Brassica rapa
ref|XP_006842209.1|  hypothetical protein AMTR_s00078p00173230        84.0    5e-15   
ref|XP_007151935.1|  hypothetical protein PHAVU_004G088300g           83.6    7e-15   Phaseolus vulgaris [French bean]
emb|CDM81775.1|  unnamed protein product                              83.6    9e-15   Triticum aestivum [Canadian hard winter wheat]
emb|CDY04787.1|  BnaC05g18020D                                        83.6    9e-15   
gb|ADZ72836.1|  GIGANTEA-like protein                                 82.8    1e-14   Aquilegia formosa
gb|EMS55238.1|  hypothetical protein TRIUR3_30834                     82.4    2e-14   Triticum urartu
gb|AIC83986.1|  gigantea-like protein                                 82.4    2e-14   Festuca pratensis [meadow ryegrass]
gb|EMT06342.1|  hypothetical protein F775_28583                       82.4    2e-14   
gb|AAT79486.1|  gigantea 2                                            82.4    2e-14   Triticum aestivum [Canadian hard winter wheat]
gb|AAQ11738.1|  gigantea                                              82.0    2e-14   Triticum aestivum [Canadian hard winter wheat]
gb|AAL08497.2|  gigantea-like protein                                 82.0    2e-14   Hordeum vulgare [barley]
gb|AAW66945.1|  gigantea-like protein                                 81.6    3e-14   Hordeum vulgare [barley]
gb|AAT79487.1|  gigantea 3                                            81.6    3e-14   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010925341.1|  PREDICTED: protein GIGANTEA-like                 81.6    3e-14   Elaeis guineensis
ref|XP_009380419.1|  PREDICTED: protein GIGANTEA-like isoform X1      80.9    5e-14   
emb|CAY26028.1|  GIGANTEA                                             80.9    6e-14   Lolium perenne [perennial ryegrass]
ref|XP_003564357.1|  PREDICTED: protein GIGANTEA                      80.1    1e-13   
ref|XP_004968438.1|  PREDICTED: protein GIGANTEA-like                 79.3    2e-13   Setaria italica
ref|XP_008786518.1|  PREDICTED: protein GIGANTEA-like                 77.4    7e-13   
gb|EYU36555.1|  hypothetical protein MIMGU_mgv1a000427mg              77.0    1e-12   Erythranthe guttata [common monkey flower]
emb|CBI22759.3|  unnamed protein product                              73.9    1e-12   Vitis vinifera
gb|ADR51711.1|  GI                                                    75.5    4e-12   Secale cereale
ref|XP_009381150.1|  PREDICTED: protein GIGANTEA-like                 69.7    3e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADP92454.1|  GIGANTEA 1                                            69.3    4e-10   x Doritaenopsis hybrid cultivar
gb|AIR93790.1|  gigantea                                              67.4    1e-09   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_009408933.1|  PREDICTED: protein GIGANTEA-like isoform X1      66.6    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408935.1|  PREDICTED: protein GIGANTEA-like isoform X2      66.6    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACT22765.1|  GIGANTEA                                              65.1    7e-09   Allium cepa
gb|ACT22764.1|  GIGANTEA                                              65.1    7e-09   Allium cepa
gb|ACY30446.1|  gigantea-like protein                                 64.3    1e-08   Liriodendron tulipifera
dbj|BAD97869.1|  GI homologue                                         63.2    3e-08   Lemna gibba
dbj|BAD97864.1|  GI homologue 1                                       60.8    2e-07   Lemna aequinoctialis
dbj|BAP76055.1|  putative GI                                          53.9    3e-05   Cryptomeria japonica



>dbj|BAK19067.1| GIGANTEA [Ipomoea nil]
Length=1166

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS
Sbjct  1083  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  1142

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             QLANGMSAEFLDTAAKELGCTISV
Sbjct  1143  QLANGMSAEFLDTAAKELGCTISV  1166



>ref|XP_006359039.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1189

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSIS+LRAI+H+GSIK+RAK  ++NGIHGPAY+ LN+ GTI+WQ DIE+CL  EA+S
Sbjct  1107  VRALSISLLRAIMHTGSIKTRAKRADVNGIHGPAYKYLNI-GTINWQRDIEKCLTWEANS  1165

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++ NGM  EFLD AAKELGCTI +
Sbjct  1166  RIENGMCTEFLDMAAKELGCTIFI  1189



>ref|XP_006359040.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1166

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSIS+LRAI+H+GSIK+RAK  ++NGIHGPAY+ LN+ GTI+WQ DIE+CL  EA+S
Sbjct  1084  VRALSISLLRAIMHTGSIKTRAKRADVNGIHGPAYKYLNI-GTINWQRDIEKCLTWEANS  1142

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++ NGM  EFLD AAKELGCTI +
Sbjct  1143  RIENGMCTEFLDMAAKELGCTIFI  1166



>ref|XP_007019604.1| Gigantea protein isoform 4 [Theobroma cacao]
 gb|EOY16829.1| Gigantea protein isoform 4 [Theobroma cacao]
Length=1147

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR ILH+GSIK  +K V +NGIHGP+YQ  +VG  IDW  DIE+CL  EAHS
Sbjct  1065  VRALSTSVLRNILHAGSIKPNSKQVEINGIHGPSYQYFSVG-VIDWHTDIEKCLTWEAHS  1123

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             QLA GM   FLDTAAKELGC+IS+
Sbjct  1124  QLARGMPIRFLDTAAKELGCSISI  1147



>ref|XP_007019603.1| Gigantea protein isoform 3 [Theobroma cacao]
 gb|EOY16828.1| Gigantea protein isoform 3 [Theobroma cacao]
Length=1171

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR ILH+GSIK  +K V +NGIHGP+YQ  +VG  IDW  DIE+CL  EAHS
Sbjct  1089  VRALSTSVLRNILHAGSIKPNSKQVEINGIHGPSYQYFSVG-VIDWHTDIEKCLTWEAHS  1147

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             QLA GM   FLDTAAKELGC+IS+
Sbjct  1148  QLARGMPIRFLDTAAKELGCSISI  1171



>ref|XP_007019601.1| Gigantea protein isoform 1 [Theobroma cacao]
 ref|XP_007019602.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16826.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16827.1| Gigantea protein isoform 1 [Theobroma cacao]
Length=1170

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR ILH+GSIK  +K V +NGIHGP+YQ  +VG  IDW  DIE+CL  EAHS
Sbjct  1088  VRALSTSVLRNILHAGSIKPNSKQVEINGIHGPSYQYFSVG-VIDWHTDIEKCLTWEAHS  1146

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             QLA GM   FLDTAAKELGC+IS+
Sbjct  1147  QLARGMPIRFLDTAAKELGCSISI  1170



>ref|XP_003556164.1| PREDICTED: protein GIGANTEA isoformX1 [Glycine max]
 ref|XP_006606175.1| PREDICTED: protein GIGANTEA isoform X2 [Glycine max]
 ref|XP_006606176.1| PREDICTED: protein GIGANTEA isoform X3 [Glycine max]
 ref|XP_006606177.1| PREDICTED: protein GIGANTEA isoform X4 [Glycine max]
 gb|ACA24489.1| gigantea-like protein 1 [Glycine max]
Length=1175

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   IDWQADIE+CL  EAHS
Sbjct  1093  VRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLD-VIDWQADIEKCLTWEAHS  1151

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L+NG+S  FLDTAAKELGCTIS+
Sbjct  1152  RLSNGLSINFLDTAAKELGCTISM  1175



>gb|ACJ65312.1| GI1 protein [Glycine max]
Length=1176

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   IDWQADIE+CL  EAHS
Sbjct  1094  VRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLD-VIDWQADIEKCLTWEAHS  1152

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L+NG+S  FLDTAAKELGCTIS+
Sbjct  1153  RLSNGLSINFLDTAAKELGCTISM  1176



>dbj|BAJ22595.1| GIGANTEA [Glycine max]
Length=1168

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   IDWQADIE+CL  EAHS
Sbjct  1086  VRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLD-VIDWQADIEKCLTWEAHS  1144

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L+NG+S  FLDTAAKELGCTIS+
Sbjct  1145  RLSNGLSINFLDTAAKELGCTISM  1168



>ref|XP_004237832.1| PREDICTED: protein GIGANTEA [Solanum lycopersicum]
Length=1167

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSIS+LRAI+ +GSIK+RA   ++NGIHGPAY+ LN+G TI+WQ DIE+CL  EA+S
Sbjct  1085  VRALSISLLRAIMQTGSIKTRANRADVNGIHGPAYKYLNIG-TINWQRDIEKCLTWEANS  1143

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++ NGM  +FLD AAKELGCTIS+
Sbjct  1144  RIENGMCTQFLDMAAKELGCTISI  1167



>ref|XP_004290483.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458472.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458473.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
Length=1178

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS+SVLR IL + S++    PV +NGIHGP+Y+  N+   IDWQADIE+CL  EAHS
Sbjct  1096  VRALSVSVLRDILQTSSVRPNPNPVQINGIHGPSYKYFNLD-VIDWQADIEKCLTWEAHS  1154

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM  +FLDTAAKELGCTISV
Sbjct  1155  RLATGMPIKFLDTAAKELGCTISV  1178



>gb|KHN46389.1| Protein GIGANTEA, partial [Glycine soja]
Length=1157

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   IDWQADIE+CL  EAHS
Sbjct  1075  VRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLD-VIDWQADIEKCLTWEAHS  1133

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L+NG+S  FLDT AKELGCTIS+
Sbjct  1134  RLSNGLSINFLDTTAKELGCTISM  1157



>dbj|BAN82586.1| gigantea [Glycine max]
 dbj|BAN82590.1| gigantea [Glycine max]
 dbj|BAN82591.1| gigantea [Glycine max]
 dbj|BAN82592.1| gigantea [Glycine max]
Length=1170

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   +DWQADIE+CL  EAHS
Sbjct  1088  VRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLDA-VDWQADIEKCLTWEAHS  1146

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L+NG+S  FLD AAKELGCTIS+
Sbjct  1147  RLSNGLSINFLDIAAKELGCTISM  1170



>dbj|BAN82581.1| gigantea [Glycine max]
 dbj|BAN82582.1| gigantea [Glycine max]
 dbj|BAN82583.1| gigantea [Glycine max]
 dbj|BAN82584.1| gigantea [Glycine max]
 dbj|BAN82585.1| gigantea [Glycine max]
 dbj|BAN82587.1| gigantea [Glycine max]
 dbj|BAN82588.1| gigantea [Glycine max]
Length=1170

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   +DWQADIE+CL  EAHS
Sbjct  1088  VRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLDA-VDWQADIEKCLTWEAHS  1146

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L+NG+S  FLD AAKELGCTIS+
Sbjct  1147  RLSNGLSINFLDIAAKELGCTISM  1170



>ref|NP_001239995.1| uncharacterized protein LOC100800578 [Glycine max]
 gb|ACJ65313.1| GI2 protein [Glycine max]
 dbj|BAJ22594.1| GIGANTEA [Glycine max]
Length=1170

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   +DWQADIE+CL  EAHS
Sbjct  1088  VRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLDA-VDWQADIEKCLTWEAHS  1146

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L+NG+S  FLD AAKELGCTIS+
Sbjct  1147  RLSNGLSINFLDIAAKELGCTISM  1170



>dbj|BAN82589.1| gigantea [Glycine max]
Length=1171

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   +DWQADIE+CL  EAHS
Sbjct  1089  VRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLDA-VDWQADIEKCLTWEAHS  1147

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L+NG+S  FLD AAKELGCTIS+
Sbjct  1148  RLSNGLSINFLDIAAKELGCTISM  1171



>emb|CDP11443.1| unnamed protein product [Coffea canephora]
Length=1167

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLRAIL++GS+K+  K V+ NGIHGPAYQ L+VG  ++WQ DIE+CL  EAHS
Sbjct  1085  VRALSTSVLRAILYAGSLKASGKKVDKNGIHGPAYQYLSVGN-VNWQTDIEKCLTWEAHS  1143

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
              LA GM  +FL TAAKELGCTI++
Sbjct  1144  LLATGMPTQFLSTAAKELGCTITI  1167



>ref|XP_006588466.1| PREDICTED: uncharacterized protein LOC100800578 isoform X1 [Glycine 
max]
 ref|XP_006588467.1| PREDICTED: uncharacterized protein LOC100800578 isoform X2 [Glycine 
max]
 ref|XP_006588468.1| PREDICTED: uncharacterized protein LOC100800578 isoform X3 [Glycine 
max]
Length=1177

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   +DWQADIE+CL  EAHS
Sbjct  1095  VRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLDA-VDWQADIEKCLTWEAHS  1153

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L+NG+S  FLD AAKELGCTIS+
Sbjct  1154  RLSNGLSINFLDIAAKELGCTISM  1177



>gb|KHN17039.1| Protein GIGANTEA [Glycine soja]
Length=1149

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   +DWQADIE+CL  EAHS
Sbjct  1067  VRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLDA-VDWQADIEKCLTWEAHS  1125

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L+NG+S  FLD AAKELGCTIS+
Sbjct  1126  RLSNGLSINFLDIAAKELGCTISM  1149



>gb|AEK05861.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05866.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05871.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05876.1| gigantea-5, partial [Populus balsamifera]
Length=173

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR I H+GSIK  +K  + NGIHGP+YQ L     I+WQADIE+CL  EAHS
Sbjct  91   VRALSTSVLRDIQHTGSIKPASKLTHRNGIHGPSYQYLR-SDVINWQADIEKCLTWEAHS  149

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            +LA GM    LDTAAKELGCTIS+
Sbjct  150  RLATGMPVHHLDTAAKELGCTISI  173



>ref|XP_011074106.1| PREDICTED: protein GIGANTEA-like isoform X2 [Sesamum indicum]
Length=1138

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLRAILH+GSIKS  K V +NG+H P YQ +NVG T DW+AD+E+CL  EAHS
Sbjct  1056  VRALSTSVLRAILHAGSIKSSYKQVEVNGVHIPRYQYVNVGIT-DWRADVEKCLTWEAHS  1114

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA G+  +F+DTAA ELGCTIS+
Sbjct  1115  RLAMGLPIQFVDTAATELGCTISI  1138



>ref|XP_011074103.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074105.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
Length=1169

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLRAILH+GSIKS  K V +NG+H P YQ +NVG T DW+AD+E+CL  EAHS
Sbjct  1087  VRALSTSVLRAILHAGSIKSSYKQVEVNGVHIPRYQYVNVGIT-DWRADVEKCLTWEAHS  1145

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA G+  +F+DTAA ELGCTIS+
Sbjct  1146  RLAMGLPIQFVDTAATELGCTISI  1169



>ref|XP_008237480.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237481.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237482.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237483.1| PREDICTED: protein GIGANTEA [Prunus mume]
Length=1170

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR IL + SI+    PV +NGIHGP+Y+  N+   IDWQAD+E+CL  EAHS
Sbjct  1088  VRALSTSVLRDILQTSSIRPNPNPVEINGIHGPSYKYFNLD-VIDWQADVEKCLTWEAHS  1146

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM  +FLDTAAKELGC+IS+
Sbjct  1147  RLATGMPIKFLDTAAKELGCSISI  1170



>ref|XP_009772049.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1155

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR I+H+GSIKS AK  ++NGIHGPAY+ L++G  IDW+ADIE+CL  EA+S
Sbjct  1073  VRALSTSVLRVIMHAGSIKSSAKRADVNGIHGPAYKYLSIG-IIDWRADIEKCLTWEANS  1131

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++ NGM  +FLD AAKELGCTI +
Sbjct  1132  RIENGMCTKFLDMAAKELGCTICI  1155



>gb|AJC01622.1| gigantea [Prunus dulcis]
Length=1170

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR IL + SI+    PV +NGIHGP+Y+  N+   IDWQAD+E+CL  EAHS
Sbjct  1088  VRALSTSVLRDILQTSSIRPNPNPVEINGIHGPSYKYFNLD-VIDWQADVEKCLTWEAHS  1146

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM  +FLDTAAKELGC+IS+
Sbjct  1147  RLATGMPIKFLDTAAKELGCSISI  1170



>gb|AEK05881.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05886.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05891.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05896.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05901.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05906.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05911.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05916.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05921.1| gigantea-5, partial [Populus balsamifera]
Length=173

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR I H+GSIK  +K    NGIHGP+YQ       I+WQADIE+CL  EAHS
Sbjct  91   VRALSTSVLRDIQHTGSIKPASKLTQRNGIHGPSYQYFR-SDVINWQADIEKCLTWEAHS  149

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            +LA GM    LDTAAKELGCTIS+
Sbjct  150  RLATGMPVHHLDTAAKELGCTISI  173



>ref|XP_008386373.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1169

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR IL + SI+    PV +NGIHGP+Y+  N+   IDWQADIE+CL  EAHS
Sbjct  1087  VRALSTSVLRDILQASSIRPNPNPVEINGIHGPSYKYFNLD-VIDWQADIEKCLTWEAHS  1145

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM  +FLDTAAKELGC+IS+
Sbjct  1146  RLATGMHIKFLDTAAKELGCSISI  1169



>ref|XP_009335139.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
 ref|XP_009335140.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1169

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR IL + SI+    PV +NGIHGP+Y+  N+   IDWQADIE+CL  EAHS
Sbjct  1087  VRALSTSVLRDILQASSIRPNPNPVEINGIHGPSYKYFNLD-VIDWQADIEKCLTWEAHS  1145

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM  +FLDTAAKELGC+IS+
Sbjct  1146  RLATGMHIKFLDTAAKELGCSISI  1169



>ref|XP_007199688.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
 gb|EMJ00887.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
Length=1098

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR IL + SI+    PV +NGIHGP+Y+  N+   IDWQAD+E+CL  EAHS
Sbjct  1016  VRALSTSVLRDILQTSSIRPNPNPVEINGIHGPSYKYFNLD-VIDWQADVEKCLTWEAHS  1074

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM  +FLDTAAKELGC+IS+
Sbjct  1075  RLATGMPIKFLDTAAKELGCSISI  1098



>ref|XP_011100590.1| PREDICTED: protein GIGANTEA-like [Sesamum indicum]
Length=1166

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLRAILH+GS KS+ K V +NGIH P +Q +NV  T DW+ADIE+CL  EAHS
Sbjct  1084  VRALSTSVLRAILHAGSTKSKGKQVGVNGIHRPPFQYINVDVT-DWRADIEKCLTWEAHS  1142

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA G+  +F++TAAKELGCTIS+
Sbjct  1143  RLATGLPIQFVNTAAKELGCTISI  1166



>ref|XP_009631435.1| PREDICTED: protein GIGANTEA-like isoform X6 [Nicotiana tomentosiformis]
Length=945

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++G  IDW+ADIE+CL  EA+S
Sbjct  863  VRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSIG-IIDWRADIEKCLTWEANS  921

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            ++ NGM  +FLD AAKELGCTI +
Sbjct  922  RIENGMCTKFLDIAAKELGCTICI  945



>gb|AFK37980.1| unknown [Lotus japonicus]
Length=336

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VR LSISVLR ILH+GS +   K   MNGIH P+YQ  N+   IDW ADIE+CL  EAH+
Sbjct  254  VRTLSISVLRDILHTGSTRCSPKSQRMNGIHHPSYQYFNLD-VIDWLADIEKCLTWEAHT  312

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            +L+NG+S  FLDTAAKELGCTI+V
Sbjct  313  RLSNGLSINFLDTAAKELGCTIAV  336



>ref|XP_009631436.1| PREDICTED: protein GIGANTEA-like isoform X7 [Nicotiana tomentosiformis]
Length=941

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++G  IDW+ADIE+CL  EA+S
Sbjct  859  VRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSIG-IIDWRADIEKCLTWEANS  917

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            ++ NGM  +FLD AAKELGCTI +
Sbjct  918  RIENGMCTKFLDIAAKELGCTICI  941



>ref|XP_009631429.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009631430.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
Length=1173

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++G  IDW+ADIE+CL  EA+S
Sbjct  1091  VRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSIG-IIDWRADIEKCLTWEANS  1149

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++ NGM  +FLD AAKELGCTI +
Sbjct  1150  RIENGMCTKFLDIAAKELGCTICI  1173



>ref|XP_009631433.1| PREDICTED: protein GIGANTEA-like isoform X4 [Nicotiana tomentosiformis]
Length=1159

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++G  IDW+ADIE+CL  EA+S
Sbjct  1077  VRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSIG-IIDWRADIEKCLTWEANS  1135

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++ NGM  +FLD AAKELGCTI +
Sbjct  1136  RIENGMCTKFLDIAAKELGCTICI  1159



>ref|XP_009631434.1| PREDICTED: protein GIGANTEA-like isoform X5 [Nicotiana tomentosiformis]
Length=1155

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++G  IDW+ADIE+CL  EA+S
Sbjct  1073  VRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSIG-IIDWRADIEKCLTWEANS  1131

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++ NGM  +FLD AAKELGCTI +
Sbjct  1132  RIENGMCTKFLDIAAKELGCTICI  1155



>ref|XP_002524341.1| Protein GIGANTEA, putative [Ricinus communis]
 gb|EEF38081.1| Protein GIGANTEA, putative [Ricinus communis]
Length=1161

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRA+S SVLR IL++GSIK  +  V++NGI GP+YQ  N+  T DWQ DIE+CL  EAHS
Sbjct  1079  VRAVSTSVLRGILYTGSIKRTSNRVDINGIRGPSYQYFNIDVT-DWQTDIEKCLTWEAHS  1137

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM  +FLDTAAKELGCTIS+
Sbjct  1138  RLATGMPIQFLDTAAKELGCTISI  1161



>ref|XP_009631432.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nicotiana tomentosiformis]
Length=1165

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++G  IDW+ADIE+CL  EA+S
Sbjct  1083  VRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSIG-IIDWRADIEKCLTWEANS  1141

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++ NGM  +FLD AAKELGCTI +
Sbjct  1142  RIENGMCTKFLDIAAKELGCTICI  1165



>ref|XP_009631431.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nicotiana tomentosiformis]
Length=1169

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++G  IDW+ADIE+CL  EA+S
Sbjct  1087  VRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSIG-IIDWRADIEKCLTWEANS  1145

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++ NGM  +FLD AAKELGCTI +
Sbjct  1146  RIENGMCTKFLDIAAKELGCTICI  1169



>gb|AEK05816.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05821.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05826.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05831.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05836.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05841.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05846.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05851.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05856.1| gigantea-5, partial [Populus balsamifera]
Length=173

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR I H+GSIK  +K    NGIHGP+YQ       I+WQADIE+CL  EAHS
Sbjct  91   VRALSTSVLRDIQHTGSIKPASKLTXRNGIHGPSYQYXR-SDVINWQADIEKCLTWEAHS  149

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            +LA GM    LDTAAKELGCTIS+
Sbjct  150  RLATGMPVHHLDTAAKELGCTISI  173



>ref|XP_011042897.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042898.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042899.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1169

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR IL +GSIK  +K  + NGIHGP+YQ  +    IDWQADIE+CL  EAHS
Sbjct  1087  VRALSISVLRDILRTGSIKPSSKRADRNGIHGPSYQYFS-PDKIDWQADIEKCLTWEAHS  1145

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM    LDTAAKELGCTIS+
Sbjct  1146  RLATGMPIHHLDTAAKELGCTISI  1169



>ref|XP_010314472.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum lycopersicum]
Length=1166

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 2/85 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAK-PVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
             VRALS SVLR I+++GS+K  AK   ++N IH PAYQ L++   IDW+ADIE+CL CEA 
Sbjct  1083  VRALSTSVLRDIMYAGSVKPSAKQAADVNAIHNPAYQYLSIS-IIDWKADIEKCLMCEAS  1141

Query  407   SQLANGMSAEFLDTAAKELGCTISV  333
             S+L NGMSA+FLDTAA+ELGCTISV
Sbjct  1142  SRLENGMSAQFLDTAARELGCTISV  1166



>ref|XP_004252566.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum lycopersicum]
Length=1167

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 2/85 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAK-PVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
             VRALS SVLR I+++GS+K  AK   ++N IH PAYQ L++   IDW+ADIE+CL CEA 
Sbjct  1084  VRALSTSVLRDIMYAGSVKPSAKQAADVNAIHNPAYQYLSIS-IIDWKADIEKCLMCEAS  1142

Query  407   SQLANGMSAEFLDTAAKELGCTISV  333
             S+L NGMSA+FLDTAA+ELGCTISV
Sbjct  1143  SRLENGMSAQFLDTAARELGCTISV  1167



>ref|XP_010097648.1| hypothetical protein L484_023788 [Morus notabilis]
 gb|EXB70603.1| hypothetical protein L484_023788 [Morus notabilis]
Length=1195

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR ILH+GSIK+  KPV +N  HGP+YQ  N    I+W ADIE+ L  EAHS
Sbjct  1113  VRALSTSVLRDILHTGSIKTNHKPVEINAPHGPSYQYFN-PDDINWHADIEKRLTWEAHS  1171

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GMS +FLD AAKELGCTIS+
Sbjct  1172  RLATGMSIQFLDIAAKELGCTISI  1195



>ref|XP_009802612.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
 ref|XP_009802613.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1156

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 71/85 (84%), Gaps = 2/85 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSR-AKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
             VRALS SVLRAI+++GS++S  AK  ++NG H PAYQ L++   IDW+ADIE+CL  EA+
Sbjct  1073  VRALSTSVLRAIMYAGSVRSSSAKQADVNGFHSPAYQYLSIS-IIDWKADIEKCLMWEAN  1131

Query  407   SQLANGMSAEFLDTAAKELGCTISV  333
             S+L NGMSA+FLDTAA+ELGCTIS+
Sbjct  1132  SRLENGMSAQFLDTAARELGCTISI  1156



>ref|XP_008381855.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1170

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR IL + SI+    PV ++GIHGP+Y+  N+   IDWQ DIE+CL  EAHS
Sbjct  1088  VRALSTSVLRDILQASSIRPNPNPVEIDGIHGPSYKYFNLD-VIDWQGDIEKCLTWEAHS  1146

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM  +FLDTAAKELGC+IS+
Sbjct  1147  RLATGMQIKFLDTAAKELGCSISL  1170



>ref|XP_007143577.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 ref|XP_007143578.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15571.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15572.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
Length=1199

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N    IDWQADIE+CL  EAHS
Sbjct  1117  VRALSISVLRDILHTGSIRYNLKPRRINGTHNPSYQYFN-SDAIDWQADIEKCLTWEAHS  1175

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L+  +   FLDTAAKELGC IS+
Sbjct  1176  RLSTRLPINFLDTAAKELGCNISM  1199



>ref|XP_009610493.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
 ref|XP_009610494.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
Length=1158

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 2/85 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIK-SRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
             VRALS SVLRAI+ +GS+K S AK  ++NGIH PAYQ L++   IDW+ADIE+CL  EA+
Sbjct  1075  VRALSTSVLRAIMFAGSVKPSSAKQADVNGIHSPAYQYLSIS-IIDWKADIEKCLMWEAN  1133

Query  407   SQLANGMSAEFLDTAAKELGCTISV  333
             S+L NGMSA+FL TAA+ELGCTIS+
Sbjct  1134  SRLENGMSAQFLGTAARELGCTISI  1158



>ref|XP_002307516.1| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE94512.1| GIGANTEA family protein [Populus trichocarpa]
Length=1171

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR I H+GSIK  +K  + NGIHGP+YQ L     I+WQADIE+CL  EAHS
Sbjct  1089  VRALSTSVLRDIQHTGSIKPASKLTHRNGIHGPSYQYLR-SDVINWQADIEKCLTWEAHS  1147

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM    LDTAAKELGCTIS+
Sbjct  1148  RLATGMPVHHLDTAAKELGCTISI  1171



>gb|AII99806.1| gigantea [Dimocarpus longan]
Length=1171

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR ILH+ S KS +K + +NGI  P YQ  N+   IDW AD E+CL  EAHS
Sbjct  1089  VRALSTSVLRDILHTTSSKSNSKQIEINGICSPPYQYFNIDA-IDWHADTEKCLTWEAHS  1147

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GMS +FLDTAAKELGCTIS+
Sbjct  1148  RLATGMSIQFLDTAAKELGCTISI  1171



>gb|ABP81863.1| LATE BLOOMER 1 [Pisum sativum]
Length=1175

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VR LS+SVLR ILH+GSI+   KP+ +NG H P+Y    +   +DWQADIE+CL CEAHS
Sbjct  1093  VRTLSVSVLRDILHTGSIRCSPKPLRINGNHNPSYPYFKLD-VVDWQADIEKCLTCEAHS  1151

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +++ G+  +FLDTAAKELGC IS+
Sbjct  1152  RISAGLPIKFLDTAAKELGCAISI  1175



>ref|XP_003592047.1| Protein GIGANTEA [Medicago truncatula]
Length=795

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS+SVLR ILH+GSI+   KP+ +NG H P+YQ   +   +DWQADIE+C+  EAHS
Sbjct  713  VRALSVSVLRDILHTGSIRCSPKPLRINGSHNPSYQYFKLD-VVDWQADIEKCMAWEAHS  771

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            +++ G+  +FLDTAAKELGC ISV
Sbjct  772  RISAGLPIKFLDTAAKELGCAISV  795



>ref|XP_003592046.1| Protein GIGANTEA [Medicago truncatula]
Length=1172

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS+SVLR ILH+GSI+   KP+ +NG H P+YQ   +   +DWQADIE+C+  EAHS
Sbjct  1090  VRALSVSVLRDILHTGSIRCSPKPLRINGSHNPSYQYFKLD-VVDWQADIEKCMAWEAHS  1148

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +++ G+  +FLDTAAKELGC ISV
Sbjct  1149  RISAGLPIKFLDTAAKELGCAISV  1172



>gb|AES62299.2| gigantea protein 1B [Medicago truncatula]
Length=1177

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS+SVLR ILH+GSI+   KP+ +NG H P+YQ   +   +DWQADIE+C+  EAHS
Sbjct  1095  VRALSVSVLRDILHTGSIRCSPKPLRINGSHNPSYQYFKLD-VVDWQADIEKCMAWEAHS  1153

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +++ G+  +FLDTAAKELGC ISV
Sbjct  1154  RISAGLPIKFLDTAAKELGCAISV  1177



>ref|XP_004496436.1| PREDICTED: protein GIGANTEA-like isoform X2 [Cicer arietinum]
Length=1152

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VR LS+SVLR ILH+ SI+   KP+ +NG H P+YQ   +   +DWQ DIE+CL CEAHS
Sbjct  1070  VRTLSVSVLRDILHTSSIRCNPKPLRINGNHNPSYQYFKLD-VVDWQTDIEKCLTCEAHS  1128

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++++G+  +FLDTAAKELGC IS+
Sbjct  1129  RISSGLPIKFLDTAAKELGCAISI  1152



>ref|XP_003592048.1| Protein GIGANTEA [Medicago truncatula]
Length=1200

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS+SVLR ILH+GSI+   KP+ +NG H P+YQ   +   +DWQADIE+C+  EAHS
Sbjct  1118  VRALSVSVLRDILHTGSIRCSPKPLRINGSHNPSYQYFKLD-VVDWQADIEKCMAWEAHS  1176

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +++ G+  +FLDTAAKELGC ISV
Sbjct  1177  RISAGLPIKFLDTAAKELGCAISV  1200



>ref|XP_004496435.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cicer arietinum]
Length=1180

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VR LS+SVLR ILH+ SI+   KP+ +NG H P+YQ   +   +DWQ DIE+CL CEAHS
Sbjct  1098  VRTLSVSVLRDILHTSSIRCNPKPLRINGNHNPSYQYFKLD-VVDWQTDIEKCLTCEAHS  1156

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++++G+  +FLDTAAKELGC IS+
Sbjct  1157  RISSGLPIKFLDTAAKELGCAISI  1180



>gb|AEK26576.1| gigantea 5 [Populus tremula]
Length=179

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR I  +GS+K  +K  + NGIHGP+YQ       I+WQADIE+CL  EAHS
Sbjct  97   VRALSTSVLRDIQQTGSMKPASKLTHRNGIHGPSYQYFR-SDVINWQADIEKCLTWEAHS  155

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            +LA GM    LD+AAKELGCTIS+
Sbjct  156  RLATGMPVHHLDSAAKELGCTISI  179



>ref|XP_006361617.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1170

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 2/85 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAK-PVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
             VRALS SVLR I+++GS+K  AK   ++NGIH PAYQ L +  + DW+ADIE+CL  EA+
Sbjct  1087  VRALSTSVLRDIMYAGSVKPSAKQAADVNGIHNPAYQYLGISIS-DWKADIEKCLMWEAN  1145

Query  407   SQLANGMSAEFLDTAAKELGCTISV  333
             S+L NGMSA+FLDTAA+ELGCTISV
Sbjct  1146  SRLENGMSAQFLDTAARELGCTISV  1170



>ref|XP_006361616.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1171

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 2/85 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAK-PVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
             VRALS SVLR I+++GS+K  AK   ++NGIH PAYQ L +  + DW+ADIE+CL  EA+
Sbjct  1088  VRALSTSVLRDIMYAGSVKPSAKQAADVNGIHNPAYQYLGISIS-DWKADIEKCLMWEAN  1146

Query  407   SQLANGMSAEFLDTAAKELGCTISV  333
             S+L NGMSA+FLDTAA+ELGCTISV
Sbjct  1147  SRLENGMSAQFLDTAARELGCTISV  1171



>gb|KJB59490.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1022

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR ILH GSI S++K + + GI GP+YQ  N+G  I+WQ DIE+CL  E +S
Sbjct  941   VRALSTSVLRNILHIGSINSKSK-LEIYGIRGPSYQFFNIGA-INWQTDIEKCLTWEVYS  998

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             QLA GM+ +FLDTAAKELGC IS+
Sbjct  999   QLARGMTIQFLDTAAKELGCNISI  1022



>ref|XP_009336496.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1170

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR IL + SI+    PV ++GIHGP+Y+  N+   IDWQ DIE+CL  EAHS
Sbjct  1088  VRALSTSVLRDILQASSIRPNPNPVEIDGIHGPSYKYFNLD-VIDWQGDIEKCLTWEAHS  1146

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM  +FLD AAKELGC+IS+
Sbjct  1147  RLATGMQIKFLDGAAKELGCSISL  1170



>gb|KJB59494.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59495.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59496.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59497.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59498.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1168

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR ILH GSI S++K + + GI GP+YQ  N+G  I+WQ DIE+CL  E +S
Sbjct  1087  VRALSTSVLRNILHIGSINSKSK-LEIYGIRGPSYQFFNIGA-INWQTDIEKCLTWEVYS  1144

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             QLA GM+ +FLDTAAKELGC IS+
Sbjct  1145  QLARGMTIQFLDTAAKELGCNISI  1168



>gb|KJB59489.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=802

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR ILH GSI S++K + + GI GP+YQ  N+G  I+WQ DIE+CL  E +S
Sbjct  721  VRALSTSVLRNILHIGSINSKSK-LEIYGIRGPSYQFFNIGA-INWQTDIEKCLTWEVYS  778

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            QLA GM+ +FLDTAAKELGC IS+
Sbjct  779  QLARGMTIQFLDTAAKELGCNISI  802



>ref|XP_006386299.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
 gb|ERP64096.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
Length=1171

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR IL +GSIK  +K  + NGIHGP+YQ  ++   IDWQADIE+CL  EA S
Sbjct  1089  VRALSTSVLRDILQTGSIKPSSKQGDRNGIHGPSYQYFSLD-KIDWQADIEKCLTWEARS  1147

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM    LDTAAKELGCTIS+
Sbjct  1148  RLATGMPIHHLDTAAKELGCTISI  1171



>ref|XP_002300901.2| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE80174.2| GIGANTEA family protein [Populus trichocarpa]
Length=1194

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR IL +GSIK  +K  + NGIHGP+YQ  ++   IDWQADIE+CL  EA S
Sbjct  1112  VRALSTSVLRDILQTGSIKPSSKQGDRNGIHGPSYQYFSLD-KIDWQADIEKCLTWEARS  1170

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM    LDTAAKELGCTIS+
Sbjct  1171  RLATGMPIHHLDTAAKELGCTISI  1194



>ref|XP_011044276.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1171

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR I H+GS+K  +K  + NGIHGP+YQ       I+WQADIE+CL  EAHS
Sbjct  1089  VRALSTSVLRDIQHTGSMKPASKLTHRNGIHGPSYQYFR-SDVINWQADIEKCLTWEAHS  1147

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM    LDTAAKELGCTIS+
Sbjct  1148  RLATGMPIHHLDTAAKELGCTISI  1171



>gb|KDP36552.1| hypothetical protein JCGZ_08319 [Jatropha curcas]
Length=1168

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR+ILH+GSI+     V++NG  GP+ Q +N+   IDWQADIE+CL  EAHS
Sbjct  1086  VRALSASVLRSILHTGSIRPTVNQVDINGFRGPSCQYINID-VIDWQADIEKCLTWEAHS  1144

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA G+  +FLD AAKEL CTIS+
Sbjct  1145  RLATGLDIQFLDAAAKELDCTISI  1168



>ref|XP_006473108.1| PREDICTED: protein GIGANTEA-like [Citrus sinensis]
Length=249

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR  LH+ S KS  + V  NGIHG +    N+   I+WQ+DIE+CL  EAHS
Sbjct  167  VRALSTSVLRDFLHTSSFKSNIEQVERNGIHGSSLHYFNIDA-INWQSDIEKCLTWEAHS  225

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            +LA GM  +FLD AAKELGCTIS+
Sbjct  226  RLATGMPIQFLDIAAKELGCTISI  249



>ref|XP_002264755.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665061.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665062.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
Length=1170

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 64/84 (76%), Gaps = 3/84 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR +L SGSIK   K    NGIH  +YQ +N+G  IDWQADIE+CL  EAHS
Sbjct  1090  VRALSTSVLRDVLQSGSIKPHIKQGGRNGIH--SYQYVNLG-IIDWQADIEKCLTWEAHS  1146

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM+ +FLD AAKELGCTIS+
Sbjct  1147  RLATGMTNQFLDVAAKELGCTISI  1170



>emb|CAN81809.1| hypothetical protein VITISV_032939 [Vitis vinifera]
Length=1172

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 64/84 (76%), Gaps = 3/84 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR +L SGSIK   K    NGIH  +YQ +N+G  IDWQADIE+CL  EAHS
Sbjct  1092  VRALSTSVLRDVLQSGSIKPHIKQGGRNGIH--SYQYVNLG-IIDWQADIEKCLTWEAHS  1148

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM+ +FLD AAKELGCTIS+
Sbjct  1149  RLATGMTNQFLDAAAKELGCTISI  1172



>ref|XP_004169554.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=127

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR ILH+  IKS +K VN+NGI+ P+YQ  +  G IDW+ADIE+CL  E  S
Sbjct  46   VRALSTSVLRDILHTSLIKSNSKSVNVNGIY-PSYQYFS-SGIIDWKADIEKCLGWEVRS  103

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            QLA G S +FL  AAKEL C+IS+
Sbjct  104  QLATGQSTQFLQAAAKELSCSISL  127



>gb|AGW52153.1| GI [Populus tomentosa]
Length=1241

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR IL SGSIK  +K  + NGI GP+YQ  +    IDWQADIE+CL  EA S
Sbjct  1159  VRALSTSVLRDILRSGSIKPSSKRADRNGIQGPSYQYFS-PDKIDWQADIEKCLTWEAGS  1217

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM    LDTAAKELGCTIS+
Sbjct  1218  RLATGMPIHHLDTAAKELGCTISI  1241



>gb|AGM20686.1| GI1-2 [Populus tomentosa]
Length=1170

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR IL SGSIK  +K  + NGI GP+YQ  +    IDWQADIE+CL  EA S
Sbjct  1088  VRALSTSVLRDILRSGSIKPSSKRADRNGIQGPSYQYFS-PDKIDWQADIEKCLTWEAGS  1146

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM    LDTAAKELGCTIS+
Sbjct  1147  RLATGMPIHHLDTAAKELGCTISI  1170



>ref|XP_006434519.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
 gb|ESR47759.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
Length=1082

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR  LH+ S KS  + V  NGIHG +    N+   I+WQADIE+CL  EAHS
Sbjct  1000  VRALSTSVLRDFLHTSSFKSNIEQVERNGIHGSSLHYFNIDA-INWQADIEKCLTWEAHS  1058

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM  +FLD AAKELGCTIS+
Sbjct  1059  RLATGMPIQFLDIAAKELGCTISI  1082



>ref|XP_006473104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Citrus sinensis]
 ref|XP_006473105.1| PREDICTED: protein GIGANTEA-like isoform X2 [Citrus sinensis]
 ref|XP_006473106.1| PREDICTED: protein GIGANTEA-like isoform X3 [Citrus sinensis]
 ref|XP_006473107.1| PREDICTED: protein GIGANTEA-like isoform X4 [Citrus sinensis]
Length=1165

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR  LH+ S KS  + V  NGIHG +    N+   I+WQ+DIE+CL  EAHS
Sbjct  1083  VRALSTSVLRDFLHTSSFKSNIEQVERNGIHGSSLHYFNIDA-INWQSDIEKCLTWEAHS  1141

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM  +FLD AAKELGCTIS+
Sbjct  1142  RLATGMPIQFLDIAAKELGCTISI  1165



>gb|KDO83806.1| hypothetical protein CISIN_1g001216mg [Citrus sinensis]
Length=1122

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR  LH+ S KS  + V  NGIHG +    N+   I+WQ+DIE+CL  EAHS
Sbjct  1040  VRALSTSVLRDFLHTSSFKSNIEQVERNGIHGSSLHYFNIDA-INWQSDIEKCLTWEAHS  1098

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA GM  +FLD AAKELGCTIS+
Sbjct  1099  RLATGMPIQFLDIAAKELGCTISI  1122



>ref|XP_004173921.1| PREDICTED: protein GIGANTEA-like, partial [Cucumis sativus]
Length=156

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR IL +GS   R+ P N+NG+H P++Q  N    I+W+ D+E+CL  EAHS
Sbjct  74   VRALSTSVLRDILQTGSYVHRSTPNNINGVHSPSFQYFNREA-INWKVDLEKCLTWEAHS  132

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            +L  GM  E L  AAKELGC+IS+
Sbjct  133  RLVTGMPIEVLHVAAKELGCSISL  156



>emb|CAJ38396.1| photoperiodic response / GIGANTEA [Plantago major]
Length=228

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHG--PAYQCLNVGGTIDWQADIERCLNCEA  411
            VRALS SVL A+LH+GS  +  + + +  ++G  P Y+C NV  T DWQADIE+CL  EA
Sbjct  141  VRALSRSVLGAMLHAGSSINSDRKITLPAMNGSAPPYECTNVSNT-DWQADIEKCLTWEA  199

Query  410  HSQLANGMSAEFLDTAAKELGCTISV  333
            HS+LA G+  +F+D AAKELGCTIS+
Sbjct  200  HSRLATGLPIQFVDNAAKELGCTISI  225



>gb|KGN44456.1| hypothetical protein Csa_7G293740 [Cucumis sativus]
Length=811

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR ILH+  IKS +K VN+NGI+ P+YQ  +  G IDW+ADIE+CL  E  S
Sbjct  730  VRALSTSVLRDILHTSLIKSNSKSVNVNGIY-PSYQYFS-SGIIDWKADIEKCLGWEVRS  787

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            QLA G S +FL  AAKEL C+IS+
Sbjct  788  QLATGQSTQFLQAAAKELSCSISL  811



>ref|XP_004139688.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=1168

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR ILH+  IKS +K VN+NGI+ P+YQ  +  G IDW+ADIE+CL  E  S
Sbjct  1087  VRALSTSVLRDILHTSLIKSNSKSVNVNGIY-PSYQYFS-SGIIDWKADIEKCLGWEVRS  1144

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             QLA G S +FL  AAKEL C+IS+
Sbjct  1145  QLATGQSTQFLQAAAKELSCSISL  1168



>ref|XP_010477546.1| PREDICTED: protein GIGANTEA-like isoform X4 [Camelina sativa]
Length=1169

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG+H P+Y+  N   TIDW+ADI++CLN 
Sbjct  1081  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-AATIDWKADIQKCLNW  1139

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1140  EAHSLLSTTMPTQFLDTAARELGCTISL  1167



>ref|XP_010477545.1| PREDICTED: protein GIGANTEA-like isoform X3 [Camelina sativa]
Length=1169

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG+H P+Y+  N   TIDW+ADI++CLN 
Sbjct  1081  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-AATIDWKADIQKCLNW  1139

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1140  EAHSLLSTTMPTQFLDTAARELGCTISL  1167



>ref|XP_010477544.1| PREDICTED: protein GIGANTEA-like isoform X2 [Camelina sativa]
Length=1170

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG+H P+Y+  N   TIDW+ADI++CLN 
Sbjct  1082  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-AATIDWKADIQKCLNW  1140

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1141  EAHSLLSTTMPTQFLDTAARELGCTISL  1168



>ref|XP_010477543.1| PREDICTED: protein GIGANTEA-like isoform X1 [Camelina sativa]
Length=1170

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG+H P+Y+  N   TIDW+ADI++CLN 
Sbjct  1082  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-AATIDWKADIQKCLNW  1140

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1141  EAHSLLSTTMPTQFLDTAARELGCTISL  1168



>ref|XP_006306336.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
 gb|EOA39234.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
Length=1171

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG+H P+Y+  N   TIDW+ADI++CLN 
Sbjct  1083  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-AATIDWKADIQKCLNW  1141

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1142  EAHSLLSTTMPTQFLDTAAQELGCTISL  1169



>ref|XP_010462850.1| PREDICTED: protein GIGANTEA-like [Camelina sativa]
Length=1138

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG+H P+Y+  N   TIDW+ADI++CLN 
Sbjct  1050  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-AATIDWKADIQKCLNW  1108

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1109  EAHSLLSTTMPTQFLDTAARELGCTISL  1136



>gb|KFK44368.1| gigantea [Arabis alpina]
Length=1173

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 8/91 (9%)
 Frame = -1

Query  584   VRALSISVLRAILHSG--SIKSRAKPVNM-----NGIHGPAYQCLNVGGTIDWQADIERC  426
             VRALS SVLR I++    +IK+  KP+       NG+H P+Y+  N   TIDW+ADI++C
Sbjct  1081  VRALSTSVLRDIMNQSPITIKATPKPITTTATEKNGMHSPSYRFFN-AATIDWKADIQKC  1139

Query  425   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  333
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1140  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1170



>ref|XP_002890532.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66791.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
Length=1174

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALSISVLR I++  SI  +  P       NG++ P+Y+  N   TIDW+ADI++CLN 
Sbjct  1086  VRALSISVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AATIDWKADIQKCLNW  1144

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1145  EAHSLLSTTMPTQFLDTAARELGCTISL  1172



>ref|XP_004140955.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
 gb|KGN46115.1| hypothetical protein Csa_6G055360 [Cucumis sativus]
Length=1170

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR IL +GS   R+ P N+NG+H P++Q  N    I+W+ D+E+CL  EAHS
Sbjct  1088  VRALSTSVLRDILQTGSYVHRSTPNNINGVHSPSFQYFNREA-INWKVDLEKCLTWEAHS  1146

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L  GM  E L  AAKELGC+IS+
Sbjct  1147  RLVTGMPIEVLHVAAKELGCSISL  1170



>ref|XP_010498761.1| PREDICTED: protein GIGANTEA [Camelina sativa]
Length=1169

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG+H P+Y+  N   +IDW+ADI++CLN 
Sbjct  1081  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-ATSIDWKADIQKCLNW  1139

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1140  EAHSLLSTTMPTQFLDTAARELGCTISL  1167



>gb|AFK65758.1| GIGANTEA, partial [Chrysanthemum x morifolium]
Length=1151

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VR +SISVLRAILH G +++  +  N+    GPAYQ LNV  T DW++D+ +CL  EAHS
Sbjct  1069  VRTVSISVLRAILHVGVLRTSGEEANIPAACGPAYQYLNVDVT-DWESDVGKCLTWEAHS  1127

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++A GM  ++L+TAAKELGC IS+
Sbjct  1128  RIATGMPIQYLNTAAKELGCPISI  1151



>ref|XP_010062087.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062088.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062089.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 gb|KCW69154.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1166

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 2/84 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR I+ +GS+ SR      NGIH P  Q  N+   I+WQADI +CL  EAHS
Sbjct  1085  VRALSTSVLRDIMQTGSVDSRQSVRERNGIHSPC-QYFNLD-VIEWQADIGKCLKWEAHS  1142

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L++GMS +FLD AAKELGCTIS+
Sbjct  1143  RLSSGMSIQFLDIAAKELGCTISL  1166



>gb|KCW69153.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1167

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 2/84 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR I+ +GS+ SR      NGIH P  Q  N+   I+WQADI +CL  EAHS
Sbjct  1086  VRALSTSVLRDIMQTGSVDSRQSVRERNGIHSPC-QYFNLD-VIEWQADIGKCLKWEAHS  1143

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L++GMS +FLD AAKELGCTIS+
Sbjct  1144  RLSSGMSIQFLDIAAKELGCTISL  1167



>ref|XP_010062090.1| PREDICTED: protein GIGANTEA isoform X2 [Eucalyptus grandis]
 ref|XP_010062091.1| PREDICTED: protein GIGANTEA isoform X2 [Eucalyptus grandis]
Length=983

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 2/84 (2%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR I+ +GS+ SR      NGIH P  Q  N+   I+WQADI +CL  EAHS
Sbjct  902  VRALSTSVLRDIMQTGSVDSRQSVRERNGIHSPC-QYFNLD-VIEWQADIGKCLKWEAHS  959

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            +L++GMS +FLD AAKELGCTIS+
Sbjct  960  RLSSGMSIQFLDIAAKELGCTISL  983



>gb|KHN00736.1| Protein GIGANTEA [Glycine soja]
Length=176

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 59/84 (70%), Gaps = 4/84 (5%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR ILH+ SI S  KP   NGIH    Q  N+   IDW+AD+E+C   EAHS
Sbjct  97   VRALSTSVLRDILHTSSIGSSPKPPQKNGIHN---QYFNLD-VIDWRADVEKCSTWEAHS  152

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            +L+NG+S E+L+TAA +LG  IS+
Sbjct  153  RLSNGLSIEYLNTAANDLGFAISI  176



>dbj|BAM67030.1| gigantea-like [Chrysanthemum seticuspe f. boreale]
Length=1145

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VR LS SVLRAILH G +     P N+    GPAYQ LNV  T DW++D+ +CL  EAHS
Sbjct  1063  VRTLSTSVLRAILHVGLVNPIGAPPNIPAACGPAYQYLNVDVT-DWESDVGKCLTWEAHS  1121

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++A GM  ++L+TAAKELGC IS+
Sbjct  1122  RIATGMPIQYLNTAAKELGCPISI  1145



>gb|AGL61504.1| gigantea-like protein [Chrysanthemum x morifolium]
Length=1145

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VR LS SVLRAILH G +     P N+    GPAYQ LNV  T DW++D+ +CL  EAHS
Sbjct  1063  VRTLSTSVLRAILHVGLVNPIGAPPNIPAACGPAYQYLNVDVT-DWESDVGKCLTWEAHS  1121

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             ++A GM  ++L+TAAKELGC IS+
Sbjct  1122  RIATGMPIQYLNTAAKELGCPISI  1145



>ref|XP_008456743.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456744.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456745.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
Length=1170

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR IL +GS   R+ P N+NG+H P++Q  N    I+W+ D+E+CL  EAHS
Sbjct  1088  VRALSTSVLRNILQTGSYVLRSTPKNINGVHSPSFQYFNREA-INWKDDLEKCLTWEAHS  1146

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L  GM  E L  AAKELGC+IS+
Sbjct  1147  RLVTGMPIEVLHVAAKELGCSISL  1170



>gb|ABP96481.1| GIGANTEA [Arabidopsis lyrata subsp. petraea]
Length=1173

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALSISVLR I++  S   +  P       NG++ P+Y+  N   TIDW+ADI++CLN 
Sbjct  1086  VRALSISVLRDIMNQSSXPIKVTPKLPTTEKNGMNSPSYRFFN-AATIDWKADIQKCLNW  1144

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1145  EAHSLLSTTMPTQFLDTAARELGCTISL  1172



>gb|AAF00023.1| GIGANTEA [Arabidopsis thaliana]
Length=1155

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ CLN 
Sbjct  1067  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNCLNW  1125

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1126  EAHSLLSTTMPTQFLDTAARELGCTISL  1153



>gb|AAT97404.1| gigantea [Arabidopsis thaliana]
Length=1173

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ CLN 
Sbjct  1085  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNCLNW  1143

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1144  EAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|ABR26000.1| gigantea protein [Oryza sativa Indica Group]
Length=169

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
            VRALS+SVLR IL+SG I S    +  + NGI  P YQCL     I+WQAD+ERC+  EA
Sbjct  85   VRALSMSVLRDILNSGQINSSKLIQGEHRNGIQSPTYQCL-AASIINWQADVERCIEWEA  143

Query  410  HSQLANGMSAEFLDTAAKELGCTIS  336
            HS+ A G++  FL  AAKELGC ++
Sbjct  144  HSRRATGLTLAFLTAAAKELGCPLT  168



>gb|ABP96496.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ CLN 
Sbjct  1085  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNCLNW  1143

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1144  EAHSLLSTTMPTQFLDTAARELGCTISL  1171



>ref|NP_564180.1| protein GIGANTEA [Arabidopsis thaliana]
 sp|Q9SQI2.2|GIGAN_ARATH RecName: Full=Protein GIGANTEA [Arabidopsis thaliana]
 gb|AAF00092.1|AF105064_1 GIGANTEA [Arabidopsis thaliana]
 emb|CAB56039.1| gigantea protein [Arabidopsis thaliana]
 gb|AAT97405.1| gigantea [Arabidopsis thaliana]
 gb|AEE30286.1| gigantea protein (GI) [Arabidopsis thaliana]
Length=1173

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ CLN 
Sbjct  1085  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNCLNW  1143

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1144  EAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|AAT80910.1| GIGANTEA [Arabidopsis thaliana]
Length=1173

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ CLN 
Sbjct  1085  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNCLNW  1143

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1144  EAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|ABP96485.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96486.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96499.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ CLN 
Sbjct  1085  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNCLNW  1143

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1144  EAHSLLSTTMPTQFLDTAARELGCTISL  1171



>emb|CAA72908.1| hypothetical protein [Arabidopsis thaliana]
Length=1167

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ CLN 
Sbjct  1079  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNCLNW  1137

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1138  EAHSLLSTTMPTQFLDTAARELGCTISL  1165



>gb|ABP96488.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ CLN 
Sbjct  1085  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNCLNW  1143

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1144  EAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|ABP96484.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96487.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96489.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96500.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96501.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ CLN 
Sbjct  1085  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNCLNW  1143

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1144  EAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|ABP96498.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ CLN 
Sbjct  1085  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNCLNW  1143

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1144  EAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|ABP96483.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96490.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96491.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96492.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96493.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96494.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96495.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96502.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ CLN 
Sbjct  1085  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNCLNW  1143

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1144  EAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|ABP96497.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ CLN 
Sbjct  1085  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNCLNW  1143

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1144  EAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|ABP96482.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ CLN 
Sbjct  1085  VRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNCLNW  1143

Query  416   EAHSQLANGMSAEFLDTAAKELGCTISV  333
             EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1144  EAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|KJB28962.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1147

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 54/84 (64%), Gaps = 10/84 (12%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR IL S         + +NGIHGP +        IDW  DIE+CL  EAHS
Sbjct  1074  VRALSISVLRNILQSN------PKLEINGIHGPYFSI----SVIDWHTDIEKCLTWEAHS  1123

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             QLA GM   FLDTAAKELGC IS+
Sbjct  1124  QLARGMPIHFLDTAAKELGCNISM  1147



>gb|KJB28961.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1155

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 54/84 (64%), Gaps = 10/84 (12%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR IL S         + +NGIHGP +        IDW  DIE+CL  EAHS
Sbjct  1082  VRALSISVLRNILQSN------PKLEINGIHGPYFSI----SVIDWHTDIEKCLTWEAHS  1131

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             QLA GM   FLDTAAKELGC IS+
Sbjct  1132  QLARGMPIHFLDTAAKELGCNISM  1155



>gb|KHN41309.1| Protein GIGANTEA [Glycine soja]
Length=1166

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 4/84 (5%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SV+R ILH+ SI S  KP+  NGIH    Q LN    IDW+AD+E CL  EAHS
Sbjct  1087  VRALSSSVIRDILHTSSIGSSPKPLQKNGIHD---QYLNFD-VIDWRADVENCLTWEAHS  1142

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L+NG+S E+L+TAA +LG  IS+
Sbjct  1143  RLSNGLSIEYLNTAADDLGFAISI  1166



>ref|XP_006416159.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 ref|XP_006416160.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34512.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34513.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=1171

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 59/89 (66%), Gaps = 6/89 (7%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKP-----VNMNGIHGPAYQCLNVGGTIDWQADIERCLN  420
             VRALS SVLR I++  S+     P        N +H P+Y+  N   TIDW+ADI++CLN
Sbjct  1081  VRALSTSVLRDIMNQSSVTITVTPKQRPATEKNVMHSPSYRFFN-AATIDWKADIQKCLN  1139

Query  419   CEAHSQLANGMSAEFLDTAAKELGCTISV  333
              EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1140  WEAHSLLSTTMPTQFLDTAARELGCTISL  1168



>gb|ACJ65314.1| GI3 protein [Glycine max]
Length=1155

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 4/84 (5%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SV+R ILH+ SI S  KP+  NGIH    Q LN    IDW+AD+E CL  EAHS
Sbjct  1076  VRALSSSVIRDILHTSSIGSSPKPLQKNGIHD---QYLNFD-VIDWRADVENCLTWEAHS  1131

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L+NG+S E+L+TAA +LG  IS+
Sbjct  1132  RLSNGLSIEYLNTAADDLGFAISI  1155



>ref|XP_010681263.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
 ref|XP_010681268.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
Length=1178

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR I  +GSIK   K  + NG H  A++ L++G  IDW  DIE+CL  EAHS
Sbjct  1096  VRALSTSVLRDIQQNGSIKFSFKQESRNGTHKTAFEYLHIG-IIDWHTDIEKCLTWEAHS  1154

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +L  G + E+LD AAKELGC I++
Sbjct  1155  RLTRGKTIEYLDMAAKELGCAITI  1178



>ref|XP_010261025.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nelumbo nucifera]
Length=1102

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS+SVLR +L+ GS +S +K   +  IHG  Y  L++G  IDW  DIE+CL CEA S
Sbjct  1020  VRALSVSVLRDVLYIGSNRSNSKQEGIQAIHGTRYPYLSLG-IIDWHEDIEKCLKCEAQS  1078

Query  404   QLANGMSAEFLDTAAKELGCTIS  336
             + A+GM+  FL  AAKELGCTIS
Sbjct  1079  RHASGMNITFLGAAAKELGCTIS  1101



>dbj|BAD68053.1| putative gigantea [Oryza sativa Japonica Group]
Length=261

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
            VRALS+SVLR IL+SG I S    +  + NGI  P YQCL     I+WQAD+ERC+  EA
Sbjct  177  VRALSMSVLRDILNSGQINSSKLIQGEHRNGIQSPTYQCL-AASIINWQADVERCIEWEA  235

Query  410  HSQLANGMSAEFLDTAAKELGCTIS  336
            HS+ A G++  FL  AAKELGC ++
Sbjct  236  HSRRATGLTLAFLTAAAKELGCPLT  260



>ref|XP_010261024.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1174

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS+SVLR +L+ GS +S +K   +  IHG  Y  L++G  IDW  DIE+CL CEA S
Sbjct  1092  VRALSVSVLRDVLYIGSNRSNSKQEGIQAIHGTRYPYLSLG-IIDWHEDIEKCLKCEAQS  1150

Query  404   QLANGMSAEFLDTAAKELGCTIS  336
             + A+GM+  FL  AAKELGCTIS
Sbjct  1151  RHASGMNITFLGAAAKELGCTIS  1173



>ref|XP_008461914.1| PREDICTED: protein GIGANTEA-like isoform X3 [Cucumis melo]
Length=954

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR ILH+ SIKS +K VN+NGI+ P+YQ  +  G IDW+ADIE+CL  E  S
Sbjct  873  VRALSTSVLRDILHTSSIKSSSKSVNINGIY-PSYQYFS-SGIIDWKADIEKCLGWEVRS  930

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            QLA+G S +FL  AAKEL C+IS+
Sbjct  931  QLASGQSTQFLQAAAKELSCSISL  954



>ref|XP_008461912.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cucumis melo]
Length=1168

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR ILH+ SIKS +K VN+NGI+ P+YQ  +  G IDW+ADIE+CL  E  S
Sbjct  1087  VRALSTSVLRDILHTSSIKSSSKSVNINGIY-PSYQYFS-SGIIDWKADIEKCLGWEVRS  1144

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             QLA+G S +FL  AAKEL C+IS+
Sbjct  1145  QLASGQSTQFLQAAAKELSCSISL  1168



>ref|XP_008461913.1| PREDICTED: protein GIGANTEA-like isoform X2 [Cucumis melo]
Length=999

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
            VRALS SVLR ILH+ SIKS +K VN+NGI+ P+YQ  +  G IDW+ADIE+CL  E  S
Sbjct  918  VRALSTSVLRDILHTSSIKSSSKSVNINGIY-PSYQYFS-SGIIDWKADIEKCLGWEVRS  975

Query  404  QLANGMSAEFLDTAAKELGCTISV  333
            QLA+G S +FL  AAKEL C+IS+
Sbjct  976  QLASGQSTQFLQAAAKELSCSISL  999



>gb|EEE54000.1| hypothetical protein OsJ_00641 [Oryza sativa Japonica Group]
Length=1176

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR IL+SG I S    +  + NGI  P YQCL     I+WQAD+ERC+  EA
Sbjct  1092  VRALSMSVLRDILNSGQINSSKLIQGEHRNGIQSPTYQCL-AASIINWQADVERCIEWEA  1150

Query  410   HSQLANGMSAEFLDTAAKELGCTIS  336
             HS+ A G++  FL  AAKELGC ++
Sbjct  1151  HSRRATGLTLAFLTAAAKELGCPLT  1175



>ref|NP_001042220.1| Os01g0182600 [Oryza sativa Japonica Group]
 sp|Q9AWL7.2|GIGAN_ORYSJ RecName: Full=Protein GIGANTEA [Oryza sativa Japonica Group]
 dbj|BAD68052.1| putative gigantea [Oryza sativa Japonica Group]
 dbj|BAF04134.1| Os01g0182600 [Oryza sativa Japonica Group]
Length=1160

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR IL+SG I S    +  + NGI  P YQCL     I+WQAD+ERC+  EA
Sbjct  1076  VRALSMSVLRDILNSGQINSSKLIQGEHRNGIQSPTYQCL-AASIINWQADVERCIEWEA  1134

Query  410   HSQLANGMSAEFLDTAAKELGCTIS  336
             HS+ A G++  FL  AAKELGC ++
Sbjct  1135  HSRRATGLTLAFLTAAAKELGCPLT  1159



>gb|EEC70061.1| hypothetical protein OsI_00663 [Oryza sativa Indica Group]
Length=1176

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR IL+SG I S    +  + NGI  P YQCL     I+WQAD+ERC+  EA
Sbjct  1092  VRALSMSVLRDILNSGQINSSKLIQGEHRNGIQSPTYQCL-AASIINWQADVERCIEWEA  1150

Query  410   HSQLANGMSAEFLDTAAKELGCTIS  336
             HS+ A G++  FL  AAKELGC ++
Sbjct  1151  HSRRATGLTLAFLTAAAKELGCPLT  1175



>gb|AEK05790.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05808.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  EA S
Sbjct  1041  VRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWEARS  1099

Query  404   QLANGMSAEFLDTA  363
             +LA GM    LDTA
Sbjct  1100  RLATGMPIHHLDTA  1113



>gb|AEK05802.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  EA S
Sbjct  1041  VRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWEARS  1099

Query  404   QLANGMSAEFLDTA  363
             +LA GM    LDTA
Sbjct  1100  RLATGMPIHHLDTA  1113



>gb|AEK05807.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05810.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05811.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  EA S
Sbjct  1041  VRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWEARS  1099

Query  404   QLANGMSAEFLDTA  363
             +LA GM    LDTA
Sbjct  1100  RLATGMPIHHLDTA  1113



>gb|AEK05801.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  EA S
Sbjct  1041  VRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWEARS  1099

Query  404   QLANGMSAEFLDTA  363
             +LA GM    LDTA
Sbjct  1100  RLATGMPIHHLDTA  1113



>gb|AEK05799.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  EA S
Sbjct  1041  VRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWEARS  1099

Query  404   QLANGMSAEFLDTA  363
             +LA GM    LDTA
Sbjct  1100  RLATGMPIHHLDTA  1113



>gb|AEK05795.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05800.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  EA S
Sbjct  1041  VRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWEARS  1099

Query  404   QLANGMSAEFLDTA  363
             +LA GM    LDTA
Sbjct  1100  RLATGMPIHHLDTA  1113



>gb|AEK05793.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05794.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05796.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05797.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05798.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05804.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05805.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05806.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05809.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  EA S
Sbjct  1041  VRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWEARS  1099

Query  404   QLANGMSAEFLDTA  363
             +LA GM    LDTA
Sbjct  1100  RLATGMPIHHLDTA  1113



>gb|AEK05791.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05792.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  EA S
Sbjct  1041  VRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWEARS  1099

Query  404   QLANGMSAEFLDTA  363
             +LA GM    LDTA
Sbjct  1100  RLATGMPIHHLDTA  1113



>gb|EYU30283.1| hypothetical protein MIMGU_mgv1a000455mg [Erythranthe guttata]
Length=1141

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
             VRALS SVLRAILH+GS K    K    N IH P +    +   +DWQADIE+CL  EAH
Sbjct  1060  VRALSTSVLRAILHAGSRKPNTTKTGAANSIHSPRHHHHLL---LDWQADIEKCLAWEAH  1116

Query  407   SQLANGMSAEFLDTAAKELGCTISV  333
             S+   G+  +F+D+AAKELGCTISV
Sbjct  1117  SRRVTGLPVQFVDSAAKELGCTISV  1141



>gb|ACF84482.1| unknown [Zea mays]
Length=488

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 59/86 (69%), Gaps = 6/86 (7%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIK----SRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
            VRALS+SVLR IL  GS+     SR +    NGI  P+Y+C+   G ++WQAD+ERC+  
Sbjct  403  VRALSMSVLRDILDHGSVSPNKISRGEQ-QRNGIQSPSYRCV-AAGILNWQADVERCIEW  460

Query  416  EAHSQLANGMSAEFLDTAAKELGCTI  339
            EAHS+ A G++  FL TAAKELGC +
Sbjct  461  EAHSRRATGLTLAFLSTAAKELGCPL  486



>gb|ABZ81992.1| gigantea [Zea mays]
Length=1162

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSI---KSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  414
             VRALS+SVLR IL +GS+   K+       NGI  P+Y+CL   G I+WQAD+ERC+  E
Sbjct  1077  VRALSMSVLRDILSNGSVNPNKTIQGEQQRNGIQSPSYRCL-AAGIINWQADVERCIEWE  1135

Query  413   AHSQLANGMSAEFLDTAAKELGCTI  339
             AHS+ A G++  FL  AAKELGC +
Sbjct  1136  AHSRRATGLTLAFLSAAAKELGCPL  1160



>ref|NP_001288586.1| gigantea like1a [Zea mays]
 ref|XP_008655715.1| PREDICTED: protein GIGANTEA [Zea mays]
 ref|XP_008655716.1| PREDICTED: protein GIGANTEA [Zea mays]
 tpg|DAA06172.1| TPA_inf: gigantea 1A [Zea mays]
 gb|AFW80283.1| gigantea isoform 1 [Zea mays]
 gb|AFW80284.1| gigantea isoform 2 [Zea mays]
Length=1162

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSI---KSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  414
             VRALS+SVLR IL +GS+   K+       NGI  P+Y+CL   G I+WQAD+ERC+  E
Sbjct  1077  VRALSMSVLRDILSNGSVNPNKTIQGEQQRNGIQSPSYRCL-AAGIINWQADVERCIEWE  1135

Query  413   AHSQLANGMSAEFLDTAAKELGCTI  339
             AHS+ A G++  FL  AAKELGC +
Sbjct  1136  AHSRRATGLTLAFLSAAAKELGCPL  1160



>ref|XP_010915066.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1171

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMN-GIHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
             VRALS SVLR I+HS  IKS +     N GI  P+Y CL+VG  I+W ADIE+C+  EAH
Sbjct  1088  VRALSTSVLRDIMHSNPIKSTSFLHGDNQGICDPSYGCLSVG-IINWHADIEKCIKWEAH  1146

Query  407   SQLANGMSAEFLDTAAKELGCTIS  336
             S+LA G++  FL+ AAKELGC ++
Sbjct  1147  SRLATGLTLAFLNAAAKELGCPLT  1170



>emb|CAB56058.1| gigantea homologue [Oryza sativa]
Length=975

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
            VRALS+SVLR IL+SG I S    +  + NGI  P YQCL     I+WQAD+ERC+  EA
Sbjct  892  VRALSMSVLRDILNSGQINSSKLIQGEHRNGIQSPTYQCL-AASIINWQADVERCIEWEA  950

Query  410  HSQLANGMSAEFLDTAAKELGCTIS  336
            HS+ A G++  FL TAAKELGC ++
Sbjct  951  HSRRATGLTLAFL-TAAKELGCPLT  974



>ref|XP_008672375.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672376.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672377.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 tpg|DAA53146.1| TPA: gigantea1B [Zea mays]
Length=1160

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 59/86 (69%), Gaps = 6/86 (7%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIK----SRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS+SVLR IL  GS+     SR +    NGI  P+Y+C+   G ++WQAD+ERC+  
Sbjct  1075  VRALSMSVLRDILDHGSVSPNKISRGE-QQRNGIQSPSYRCV-AAGILNWQADVERCIEW  1132

Query  416   EAHSQLANGMSAEFLDTAAKELGCTI  339
             EAHS+ A G++  FL TAAKELGC +
Sbjct  1133  EAHSRRATGLTLAFLSTAAKELGCPL  1158



>ref|NP_001140728.1| uncharacterized protein LOC100272803 [Zea mays]
 tpg|DAA06171.1| TPA_inf: gigantea 1B [Zea mays]
Length=1160

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 59/86 (69%), Gaps = 6/86 (7%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIK----SRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS+SVLR IL  GS+     SR +    NGI  P+Y+C+   G ++WQAD+ERC+  
Sbjct  1075  VRALSMSVLRDILDHGSVSPNKISRGE-QQRNGIQSPSYRCV-AAGILNWQADVERCIEW  1132

Query  416   EAHSQLANGMSAEFLDTAAKELGCTI  339
             EAHS+ A G++  FL TAAKELGC +
Sbjct  1133  EAHSRRATGLTLAFLSTAAKELGCPL  1158



>ref|XP_010535090.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535098.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535104.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
Length=1167

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNG-IHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
             VR LSISVLR I+   S+K + KP   NG IH   +   N G  IDW+ADI++CL+ EAH
Sbjct  1081  VRTLSISVLRGIMQQSSMKKK-KPQEKNGGIHKGTF--FNGGEAIDWKADIQKCLSWEAH  1137

Query  407   SQLANGMSAEFLDTAAKELGCTISV  333
             S +++ +  +FLDTAA ELGCTIS+
Sbjct  1138  SLVSSSLPTQFLDTAALELGCTISI  1162



>ref|XP_006643836.1| PREDICTED: protein GIGANTEA-like isoform X1 [Oryza brachyantha]
 ref|XP_006643837.1| PREDICTED: protein GIGANTEA-like isoform X2 [Oryza brachyantha]
Length=1162

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 5/87 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKS----RAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  417
             VRALS+SVLR IL+SG I S    + +  + NGI  P YQCL     I+WQAD+ERC+  
Sbjct  1076  VRALSMSVLRDILNSGQIHSSKLIQIQGEHRNGIQSPTYQCL-AASIINWQADVERCIEW  1134

Query  416   EAHSQLANGMSAEFLDTAAKELGCTIS  336
             EA S+ A G++  FL  AAKELGC ++
Sbjct  1135  EARSRRATGLTLAFLTAAAKELGCPLT  1161



>gb|AEK05803.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    I WQADIE+CL  EA S
Sbjct  1041  VRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIXWQADIEKCLTWEARS  1099

Query  404   QLANGMSAEFLDTA  363
             +LA GM    LDTA
Sbjct  1100  RLATGMPIHHLDTA  1113



>ref|XP_009115601.1| PREDICTED: protein GIGANTEA [Brassica rapa]
Length=1171

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 59/92 (64%), Gaps = 9/92 (10%)
 Frame = -1

Query  584   VRALSISVLRAIL-HSGSIKSRAKPV-------NMNGIHGPAYQCLNVGGTIDWQADIER  429
             VRALS SVLR I+  SG   ++A P          NG   P+Y+  N    IDW+ADI++
Sbjct  1078  VRALSTSVLRDIMNQSGITTTKATPKPPPTITTEKNGTDSPSYRFFNAAA-IDWKADIQK  1136

Query  428   CLNCEAHSQLANGMSAEFLDTAAKELGCTISV  333
             CLN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1137  CLNWEAHSLLSTTMPTQFLDTAARELGCTISM  1168



>ref|XP_008793464.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1169

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
             VRALS SVLR I++S  IKS +    +  G+  P+Y CL+VG  ++W ADIE+C+  EAH
Sbjct  1086  VRALSTSVLRDIMYSNPIKSTSFMHGDSQGLRDPSYGCLSVG-IVNWHADIEKCIKWEAH  1144

Query  407   SQLANGMSAEFLDTAAKELGCTIS  336
             S+ A G++  FLD AAKELGC ++
Sbjct  1145  SRRATGLTLAFLDAAAKELGCPLT  1168



>emb|CDY21388.1| BnaA09g30390D [Brassica napus]
Length=1171

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 59/92 (64%), Gaps = 9/92 (10%)
 Frame = -1

Query  584   VRALSISVLRAIL-HSGSIKSRAKPV-------NMNGIHGPAYQCLNVGGTIDWQADIER  429
             VRALS SVLR I+  SG   ++A P          NG   P+Y+  N    IDW+ADI++
Sbjct  1078  VRALSTSVLRDIMNQSGITTTKATPKPPPTITTEKNGTDSPSYRFFNAAA-IDWKADIQK  1136

Query  428   CLNCEAHSQLANGMSAEFLDTAAKELGCTISV  333
             CLN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1137  CLNWEAHSLLSTTMPTQFLDTAARELGCTISM  1168



>ref|NP_001288824.1| protein GIGANTEA [Brassica rapa]
 gb|AEB33730.1| GIGANTEA [Brassica rapa]
Length=1183

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 59/92 (64%), Gaps = 9/92 (10%)
 Frame = -1

Query  584   VRALSISVLRAIL-HSGSIKSRAKPV-------NMNGIHGPAYQCLNVGGTIDWQADIER  429
             VRALS SVLR I+  SG   ++A P          NG   P+Y+  N    IDW+ADI++
Sbjct  1090  VRALSTSVLRDIMNQSGITTTKATPKPPPTITTEKNGTDSPSYRFFNAAA-IDWKADIQK  1148

Query  428   CLNCEAHSQLANGMSAEFLDTAAKELGCTISV  333
             CLN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1149  CLNWEAHSLLSTTMPTQFLDTAARELGCTISM  1180



>ref|XP_006842209.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
 gb|ERN03884.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
Length=1143

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS S+LR IL+ GS KS     ++ GI  P Y+ +++G TIDW++D+E+CL  EA +
Sbjct  1061  VRALSTSLLRDILNIGSPKSNFAEEDIRGIPVPPYRNISIG-TIDWRSDLEKCLAWEARN  1119

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             + A GM+  FL  AAKELGC ISV
Sbjct  1120  RRATGMTLTFLSAAAKELGCAISV  1143



>ref|XP_007151935.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
 gb|ESW23929.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
Length=1169

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 58/85 (68%), Gaps = 5/85 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
             VRALS SVLR ILH+ SI+  + K    N IH    Q  N+   IDWQADI +CL  EAH
Sbjct  1089  VRALSTSVLRDILHTCSIRRYSPKRPQKNDIHN---QYFNLD-VIDWQADINKCLTWEAH  1144

Query  407   SQLANGMSAEFLDTAAKELGCTISV  333
             SQL NGMS E+L+TAA++LG  IS+
Sbjct  1145  SQLLNGMSIEYLNTAARDLGFGISI  1169



>emb|CDM81775.1| unnamed protein product [Triticum aestivum]
Length=1155

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 3/84 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR IL+SG + S    +    NGI  P YQC     T++WQAD+ERC++ EA
Sbjct  1071  VRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPNYQC-AAANTVNWQADVERCIDWEA  1129

Query  410   HSQLANGMSAEFLDTAAKELGCTI  339
              S+ A GM+  FL  AA ELGCT+
Sbjct  1130  RSRRATGMTLAFLTAAANELGCTL  1153



>emb|CDY04787.1| BnaC05g18020D [Brassica napus]
Length=1170

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 58/92 (63%), Gaps = 9/92 (10%)
 Frame = -1

Query  584   VRALSISVLRAIL-HSGSIKSRAKPV-------NMNGIHGPAYQCLNVGGTIDWQADIER  429
             VRALS SVLR I+  SG   S+A P          NG   P+Y+  N    IDW+ADI++
Sbjct  1077  VRALSTSVLRDIMNQSGITTSKATPKPPPTITTEKNGTDSPSYRFFNAAA-IDWKADIQK  1135

Query  428   CLNCEAHSQLANGMSAEFLDTAAKELGCTISV  333
             CLN EAHS L+  M  +FLDTAA ELGCTIS+
Sbjct  1136  CLNWEAHSLLSTTMPTQFLDTAAGELGCTISM  1167



>gb|ADZ72836.1| GIGANTEA-like protein [Aquilegia formosa]
Length=750

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAK-PVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
            VRALS SVLR IL  G IK   K     +G+ GP+++CL+    IDW  DIE+CL  EA 
Sbjct  667  VRALSTSVLRDILFLGPIKFNVKQEKRYSGVQGPSHRCLS-SSIIDWNKDIEKCLTWEAR  725

Query  407  SQLANGMSAEFLDTAAKELGCTI  339
            S+   G+S  FLD AAK+LGCTI
Sbjct  726  SRHTTGVSTTFLDAAAKDLGCTI  748



>gb|EMS55238.1| hypothetical protein TRIUR3_30834 [Triticum urartu]
Length=1126

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR IL+SG + S    +    NGI  P YQC     T++WQAD+ERC++ EA
Sbjct  1042  VRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPNYQC-TAANTVNWQADVERCIDWEA  1100

Query  410   HSQLANGMSAEFLDTAAKELGCTI  339
              S+ A GM+  FL  AA ELGC +
Sbjct  1101  RSRRATGMTLAFLTAAANELGCPL  1124



>gb|AIC83986.1| gigantea-like protein [Festuca pratensis]
Length=1149

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 3/84 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR IL+SG I S    +    NGI  P+Y+C+    T +WQAD+ERC+  EA
Sbjct  1065  VRALSMSVLRDILNSGPISSTKINQGEQRNGIQSPSYRCMAASMT-NWQADVERCIEWEA  1123

Query  410   HSQLANGMSAEFLDTAAKELGCTI  339
             H++ A GM+  FL  AA ELGC +
Sbjct  1124  HNRQATGMTLAFLTAAANELGCPL  1147



>gb|EMT06342.1| hypothetical protein F775_28583 [Aegilops tauschii]
Length=1146

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR IL+SG + S    +    NGI  P YQC     T++WQAD+ERC++ EA
Sbjct  1062  VRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPTYQC-AAANTVNWQADVERCIDWEA  1120

Query  410   HSQLANGMSAEFLDTAAKELGCTI  339
              S+ A GM+  FL  AA ELGC +
Sbjct  1121  RSRRATGMTLAFLTAAANELGCPL  1144



>gb|AAT79486.1| gigantea 2 [Triticum aestivum]
Length=1153

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR IL+SG + S    +    NGI  P YQC     T++WQAD+ERC++ EA
Sbjct  1069  VRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPTYQC-AAANTVNWQADVERCIDWEA  1127

Query  410   HSQLANGMSAEFLDTAAKELGCTI  339
              S+ A GM+  FL  AA ELGC +
Sbjct  1128  RSRRATGMTLAFLTAAANELGCPL  1151



>gb|AAQ11738.1| gigantea [Triticum aestivum]
Length=1155

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR IL+SG + S    +    NGI  P YQC     T++WQAD+ERC++ EA
Sbjct  1071  VRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPTYQC-AAANTVNWQADVERCIDWEA  1129

Query  410   HSQLANGMSAEFLDTAAKELGCTI  339
              S+ A GM+  FL  AA ELGC +
Sbjct  1130  RSRRATGMTLAFLTAAANELGCPL  1153



>gb|AAL08497.2| gigantea-like protein [Hordeum vulgare]
Length=856

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 5/85 (6%)
 Frame = -1

Query  584  VRALSISVLRAILHSGSIKSRAKPVN---MNGIHGPAYQCLNVGGTIDWQADIERCLNCE  414
            VRALS+SVLR IL+SG + S +K +     NGI  P YQC     T++WQAD+ERC++ E
Sbjct  772  VRALSMSVLRDILNSGPLGS-SKTIQGEQRNGIQSPNYQC-AAANTVNWQADVERCIDWE  829

Query  413  AHSQLANGMSAEFLDTAAKELGCTI  339
            A S+ A GM+  FL  AA ELGC +
Sbjct  830  ARSRRATGMTLAFLTAAANELGCPL  854



>gb|AAW66945.1| gigantea-like protein [Hordeum vulgare]
 gb|AAW66946.1| gigantea-like protein [Hordeum vulgare subsp. vulgare]
Length=1155

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 5/85 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVN---MNGIHGPAYQCLNVGGTIDWQADIERCLNCE  414
             VRALS+SVLR IL+SG + S +K +     NGI  P YQC     T++WQAD+ERC++ E
Sbjct  1071  VRALSMSVLRDILNSGPLGS-SKTIQGEQRNGIQSPNYQC-AAANTVNWQADVERCIDWE  1128

Query  413   AHSQLANGMSAEFLDTAAKELGCTI  339
             A S+ A GM+  FL  AA ELGC +
Sbjct  1129  ARSRRATGMTLAFLTAAANELGCPL  1153



>gb|AAT79487.1| gigantea 3 [Triticum aestivum]
Length=1155

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR IL+SG + S    +    NGI  P YQC     T++WQAD+ERC++ EA
Sbjct  1071  VRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPNYQC-AAANTVNWQADVERCIDWEA  1129

Query  410   HSQLANGMSAEFLDTAAKELGCTI  339
              S+ A GM+  FL  AA ELGC +
Sbjct  1130  RSRRATGMTLAFLTAAANELGCPL  1153



>ref|XP_010925341.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1170

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
             VRALS SVLRAI+H    KS      +  G++ P+Y+ L+  G I+W +DIE+C+  EAH
Sbjct  1087  VRALSTSVLRAIMHGNPTKSTTFMHGDRQGLYDPSYRSLS-AGVINWYSDIEKCIKWEAH  1145

Query  407   SQLANGMSAEFLDTAAKELGCTIS  336
             S+ A G++  FLD AAKELGC ++
Sbjct  1146  SRRATGLTLAFLDAAAKELGCPLT  1169



>ref|XP_009380419.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380420.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380421.1| PREDICTED: protein GIGANTEA-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=1162

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 58/89 (65%), Gaps = 12/89 (13%)
 Frame = -1

Query  584   VRALSISVLRAILH------SGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCL  423
             VRALSI+VLR I+       SG I+  A      G+  P+YQCLN+G  I+W +D+E+CL
Sbjct  1079  VRALSIAVLRNIIQNSMSNGSGRIQGDAP-----GLSDPSYQCLNLG-IINWHSDVEKCL  1132

Query  422   NCEAHSQLANGMSAEFLDTAAKELGCTIS  336
               EA S+LA G++  FL  AAKELGC IS
Sbjct  1133  KWEARSRLATGLTLAFLSAAAKELGCPIS  1161



>emb|CAY26028.1| GIGANTEA [Lolium perenne]
 gb|ABF83898.2| GIGANTEA [Lolium perenne]
Length=1148

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR IL+SG I S    +    NGI  P+Y+C     T +WQAD+ERC+  EA
Sbjct  1064  VRALSMSVLRDILNSGPISSTKIIQGEQRNGIQSPSYRCAAASMT-NWQADVERCIEWEA  1122

Query  410   HSQLANGMSAEFLDTAAKELGCTI  339
             H++ A GM+  FL  AA ELGC +
Sbjct  1123  HNRQATGMTLAFLTAAANELGCPL  1146



>ref|XP_003564357.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230544.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230545.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230546.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230547.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
Length=1155

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 3/84 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR IL+SG I S    +    NG+  P YQC      ++WQAD+ERC+  EA
Sbjct  1071  VRALSMSVLRDILNSGPINSTKIIQGEQRNGVQSPTYQC-AAASMVNWQADMERCIEWEA  1129

Query  410   HSQLANGMSAEFLDTAAKELGCTI  339
              S+ A GM+  FL  AA ELGC +
Sbjct  1130  RSRRATGMTLAFLSAAANELGCPL  1153



>ref|XP_004968438.1| PREDICTED: protein GIGANTEA-like [Setaria italica]
Length=1160

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 5/85 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSI---KSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  414
             VRALS+SVLR IL++G I   K        NGI   +Y+CL    +I+WQAD+ERC+  E
Sbjct  1076  VRALSMSVLRDILNNGHITPSKIIQGEQQRNGIQNSSYRCL--AASINWQADVERCIEWE  1133

Query  413   AHSQLANGMSAEFLDTAAKELGCTI  339
             AHS+ A G++  FL  AAKELGC +
Sbjct  1134  AHSRRATGLTLAFLSAAAKELGCPL  1158



>ref|XP_008786518.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786528.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786537.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1170

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAH  408
             VRALS S+LR I+H  + KS +    +  G+  P+Y+ L+  G I+W +DIE+C+  EAH
Sbjct  1087  VRALSSSILRVIMHGNTTKSTSFMHGDGQGLCDPSYRSLS-AGIINWHSDIEKCIKWEAH  1145

Query  407   SQLANGMSAEFLDTAAKELGCTIS  336
             S+ A GM+  FLD AAKELGC ++
Sbjct  1146  SRRATGMTLAFLDAAAKELGCPLT  1169



>gb|EYU36555.1| hypothetical protein MIMGU_mgv1a000427mg [Erythranthe guttata]
Length=1160

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 4/84 (5%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLRA+LH+GS    AK   +NG     Y  +   G  D +A +E+CL  EAHS
Sbjct  1081  VRALSTSVLRAVLHAGSESISAK-SQVNGFRSQPYISV---GIRDCKAHVEKCLTWEAHS  1136

Query  404   QLANGMSAEFLDTAAKELGCTISV  333
             +LA G+  +F+DT AKELGCTI +
Sbjct  1137  RLATGLPIQFVDTTAKELGCTICI  1160



>emb|CBI22759.3| unnamed protein product [Vitis vinifera]
Length=259

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  461  GTIDWQADIERCLNCEAHSQLANGMSAEFLDTAAKELGCTISV  333
            G IDWQADIE+CL  EAHS+LA GM+ +FLD AAKELGCTIS+
Sbjct  217  GIIDWQADIEKCLTWEAHSRLATGMTNQFLDVAAKELGCTISI  259



>gb|ADR51711.1| GI [Secale cereale]
Length=1142

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 52/81 (64%), Gaps = 3/81 (4%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR IL+SG + S    +    NGI  P YQC      ++WQAD+ERC++ EA
Sbjct  1063  VRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPNYQC-AAANMVNWQADVERCIDWEA  1121

Query  410   HSQLANGMSAEFLDTAAKELG  348
              S+ A GM+  FL  AA ELG
Sbjct  1122  RSRRATGMTLAFLTAAANELG  1142



>ref|XP_009381150.1| PREDICTED: protein GIGANTEA-like [Musa acuminata subsp. malaccensis]
Length=1171

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 53/82 (65%), Gaps = 10/82 (12%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR ILH GS  +         +   +YQ LN+G  I+W++DI++C+  EA S
Sbjct  1087  VRALSKSVLRDILHHGSCLN---------VDNSSYQLLNMG-IINWRSDIDKCIQWEAQS  1136

Query  404   QLANGMSAEFLDTAAKELGCTI  339
             ++A G++  +L  AAKELGC I
Sbjct  1137  RIATGLTLAYLSAAAKELGCPI  1158



>gb|ADP92454.1| GIGANTEA 1 [x Doritaenopsis hybrid cultivar]
Length=1160

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 6/84 (7%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIH--GPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALSISVLR I+++G I S +   N   +H   P+Y+ L   G  +W A+IE+C+  EA
Sbjct  1079  VRALSISVLRDIMNTGPINS-SNYTNTETLHLYDPSYRSL---GMTNWHANIEKCIKWEA  1134

Query  410   HSQLANGMSAEFLDTAAKELGCTI  339
              S+ A G++  FL +A+KELGC +
Sbjct  1135  RSRRATGLALSFLGSASKELGCPL  1158



>gb|AIR93790.1| gigantea [Kalanchoe fedtschenkoi]
Length=1149

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHG-PAYQCLNVGGTIDWQADIERCLNCEAH  408
             VRALSISV+R I+     +S A    ++ I G PA Q  +  G  DW+++IE CL  EAH
Sbjct  1066  VRALSISVVRDIMQIDVTESMAL-AEISSISGAPAEQSKSKLGIADWRSNIEMCLTWEAH  1124

Query  407   SQLANGMSAEFLDTAAKELGCTIS  336
             +++++ M+ EFL  AAKELGC  S
Sbjct  1125  NRISSEMTLEFLSIAAKELGCRFS  1148



>ref|XP_009408933.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408934.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1205

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 7/82 (9%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR ILHS      +  +N++G         N   +  WQAD+E+C+  EA S
Sbjct  1129  VRALSTSVLRDILHSSPTTISSGCLNVDGQR-------NCNSSYHWQADMEKCIQWEAQS  1181

Query  404   QLANGMSAEFLDTAAKELGCTI  339
             +LA G++  +L  AAKELGC I
Sbjct  1182  RLATGLTLAYLCAAAKELGCPI  1203



>ref|XP_009408935.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1163

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 7/82 (9%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS SVLR ILHS      +  +N++G         N   +  WQAD+E+C+  EA S
Sbjct  1087  VRALSTSVLRDILHSSPTTISSGCLNVDGQR-------NCNSSYHWQADMEKCIQWEAQS  1139

Query  404   QLANGMSAEFLDTAAKELGCTI  339
             +LA G++  +L  AAKELGC I
Sbjct  1140  RLATGLTLAYLCAAAKELGCPI  1161



>gb|ACT22765.1| GIGANTEA [Allium cepa]
Length=1109

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS+SVLR I+H   +K         G+   +Y+   +G T++W ADI++C+  EA S
Sbjct  1031  VRALSLSVLRDIMHISPLKFNTV---RTGVCNHSYRSSTLG-TVNWHADIDKCIKWEAQS  1086

Query  404   QLANGMSAEFLDTAAKELGC  345
               ANG +  FLD AA ELGC
Sbjct  1087  IEANGTTLAFLDAAANELGC  1106



>gb|ACT22764.1| GIGANTEA [Allium cepa]
Length=1109

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS+SVLR I+H   +K         G+   +Y+   +G T++W ADI++C+  EA S
Sbjct  1031  VRALSLSVLRDIMHISPLKFNTV---RTGVCNHSYRSSTLG-TVNWHADIDKCIKWEAQS  1086

Query  404   QLANGMSAEFLDTAAKELGC  345
               ANG +  FLD AA ELGC
Sbjct  1087  IEANGTTLAFLDAAANELGC  1106



>gb|ACY30446.1| gigantea-like protein [Liriodendron tulipifera]
Length=1209

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  411
             VRALS+SVLR ILH  SI +  K  +   IHGP YQCL +G TI+W +DIE+CL  EA
Sbjct  1094  VRALSMSVLRDILHIDSI-NLTKEEDAEQIHGPPYQCLTIG-TINWHSDIEKCLTWEA  1149



>dbj|BAD97869.1| GI homologue [Lemna gibba]
Length=1116

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSR----AKPVNMNGIHGPAYQ---CLNVGGTIDWQADIERC  426
             VRALS +VLR IL+S  ++ +        +   +H    +   CLN    IDWQADI++ 
Sbjct  1025  VRALSTAVLRDILNSAPMRVKNSGGGGGGHGEEVHSSPQKYSRCLNQAA-IDWQADIQKW  1083

Query  425   LNCEAHSQLANGMSAEFLDTAAKELGCTIS  336
             L  E HS+ A G++  FL  AAKELGCT S
Sbjct  1084  LLWELHSRRATGLTLSFLHHAAKELGCTTS  1113



>dbj|BAD97864.1| GI homologue 1 [Lemna paucicostata]
Length=1115

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 49/88 (56%), Gaps = 5/88 (6%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSR----AKPVNMNGIHG-PAYQCLNVGGTIDWQADIERCLN  420
             VRALS +VLR IL+   ++ +    +       +H  P        G IDWQADI++ L 
Sbjct  1025  VRALSTAVLRDILNGAPMRVKNSGSSSSGAAEEVHSSPQKYRAAQHGAIDWQADIQKWLL  1084

Query  419   CEAHSQLANGMSAEFLDTAAKELGCTIS  336
              E HS+ A G++  FL  AAKELGCT S
Sbjct  1085  WELHSRRATGLTLSFLQHAAKELGCTTS  1112



>dbj|BAP76055.1| putative GI [Cryptomeria japonica]
Length=1197

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = -1

Query  584   VRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHS  405
             VRALS S+LR ILH        K ++    H     C+       W+ D+E+CL  E H+
Sbjct  1102  VRALSTSLLRVILHESLNFGHGKYLSEKSHHSENVCCVEDLVIKYWRRDVEQCLAWEVHN  1161

Query  404   QLANGMSAEFLDTAAKELGCTI  339
             + A GMS   L +AA  LGC++
Sbjct  1162  RQARGMSVALLVSAANALGCSV  1183



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950