BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF046K05

Length=585
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611838.1|  PREDICTED: basic 7S globulin-like                  149   6e-39   Nicotiana tomentosiformis
ref|XP_006339396.1|  PREDICTED: basic 7S globulin-like                  142   2e-36   Solanum tuberosum [potatoes]
ref|XP_004229435.1|  PREDICTED: basic 7S globulin-like                  140   6e-36   Solanum lycopersicum
ref|XP_011090791.1|  PREDICTED: basic 7S globulin                       130   4e-32   Sesamum indicum [beniseed]
ref|XP_007034626.1|  Eukaryotic aspartyl protease family protein,...    127   7e-31   
gb|KEH36785.1|  eukaryotic aspartyl protease family protein             125   2e-30   Medicago truncatula
gb|KJB61114.1|  hypothetical protein B456_009G341600                    124   3e-30   Gossypium raimondii
gb|EYU41534.1|  hypothetical protein MIMGU_mgv1a008121mg                123   1e-29   Erythranthe guttata [common monkey flower]
ref|XP_002517162.1|  basic 7S globulin 2 precursor small subunit,...    122   4e-29   Ricinus communis
ref|XP_002280508.1|  PREDICTED: basic 7S globulin                       121   4e-29   Vitis vinifera
ref|XP_009342158.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    120   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_004486144.1|  PREDICTED: basic 7S globulin-like                  120   2e-28   Cicer arietinum [garbanzo]
ref|XP_006489306.1|  PREDICTED: basic 7S globulin-like                  119   2e-28   Citrus sinensis [apfelsine]
gb|KDO74801.1|  hypothetical protein CISIN_1g040581mg                   119   2e-28   Citrus sinensis [apfelsine]
emb|CDO98999.1|  unnamed protein product                                119   2e-28   Coffea canephora [robusta coffee]
ref|NP_001239980.1|  uncharacterized protein LOC100806719 precursor     119   3e-28   Glycine max [soybeans]
gb|KHN03053.1|  Basic 7S globulin                                       119   3e-28   Glycine soja [wild soybean]
ref|XP_006419821.1|  hypothetical protein CICLE_v10005127mg             119   3e-28   Citrus clementina [clementine]
ref|XP_007224886.1|  hypothetical protein PRUPE_ppa022337mg             119   3e-28   
ref|XP_007154121.1|  hypothetical protein PHAVU_003G092100g             118   7e-28   Phaseolus vulgaris [French bean]
ref|XP_008222998.1|  PREDICTED: basic 7S globulin 2                     118   8e-28   Prunus mume [ume]
gb|KDP40108.1|  hypothetical protein JCGZ_02106                         117   1e-27   Jatropha curcas
ref|XP_003550008.2|  PREDICTED: basic 7S globulin 2-like                117   2e-27   
gb|KHN03449.1|  Basic 7S globulin                                       117   2e-27   Glycine soja [wild soybean]
ref|XP_004298169.1|  PREDICTED: basic 7S globulin-like                  117   2e-27   Fragaria vesca subsp. vesca
gb|KDP21480.1|  hypothetical protein JCGZ_21951                         117   2e-27   Jatropha curcas
ref|XP_002272235.1|  PREDICTED: basic 7S globulin                       116   3e-27   Vitis vinifera
emb|CAN80378.1|  hypothetical protein VITISV_038701                     116   3e-27   Vitis vinifera
emb|CBI32364.3|  unnamed protein product                                116   3e-27   Vitis vinifera
emb|CAN68736.1|  hypothetical protein VITISV_030193                     116   4e-27   Vitis vinifera
ref|XP_002284868.1|  PREDICTED: basic 7S globulin-like                  116   4e-27   Vitis vinifera
gb|ACU24232.1|  unknown                                                 115   1e-26   Glycine max [soybeans]
ref|XP_003542884.1|  PREDICTED: basic 7S globulin                       115   1e-26   Glycine max [soybeans]
ref|XP_008340919.1|  PREDICTED: basic 7S globulin                       114   1e-26   
ref|XP_011014389.1|  PREDICTED: basic 7S globulin-like                  114   3e-26   Populus euphratica
ref|XP_004151001.1|  PREDICTED: basic 7S globulin-like                  113   3e-26   Cucumis sativus [cucumbers]
emb|CDP10858.1|  unnamed protein product                                113   6e-26   Coffea canephora [robusta coffee]
ref|XP_011026191.1|  PREDICTED: basic 7S globulin-like                  112   6e-26   Populus euphratica
ref|XP_010255899.1|  PREDICTED: basic 7S globulin-like                  112   7e-26   Nelumbo nucifera [Indian lotus]
ref|XP_008458562.1|  PREDICTED: basic 7S globulin-like                  112   8e-26   Cucumis melo [Oriental melon]
ref|XP_010242827.1|  PREDICTED: basic 7S globulin-like                  112   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_009411762.1|  PREDICTED: basic 7S globulin-like                  112   1e-25   
ref|XP_003546133.1|  PREDICTED: basic 7S globulin                       111   2e-25   Glycine max [soybeans]
ref|XP_010111673.1|  Basic 7S globulin                                  111   2e-25   Morus notabilis
ref|XP_004170412.1|  PREDICTED: basic 7S globulin-like                  111   2e-25   
ref|XP_010035593.1|  PREDICTED: basic 7S globulin-like                  111   2e-25   Eucalyptus grandis [rose gum]
ref|XP_002302122.1|  hypothetical protein POPTR_0002s05580g             111   3e-25   Populus trichocarpa [western balsam poplar]
emb|CDP03612.1|  unnamed protein product                                108   3e-25   Coffea canephora [robusta coffee]
ref|XP_003590668.1|  Basic 7S globulin                                  110   4e-25   Medicago truncatula
ref|XP_006489581.1|  PREDICTED: basic 7S globulin-like                  110   7e-25   
gb|KDO74788.1|  hypothetical protein CISIN_1g036132mg                   110   7e-25   Citrus sinensis [apfelsine]
ref|XP_011082548.1|  PREDICTED: basic 7S globulin-like                  109   9e-25   Sesamum indicum [beniseed]
ref|XP_004290668.1|  PREDICTED: basic 7S globulin 2-like                109   1e-24   Fragaria vesca subsp. vesca
ref|XP_003518926.1|  PREDICTED: basic 7S globulin                       109   1e-24   Glycine max [soybeans]
gb|KFK42682.1|  hypothetical protein AALP_AA1G026200                    108   2e-24   Arabis alpina [alpine rockcress]
ref|XP_004236054.1|  PREDICTED: basic 7S globulin-like                  108   2e-24   Solanum lycopersicum
emb|CAN61502.1|  hypothetical protein VITISV_011733                     108   2e-24   Vitis vinifera
ref|XP_006345120.1|  PREDICTED: basic 7S globulin-like                  108   2e-24   Solanum tuberosum [potatoes]
ref|XP_003590665.1|  Xyloglucan-specific endoglucanase inhibitor ...    108   2e-24   Medicago truncatula
ref|XP_010255900.1|  PREDICTED: basic 7S globulin 2-like                108   3e-24   Nelumbo nucifera [Indian lotus]
gb|AFK46427.1|  unknown                                                 107   3e-24   Medicago truncatula
gb|KJB46995.1|  hypothetical protein B456_008G005100                    107   6e-24   Gossypium raimondii
ref|XP_011011197.1|  PREDICTED: basic 7S globulin-like isoform X2       107   6e-24   Populus euphratica
ref|XP_008235257.1|  PREDICTED: basic 7S globulin 2-like                107   7e-24   Prunus mume [ume]
ref|XP_011015097.1|  PREDICTED: basic 7S globulin-like isoform X2       107   7e-24   Populus euphratica
ref|XP_006418255.1|  hypothetical protein EUTSA_v10007672mg             107   7e-24   Eutrema salsugineum [saltwater cress]
ref|XP_006419808.1|  hypothetical protein CICLE_v10006987mg             107   7e-24   Citrus clementina [clementine]
ref|XP_011011196.1|  PREDICTED: basic 7S globulin-like isoform X1       107   7e-24   Populus euphratica
ref|XP_011015096.1|  PREDICTED: basic 7S globulin-like isoform X1       107   8e-24   Populus euphratica
ref|XP_006489296.1|  PREDICTED: basic 7S globulin-like                  106   1e-23   Citrus sinensis [apfelsine]
ref|XP_007147764.1|  hypothetical protein PHAVU_006G153200g             106   1e-23   Phaseolus vulgaris [French bean]
ref|XP_006489297.1|  PREDICTED: basic 7S globulin-like                  106   1e-23   
ref|XP_007201544.1|  hypothetical protein PRUPE_ppa017430mg             106   1e-23   
ref|XP_011020124.1|  PREDICTED: basic 7S globulin-like                  106   1e-23   Populus euphratica
ref|XP_002308984.2|  hypothetical protein POPTR_0006s06820g             106   1e-23   Populus trichocarpa [western balsam poplar]
gb|EYU38145.1|  hypothetical protein MIMGU_mgv1a006647mg                106   1e-23   Erythranthe guttata [common monkey flower]
ref|XP_002311834.1|  hypothetical protein POPTR_0008s20730g             106   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006419833.1|  hypothetical protein CICLE_v10006689mg             105   2e-23   Citrus clementina [clementine]
ref|XP_006419831.1|  hypothetical protein CICLE_v10006962mg             105   2e-23   Citrus clementina [clementine]
emb|CDO98879.1|  unnamed protein product                                105   3e-23   Coffea canephora [robusta coffee]
ref|XP_007034630.1|  Eukaryotic aspartyl protease family protein ...    104   3e-23   
ref|XP_002277699.1|  PREDICTED: basic 7S globulin-like                  105   3e-23   Vitis vinifera
ref|XP_008810759.1|  PREDICTED: basic 7S globulin-like                  105   4e-23   
ref|XP_006489295.1|  PREDICTED: basic 7S globulin-like                  105   4e-23   Citrus sinensis [apfelsine]
ref|NP_563679.1|  aspartyl protease-like protein                        104   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006419809.1|  hypothetical protein CICLE_v10004993mg             104   4e-23   Citrus clementina [clementine]
ref|XP_006419811.1|  hypothetical protein CICLE_v10004995mg             104   4e-23   
ref|XP_011099700.1|  PREDICTED: basic 7S globulin-like                  104   5e-23   
ref|XP_008438716.1|  PREDICTED: basic 7S globulin-like isoform X1       104   5e-23   
ref|XP_002517165.1|  basic 7S globulin 2 precursor small subunit,...    104   6e-23   Ricinus communis
ref|XP_006345119.1|  PREDICTED: basic 7S globulin-like                  104   6e-23   Solanum tuberosum [potatoes]
gb|KJB23117.1|  hypothetical protein B456_004G081800                    104   6e-23   Gossypium raimondii
ref|XP_007034629.1|  Eukaryotic aspartyl protease family protein ...    104   6e-23   
ref|XP_009111159.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    104   8e-23   Brassica rapa
emb|CDX86682.1|  BnaC08g00210D                                          103   8e-23   
gb|KFK42681.1|  hypothetical protein AALP_AA1G026100                    103   9e-23   Arabis alpina [alpine rockcress]
ref|XP_006387875.1|  hypothetical protein POPTR_0509s00200g             103   1e-22   
emb|CDY15456.1|  BnaA08g27400D                                          103   1e-22   Brassica napus [oilseed rape]
gb|KDP40112.1|  hypothetical protein JCGZ_02110                         103   1e-22   Jatropha curcas
ref|XP_007034625.1|  Eukaryotic aspartyl protease family protein,...  98.6    1e-22   
ref|XP_007154122.1|  hypothetical protein PHAVU_003G092200g             103   2e-22   Phaseolus vulgaris [French bean]
ref|XP_010938774.1|  PREDICTED: basic 7S globulin-like                  102   2e-22   Elaeis guineensis
ref|XP_002889446.1|  EDGP precursor                                     102   2e-22   
ref|XP_010039912.1|  PREDICTED: basic 7S globulin-like                  103   2e-22   Eucalyptus grandis [rose gum]
ref|XP_006380060.1|  hypothetical protein POPTR_0008s20740g             102   2e-22   
ref|XP_007034624.1|  Eukaryotic aspartyl protease family protein,...    102   3e-22   
ref|XP_009773897.1|  PREDICTED: basic 7S globulin-like                  102   3e-22   Nicotiana sylvestris
ref|NP_171821.1|  aspartyl protease-like protein                        102   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004134152.1|  PREDICTED: basic 7S globulin-like                  102   3e-22   Cucumis sativus [cucumbers]
ref|XP_010522713.1|  PREDICTED: basic 7S globulin-like                  102   3e-22   Tarenaya hassleriana [spider flower]
gb|AAX81588.1|  nectarin IV                                             102   4e-22   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009595035.1|  PREDICTED: basic 7S globulin-like                  102   4e-22   Nicotiana tomentosiformis
ref|XP_010474940.1|  PREDICTED: basic 7S globulin-like                  102   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006296506.1|  hypothetical protein CARUB_v10025694mg             102   4e-22   Capsella rubella
ref|XP_008222987.1|  PREDICTED: basic 7S globulin-like                  102   5e-22   Prunus mume [ume]
ref|XP_006304586.1|  hypothetical protein CARUB_v10011636mg             102   5e-22   Capsella rubella
ref|XP_010457326.1|  PREDICTED: basic 7S globulin-like                  101   6e-22   
ref|XP_010278299.1|  PREDICTED: basic 7S globulin-like                  101   6e-22   Nelumbo nucifera [Indian lotus]
dbj|BAK57511.1|  extracellular dermal glycoprotein                      101   7e-22   Nicotiana benthamiana
gb|KEH36784.1|  xyloglucanase-specific endoglucanase inhibitor pr...    101   8e-22   Medicago truncatula
ref|XP_006419829.1|  hypothetical protein CICLE_v100071811mg            100   8e-22   
ref|XP_010045855.1|  PREDICTED: basic 7S globulin-like                  100   9e-22   
ref|XP_010481702.1|  PREDICTED: basic 7S globulin-like                  101   9e-22   Camelina sativa [gold-of-pleasure]
emb|CDY37437.1|  BnaC08g45750D                                        96.3    9e-22   Brassica napus [oilseed rape]
ref|XP_007144622.1|  hypothetical protein PHAVU_007G170900g             101   9e-22   Phaseolus vulgaris [French bean]
ref|XP_008390829.1|  PREDICTED: basic 7S globulin-like                  101   1e-21   Malus domestica [apple tree]
ref|XP_006489309.1|  PREDICTED: basic 7S globulin-like                  100   1e-21   Citrus sinensis [apfelsine]
ref|XP_010278291.1|  PREDICTED: basic 7S globulin-like                  101   1e-21   Nelumbo nucifera [Indian lotus]
ref|XP_004134154.1|  PREDICTED: basic 7S globulin-like                  100   1e-21   Cucumis sativus [cucumbers]
gb|KCW84284.1|  hypothetical protein EUGRSUZ_B01136                     100   1e-21   Eucalyptus grandis [rose gum]
ref|XP_002877156.1|  hypothetical protein ARALYDRAFT_484681             100   1e-21   
gb|KDO74795.1|  hypothetical protein CISIN_1g037976mg                   100   1e-21   Citrus sinensis [apfelsine]
ref|XP_007034628.1|  Eukaryotic aspartyl protease family protein,...  99.8    2e-21   
ref|XP_010483190.1|  PREDICTED: basic 7S globulin-like                  100   2e-21   Camelina sativa [gold-of-pleasure]
gb|KCW49915.1|  hypothetical protein EUGRSUZ_K03382                     100   2e-21   Eucalyptus grandis [rose gum]
ref|XP_010475063.1|  PREDICTED: basic 7S globulin-like                  100   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010457449.1|  PREDICTED: basic 7S globulin-like                  100   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_009118711.1|  PREDICTED: basic 7S globulin-like                  100   2e-21   Brassica rapa
emb|CDY32500.1|  BnaA09g50960D                                          100   2e-21   Brassica napus [oilseed rape]
ref|XP_010522709.1|  PREDICTED: basic 7S globulin-like                99.8    2e-21   
gb|AAM61574.1|  EDGP precursor                                          100   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KCW49914.1|  hypothetical protein EUGRSUZ_K03381                   99.8    2e-21   Eucalyptus grandis [rose gum]
ref|XP_010038106.1|  PREDICTED: basic 7S globulin 2-like              99.8    3e-21   Eucalyptus grandis [rose gum]
ref|XP_010678844.1|  PREDICTED: basic 7S globulin 2-like              99.8    3e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010038107.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  99.8    3e-21   
ref|XP_010086743.1|  Basic 7S globulin                                99.8    3e-21   
gb|KDO74796.1|  hypothetical protein CISIN_1g038219mg                 99.8    3e-21   Citrus sinensis [apfelsine]
ref|XP_007034627.1|  Eukaryotic aspartyl protease family protein,...  99.8    3e-21   
ref|XP_006419827.1|  hypothetical protein CICLE_v10005000mg           99.8    4e-21   Citrus clementina [clementine]
ref|XP_009342159.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  99.8    4e-21   Pyrus x bretschneideri [bai li]
ref|XP_009356759.1|  PREDICTED: basic 7S globulin                     99.4    4e-21   Pyrus x bretschneideri [bai li]
ref|XP_008438715.1|  PREDICTED: basic 7S globulin-like                99.0    5e-21   Cucumis melo [Oriental melon]
ref|XP_008438718.1|  PREDICTED: basic 7S globulin-like                99.0    6e-21   Cucumis melo [Oriental melon]
ref|XP_004134153.1|  PREDICTED: basic 7S globulin-like                99.0    6e-21   Cucumis sativus [cucumbers]
ref|XP_004170542.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  99.0    6e-21   
ref|XP_009611839.1|  PREDICTED: basic 7S globulin-like                99.0    6e-21   Nicotiana tomentosiformis
gb|AIL30493.1|  xyloglucan-specific fungal endoglucanase inhibito...  99.0    7e-21   Nicotiana tabacum [American tobacco]
ref|XP_009596039.1|  PREDICTED: basic 7S globulin-like                99.0    7e-21   Nicotiana tomentosiformis
gb|KJB25917.1|  hypothetical protein B456_004G215700                  98.6    7e-21   Gossypium raimondii
ref|XP_010556788.1|  PREDICTED: basic 7S globulin-like                99.0    8e-21   Tarenaya hassleriana [spider flower]
ref|XP_002517164.1|  basic 7S globulin 2 precursor small subunit,...  98.2    1e-20   Ricinus communis
ref|XP_006472113.1|  PREDICTED: basic 7S globulin-like                97.1    1e-20   
gb|ACM68432.1|  xyloglucanase-specific endoglucanase inhibitor pr...  98.2    1e-20   Petunia x hybrida [garden petunia]
dbj|BAA03413.1|  EDGP precursor                                       98.2    1e-20   Daucus carota [carrots]
pdb|3VLB|A  Chain A, Crystal Structure Of Xeg-edgp                    97.8    1e-20   Aspergillus aculeatus
ref|XP_007050654.1|  Eukaryotic aspartyl protease family protein,...  98.2    1e-20   
pdb|3VLA|A  Chain A, Crystal Structure Of Edgp                        97.8    1e-20   Daucus carota [carrots]
gb|KCW84282.1|  hypothetical protein EUGRSUZ_B01133                   98.2    1e-20   Eucalyptus grandis [rose gum]
ref|XP_007030900.1|  Eukaryotic aspartyl protease family protein,...  97.8    1e-20   Theobroma cacao [chocolate]
ref|XP_010045852.1|  PREDICTED: basic 7S globulin-like                98.2    1e-20   Eucalyptus grandis [rose gum]
ref|XP_006433276.1|  hypothetical protein CICLE_v10003944mg           97.4    2e-20   
gb|ABR17052.1|  unknown                                               97.4    2e-20   Picea sitchensis
ref|XP_006495483.1|  PREDICTED: basic 7S globulin-like                94.4    2e-20   
ref|XP_004495218.1|  PREDICTED: basic 7S globulin 2-like              97.4    2e-20   Cicer arietinum [garbanzo]
gb|AAP84703.1|  putative xyloglucanase inhibitor                      97.4    2e-20   Solanum tuberosum [potatoes]
ref|NP_001241217.1|  uncharacterized protein LOC100818868 precursor   97.8    2e-20   Glycine max [soybeans]
ref|XP_009769391.1|  PREDICTED: basic 7S globulin-like                97.4    2e-20   Nicotiana sylvestris
gb|EMT02113.1|  Basic 7S globulin                                     92.0    4e-20   
ref|XP_008355568.1|  PREDICTED: basic 7S globulin-like                96.7    4e-20   Malus domestica [apple tree]
ref|XP_009757289.1|  PREDICTED: basic 7S globulin-like                96.7    4e-20   Nicotiana sylvestris
gb|KCW58886.1|  hypothetical protein EUGRSUZ_H01512                   95.9    4e-20   Eucalyptus grandis [rose gum]
ref|XP_004508379.1|  PREDICTED: basic 7S globulin-like                96.7    5e-20   Cicer arietinum [garbanzo]
ref|NP_001234746.1|  xyloglucan-specific fungal endoglucanase inh...  96.3    6e-20   
ref|XP_010026234.1|  PREDICTED: basic 7S globulin-like                95.5    7e-20   Eucalyptus grandis [rose gum]
gb|EMS47745.1|  Basic 7S globulin                                     95.1    7e-20   Triticum urartu
ref|XP_002517167.1|  basic 7S globulin 2 precursor small subunit,...  95.9    7e-20   Ricinus communis
gb|KCW45638.1|  hypothetical protein EUGRSUZ_L005902                  93.6    8e-20   Eucalyptus grandis [rose gum]
ref|XP_006489307.1|  PREDICTED: basic 7S globulin-like                95.5    8e-20   Citrus sinensis [apfelsine]
ref|XP_006419825.1|  hypothetical protein CICLE_v10007108mg           95.1    1e-19   
ref|XP_006419823.1|  hypothetical protein CICLE_v10005035mg           95.1    1e-19   Citrus clementina [clementine]
gb|KJB26455.1|  hypothetical protein B456_004G242500                  94.7    1e-19   Gossypium raimondii
gb|EYU20619.1|  hypothetical protein MIMGU_mgv1a026442mg              95.1    1e-19   Erythranthe guttata [common monkey flower]
gb|KJB26454.1|  hypothetical protein B456_004G242400                  95.1    1e-19   Gossypium raimondii
gb|ACM68431.1|  xyloglucan-specific endoglucanase inhibitor protein   95.1    1e-19   Capsicum annuum
gb|EEE63672.1|  hypothetical protein OsJ_18490                        94.7    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EYU20615.1|  hypothetical protein MIMGU_mgv1a006692mg              94.7    2e-19   Erythranthe guttata [common monkey flower]
gb|AAT85211.1|  hypothetical protein                                  94.7    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010255898.1|  PREDICTED: basic 7S globulin-like                94.7    2e-19   
ref|XP_004486304.1|  PREDICTED: basic 7S globulin 2-like              94.4    2e-19   Cicer arietinum [garbanzo]
ref|XP_010026985.1|  PREDICTED: basic 7S globulin-like                94.4    2e-19   
gb|KDO35982.1|  hypothetical protein CISIN_1g037784mg                 92.8    3e-19   Citrus sinensis [apfelsine]
gb|KCW60840.1|  hypothetical protein EUGRSUZ_H03578                   94.0    3e-19   Eucalyptus grandis [rose gum]
gb|KCW84281.1|  hypothetical protein EUGRSUZ_B01132                   93.2    3e-19   Eucalyptus grandis [rose gum]
gb|KCW60847.1|  hypothetical protein EUGRSUZ_H03585                   94.0    3e-19   Eucalyptus grandis [rose gum]
gb|KDP40110.1|  hypothetical protein JCGZ_02108                       94.0    4e-19   Jatropha curcas
ref|XP_010024401.1|  PREDICTED: basic 7S globulin 2-like              94.0    4e-19   Eucalyptus grandis [rose gum]
ref|XP_009773278.1|  PREDICTED: basic 7S globulin-like                94.0    4e-19   Nicotiana sylvestris
gb|KJB70565.1|  hypothetical protein B456_011G080800                  93.6    5e-19   Gossypium raimondii
gb|AAT85209.1|  unknown protein                                       92.0    5e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001234249.1|  xyloglucan-specific fungal endoglucanase inh...  93.6    5e-19   
ref|XP_006366973.1|  PREDICTED: basic 7S globulin-like                92.4    6e-19   
ref|XP_009625778.1|  PREDICTED: basic 7S globulin-like                93.2    6e-19   Nicotiana tomentosiformis
ref|XP_004231264.1|  PREDICTED: basic 7S globulin-like                92.8    8e-19   Solanum lycopersicum
emb|CAN68737.1|  hypothetical protein VITISV_030194                   93.2    8e-19   Vitis vinifera
ref|XP_010659830.1|  PREDICTED: basic 7S globulin-like                93.2    8e-19   
emb|CDY15455.1|  BnaA08g27390D                                        92.8    1e-18   Brassica napus [oilseed rape]
ref|XP_002272199.2|  PREDICTED: basic 7S globulin 2-like              93.2    1e-18   Vitis vinifera
ref|XP_010035585.1|  PREDICTED: basic 7S globulin                     92.8    1e-18   Eucalyptus grandis [rose gum]
ref|XP_011079830.1|  PREDICTED: basic 7S globulin-like                92.0    1e-18   Sesamum indicum [beniseed]
dbj|BAJ94733.1|  predicted protein                                    92.4    1e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009787261.1|  PREDICTED: basic 7S globulin-like                92.4    1e-18   Nicotiana sylvestris
ref|XP_004495219.1|  PREDICTED: basic 7S globulin-like                92.4    1e-18   Cicer arietinum [garbanzo]
ref|XP_004229432.1|  PREDICTED: basic 7S globulin-like                92.4    1e-18   Solanum lycopersicum
gb|ADG23123.1|  xyloglucan specific endoglucanase inhibitor           92.4    1e-18   Solanum melongena [aubergine]
gb|EEE63670.1|  hypothetical protein OsJ_18488                        92.0    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009111160.1|  PREDICTED: basic 7S globulin-like                92.4    1e-18   Brassica rapa
gb|KDP40111.1|  hypothetical protein JCGZ_02109                       91.3    1e-18   Jatropha curcas
ref|NP_001055496.1|  Os05g0402900                                     92.4    2e-18   
ref|XP_010693887.1|  PREDICTED: basic 7S globulin-like                91.3    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006489308.1|  PREDICTED: basic 7S globulin-like                91.7    2e-18   Citrus sinensis [apfelsine]
gb|KDP25943.1|  hypothetical protein JCGZ_22848                       91.7    2e-18   Jatropha curcas
ref|XP_004247154.1|  PREDICTED: basic 7S globulin-like                91.7    2e-18   Solanum lycopersicum
gb|EAY97992.1|  hypothetical protein OsI_19909                        91.7    3e-18   Oryza sativa Indica Group [Indian rice]
gb|KJB45207.1|  hypothetical protein B456_007G295400                  91.3    3e-18   Gossypium raimondii
gb|KCW60850.1|  hypothetical protein EUGRSUZ_H03588                   90.5    6e-18   Eucalyptus grandis [rose gum]
ref|XP_008246503.1|  PREDICTED: basic 7S globulin-like                90.5    6e-18   Prunus mume [ume]
ref|XP_010524801.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  90.5    6e-18   Tarenaya hassleriana [spider flower]
ref|XP_009364261.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  90.5    6e-18   Pyrus x bretschneideri [bai li]
ref|XP_006349243.1|  PREDICTED: basic 7S globulin-like                90.5    7e-18   
ref|XP_011082639.1|  PREDICTED: basic 7S globulin 2-like              90.5    8e-18   
ref|XP_006361904.1|  PREDICTED: basic 7S globulin-like                90.1    9e-18   Solanum tuberosum [potatoes]
emb|CDP19874.1|  unnamed protein product                              90.1    9e-18   Coffea canephora [robusta coffee]
ref|XP_007162407.1|  hypothetical protein PHAVU_001G149500g           90.5    9e-18   Phaseolus vulgaris [French bean]
ref|NP_001174419.1|  Os05g0403000                                     90.1    9e-18   
gb|KDO74789.1|  hypothetical protein CISIN_1g014679mg                 89.7    9e-18   Citrus sinensis [apfelsine]
gb|KDO74797.1|  hypothetical protein CISIN_1g044303mg                 90.1    1e-17   Citrus sinensis [apfelsine]
gb|AFK34779.1|  unknown                                               90.1    1e-17   Medicago truncatula
ref|XP_003637703.1|  Basic 7S globulin                                90.1    1e-17   
gb|EYU20620.1|  hypothetical protein MIMGU_mgv1a006733mg              89.7    1e-17   Erythranthe guttata [common monkey flower]
ref|XP_006654378.1|  PREDICTED: basic 7S globulin-like                89.7    1e-17   Oryza brachyantha
gb|EPS72958.1|  hypothetical protein M569_01796                       89.7    1e-17   Genlisea aurea
gb|KCW58887.1|  hypothetical protein EUGRSUZ_H01513                   89.4    1e-17   Eucalyptus grandis [rose gum]
ref|XP_004229434.1|  PREDICTED: basic 7S globulin-like                89.7    2e-17   Solanum lycopersicum
gb|KEH36782.1|  xyloglucanase-specific endoglucanase inhibitor pr...  89.4    2e-17   Medicago truncatula
gb|ACJ85243.1|  unknown                                               87.4    2e-17   Medicago truncatula
ref|XP_010454178.1|  PREDICTED: basic 7S globulin 2-like              88.6    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010026235.1|  PREDICTED: basic 7S globulin-like                89.4    2e-17   Eucalyptus grandis [rose gum]
ref|XP_007205231.1|  hypothetical protein PRUPE_ppa006032mg           89.0    2e-17   Prunus persica
ref|XP_009591595.1|  PREDICTED: basic 7S globulin-like                89.0    2e-17   
gb|KDP21481.1|  hypothetical protein JCGZ_21952                       89.0    2e-17   Jatropha curcas
ref|XP_007222421.1|  hypothetical protein PRUPE_ppa006071mg           88.6    3e-17   
ref|NP_001274964.1|  xyloglucan-specific endoglucanase inhibitor ...  88.6    4e-17   Solanum tuberosum [potatoes]
emb|CDY13979.1|  BnaC09g38470D                                        87.4    4e-17   Brassica napus [oilseed rape]
ref|XP_008649625.1|  PREDICTED: basic 7S globulin-like                88.2    5e-17   Zea mays [maize]
gb|ADD71505.1|  xyloglucanase inhibitor 3                             88.2    5e-17   Humulus lupulus [common hop]
gb|KHN37574.1|  Basic 7S globulin 2                                   87.0    5e-17   Glycine soja [wild soybean]
ref|XP_009597883.1|  PREDICTED: basic 7S globulin-like                87.8    6e-17   Nicotiana tomentosiformis
ref|XP_004962140.1|  PREDICTED: basic 7S globulin-like                87.8    7e-17   Setaria italica
ref|XP_008222995.1|  PREDICTED: basic 7S globulin-like                87.8    8e-17   Prunus mume [ume]
ref|XP_010677554.1|  PREDICTED: basic 7S globulin-like                87.4    9e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|ADD71504.1|  xyloglucanase inhibitor 2                             87.4    9e-17   Humulus lupulus [common hop]
gb|KCW85154.1|  hypothetical protein EUGRSUZ_B01995                   87.4    1e-16   Eucalyptus grandis [rose gum]
gb|ADK87896.1|  AtV9-like protein                                     83.6    1e-16   Arabidopsis halleri
gb|ADK87883.1|  AtV9-like protein                                     83.6    1e-16   Arabidopsis halleri
ref|XP_010046260.1|  PREDICTED: basic 7S globulin-like                86.7    1e-16   
ref|XP_006419832.1|  hypothetical protein CICLE_v10005038mg           86.7    1e-16   Citrus clementina [clementine]
gb|ADK87882.1|  AtV9-like protein                                     83.6    1e-16   Arabidopsis halleri
ref|XP_006489313.1|  PREDICTED: basic 7S globulin-like                86.7    1e-16   Citrus sinensis [apfelsine]
gb|AES60912.2|  xyloglucanase-specific endoglucanase inhibitor pr...  87.0    1e-16   Medicago truncatula
gb|KFK26154.1|  hypothetical protein AALP_AA8G210500                  86.3    1e-16   
gb|ADK87879.1|  AtV9-like protein                                     83.2    2e-16   
ref|XP_010420702.1|  PREDICTED: basic 7S globulin 2-like              86.3    2e-16   
gb|ADK87894.1|  AtV9-like protein                                     83.2    2e-16   
gb|ADK87876.1|  AtV9-like protein                                     83.2    2e-16   
ref|XP_002517166.1|  ATP binding protein, putative                    85.1    2e-16   
ref|XP_006850763.1|  hypothetical protein AMTR_s00025p00079140        86.7    2e-16   
gb|EYU20616.1|  hypothetical protein MIMGU_mgv1a026206mg              86.7    2e-16   
ref|XP_006419822.1|  hypothetical protein CICLE_v10007187mg           86.3    2e-16   
ref|XP_003590661.1|  Basic 7S globulin                                87.0    2e-16   
ref|XP_007224945.1|  hypothetical protein PRUPE_ppa021451mg           86.7    2e-16   
gb|KDO74800.1|  hypothetical protein CISIN_1g036447mg                 85.1    2e-16   
ref|XP_002513220.1|  conserved hypothetical protein                   83.2    3e-16   
emb|CDX70865.1|  BnaC03g09490D                                        85.5    3e-16   
gb|KCW58889.1|  hypothetical protein EUGRSUZ_H015141                  83.6    3e-16   
ref|XP_006349245.1|  PREDICTED: basic 7S globulin-like                85.9    3e-16   
gb|EYU20618.1|  hypothetical protein MIMGU_mgv1a018279mg              85.9    3e-16   
ref|XP_004229563.2|  PREDICTED: basic 7S globulin-like                84.3    4e-16   
ref|XP_006371344.1|  hypothetical protein POPTR_0019s09280g           85.5    4e-16   
ref|XP_010999511.1|  PREDICTED: basic 7S globulin-like                85.5    4e-16   
ref|XP_006400469.1|  hypothetical protein EUTSA_v10013774mg           84.7    4e-16   
ref|XP_010690125.1|  PREDICTED: basic 7S globulin-like                85.5    4e-16   
ref|XP_006489578.1|  PREDICTED: basic 7S globulin-like                85.1    4e-16   
ref|XP_006419826.1|  hypothetical protein CICLE_v10006501mg           85.1    5e-16   
ref|XP_002517163.1|  basic 7S globulin 2 precursor small subunit,...  85.5    5e-16   
ref|XP_009120915.1|  PREDICTED: basic 7S globulin 2                   84.7    5e-16   
ref|XP_011462765.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  85.1    5e-16   
ref|XP_011005003.1|  PREDICTED: basic 7S globulin-like                83.6    5e-16   
gb|KDP40109.1|  hypothetical protein JCGZ_02107                       85.1    5e-16   
ref|XP_002871863.1|  pepsin A                                         84.3    5e-16   
ref|XP_003568479.1|  PREDICTED: basic 7S globulin-like                85.1    6e-16   
gb|EPS73324.1|  hypothetical protein M569_01438                       84.7    7e-16   
ref|XP_006289450.1|  hypothetical protein CARUB_v10002965mg           84.3    7e-16   
gb|ADK87880.1|  AtV9-like protein                                     81.3    8e-16   
ref|XP_003520561.1|  PREDICTED: basic 7S globulin-like                84.7    8e-16   
gb|KDP23539.1|  hypothetical protein JCGZ_23372                       82.0    8e-16   
ref|XP_006371346.1|  hypothetical protein POPTR_0019s09300g           84.7    8e-16   
ref|XP_006387876.1|  hypothetical protein POPTR_0509s00210g           79.3    1e-15   
gb|EEE63673.1|  hypothetical protein OsJ_18491                        84.3    1e-15   
ref|NP_001055497.1|  Os05g0403300                                     84.3    1e-15   
ref|XP_011091047.1|  PREDICTED: basic 7S globulin 2-like              83.6    1e-15   
ref|XP_003591797.1|  Xyloglucan-specific endoglucanase inhibitor ...  84.0    1e-15   
ref|XP_009786807.1|  PREDICTED: basic 7S globulin-like                84.0    1e-15   
ref|XP_009126299.1|  PREDICTED: basic 7S globulin 2-like              83.6    2e-15   
ref|XP_006349246.1|  PREDICTED: basic 7S globulin-like                84.0    2e-15   
emb|CDX88901.1|  BnaA03g07480D                                        83.2    2e-15   
ref|XP_006388012.1|  hypothetical protein POPTR_0397s00200g           84.0    2e-15   
emb|CDX92553.1|  BnaA10g15920D                                        82.8    2e-15   
ref|XP_009133965.1|  PREDICTED: basic 7S globulin-like                83.2    3e-15   
ref|XP_010546839.1|  PREDICTED: basic 7S globulin                     82.8    3e-15   
ref|XP_004229433.1|  PREDICTED: basic 7S globulin-like                83.2    3e-15   
ref|XP_004495384.1|  PREDICTED: basic 7S globulin-like                83.2    3e-15   
ref|XP_011091049.1|  PREDICTED: basic 7S globulin 2-like              82.8    3e-15   
ref|XP_006371347.1|  hypothetical protein POPTR_0019s09310g           83.2    3e-15   
ref|XP_010026236.1|  PREDICTED: basic 7S globulin-like                82.8    3e-15   
ref|XP_010495297.1|  PREDICTED: basic 7S globulin 2-like              79.3    3e-15   
gb|KEH36777.1|  extracellular dermal glycoprotein                     82.8    3e-15   
emb|CDX83218.1|  BnaA03g22880D                                        82.4    4e-15   
ref|XP_011091048.1|  PREDICTED: basic 7S globulin-like                82.4    4e-15   
ref|XP_006371348.1|  hypothetical protein POPTR_0019s09320g           82.8    4e-15   
ref|XP_010492960.1|  PREDICTED: basic 7S globulin 2-like              82.4    4e-15   
ref|XP_010999512.1|  PREDICTED: basic 7S globulin-like                82.8    4e-15   
ref|XP_008363982.1|  PREDICTED: basic 7S globulin-like                82.8    4e-15   
gb|AER26945.1|  xyloglucan-specific endoglucanase inhibitor 9         82.8    4e-15   
ref|XP_006388043.1|  hypothetical protein POPTR_0382s00210g           82.8    4e-15   
ref|XP_006371343.1|  hypothetical protein POPTR_0019s09270g           82.8    4e-15   
gb|AHG54973.1|  xyloglucan-specific endoglucanase inhibitor 10        82.4    5e-15   
ref|NP_197413.1|  aspartyl protease family protein                    82.0    5e-15   
gb|EYU46598.1|  hypothetical protein MIMGU_mgv1a019870mg              82.0    5e-15   
ref|XP_010547160.1|  PREDICTED: basic 7S globulin 2-like              82.0    5e-15   
emb|CDP03610.1|  unnamed protein product                              82.4    6e-15   
ref|XP_010325564.1|  PREDICTED: basic 7S globulin-like                82.0    6e-15   
gb|EYU41536.1|  hypothetical protein MIMGU_mgv1a024772mg              82.0    7e-15   
ref|XP_010026986.1|  PREDICTED: basic 7S globulin-like                79.7    7e-15   
emb|CDY59021.1|  BnaCnng34100D                                        80.9    1e-14   
ref|XP_007143872.1|  hypothetical protein PHAVU_007G109000g           81.3    1e-14   
ref|XP_010454177.1|  PREDICTED: basic 7S globulin 2-like              81.3    1e-14   
ref|XP_011091050.1|  PREDICTED: basic 7S globulin 2-like              80.9    1e-14   
gb|ADD71503.1|  xyloglucanase inhibitor 1                             81.3    1e-14   
ref|XP_006349244.1|  PREDICTED: basic 7S globulin-like                81.3    1e-14   
gb|KHN15634.1|  Basic 7S globulin                                     77.0    2e-14   
ref|XP_006349239.1|  PREDICTED: basic 7S globulin-like                80.9    2e-14   
ref|XP_002873929.1|  hypothetical protein ARALYDRAFT_909934           80.5    2e-14   
ref|XP_006375955.1|  hypothetical protein POPTR_0013s067401g          77.0    3e-14   
ref|XP_006352883.1|  PREDICTED: basic 7S globulin-like isoform X1     79.3    3e-14   
ref|XP_006850764.1|  hypothetical protein AMTR_s00025p00079520        79.7    4e-14   
ref|XP_006369525.1|  hypothetical protein POPTR_0001s24740g           79.7    4e-14   
ref|XP_004305011.1|  PREDICTED: basic 7S globulin-like                79.7    4e-14   
ref|XP_010492957.1|  PREDICTED: basic 7S globulin 2-like              79.3    5e-14   
ref|XP_011011027.1|  PREDICTED: basic 7S globulin-like                79.7    6e-14   
ref|XP_006382966.1|  hypothetical protein POPTR_0005s09840g           79.3    6e-14   
dbj|BAE99306.1|  conglutin gamma - like protein                       78.6    8e-14   
ref|XP_010420698.1|  PREDICTED: uncharacterized protein LOC104706...  78.6    8e-14   
gb|KEH36774.1|  eukaryotic aspartyl protease family protein           78.6    1e-13   
ref|XP_010322595.1|  PREDICTED: basic 7S globulin-like isoform X1     78.6    1e-13   
gb|EYU41535.1|  hypothetical protein MIMGU_mgv1a007318mg              78.6    1e-13   
ref|XP_010424178.1|  PREDICTED: basic 7S globulin-like                76.6    1e-13   
ref|XP_011090790.1|  PREDICTED: basic 7S globulin-like                78.6    1e-13   
ref|XP_010322603.1|  PREDICTED: basic 7S globulin-like isoform X2     78.6    1e-13   
emb|CDY47198.1|  BnaAnng08680D                                        78.2    1e-13   
ref|XP_002439768.1|  hypothetical protein SORBIDRAFT_09g019770        78.2    1e-13   
emb|CBI26188.3|  unnamed protein product                              77.8    1e-13   
ref|XP_009760543.1|  PREDICTED: basic 7S globulin-like                77.8    2e-13   
ref|XP_009373976.1|  PREDICTED: basic 7S globulin-like                77.8    2e-13   
ref|XP_009349976.1|  PREDICTED: basic 7S globulin-like                77.8    2e-13   
gb|KEH36779.1|  extracellular dermal glycoprotein                     77.4    2e-13   
gb|KCW60844.1|  hypothetical protein EUGRSUZ_H03581                   77.4    2e-13   
ref|XP_010024400.1|  PREDICTED: basic 7S globulin 2-like              77.4    3e-13   
gb|AFK34800.1|  unknown                                               73.9    3e-13   
ref|NP_001274881.1|  xyloglucan-specific endoglucanase inhibitor 8    77.4    3e-13   
ref|XP_004246189.2|  PREDICTED: basic 7S globulin-like                77.0    3e-13   
ref|XP_006352950.1|  PREDICTED: basic 7S globulin-like                77.0    4e-13   
gb|AFF60302.1|  xyloglucanase-specific endoglucanase inhibitor        77.0    4e-13   
ref|XP_010256207.1|  PREDICTED: basic 7S globulin 2-like              77.0    4e-13   
gb|KDO38562.1|  hypothetical protein CISIN_1g040428mg                 75.5    4e-13   
ref|XP_010497267.1|  PREDICTED: uncharacterized protein LOC104774336  74.7    4e-13   
ref|XP_006349258.1|  PREDICTED: basic 7S globulin-like                76.6    4e-13   
gb|KEH36780.1|  extracellular dermal glycoprotein                     76.6    5e-13   
ref|XP_006654379.1|  PREDICTED: basic 7S globulin-like                76.6    5e-13   
ref|XP_006844967.1|  hypothetical protein AMTR_s00058p00179910        76.6    5e-13   
gb|AGT17598.1|  xyloglucan-specific endoglucanase inhibitor 11        76.6    5e-13   
ref|XP_008366845.1|  PREDICTED: basic 7S globulin-like                76.6    5e-13   
gb|KHN18889.1|  Basic 7S globulin                                     71.2    6e-13   
ref|XP_004246190.2|  PREDICTED: basic 7S globulin-like                76.3    6e-13   
dbj|BAF00627.1|  dermal glycoprotein - like                           75.9    7e-13   
ref|XP_010420700.1|  PREDICTED: basic 7S globulin 2-like              75.9    8e-13   
ref|NP_197412.1|  Eukaryotic aspartyl protease family protein         75.9    8e-13   
ref|XP_010026990.1|  PREDICTED: basic 7S globulin-like                74.3    1e-12   
ref|XP_009597882.1|  PREDICTED: basic 7S globulin-like                75.5    1e-12   
ref|XP_002517175.1|  pepsin A, putative                               75.1    2e-12   
ref|XP_002517171.1|  basic 7S globulin 2 precursor small subunit,...  75.1    2e-12   
ref|XP_010492952.1|  PREDICTED: aspartic proteinase nepenthesin-1...  74.7    2e-12   
ref|XP_006844968.1|  hypothetical protein AMTR_s00058p00180190        74.7    2e-12   
gb|AFK42891.1|  unknown                                               73.9    2e-12   
ref|XP_008222996.1|  PREDICTED: basic 7S globulin-like                70.9    3e-12   
gb|AFK42416.1|  unknown                                               74.3    3e-12   
ref|XP_010420701.1|  PREDICTED: basic 7S globulin 2-like              74.3    3e-12   
ref|XP_009615960.1|  PREDICTED: basic 7S globulin-like                74.3    3e-12   
gb|EYU41533.1|  hypothetical protein MIMGU_mgv1a011412mg              72.8    3e-12   
ref|XP_010456587.1|  PREDICTED: uncharacterized protein LOC104738046  73.9    3e-12   
emb|CBI26189.3|  unnamed protein product                              72.4    4e-12   
ref|XP_004229430.1|  PREDICTED: basic 7S globulin-like                73.6    5e-12   
ref|XP_006850766.1|  hypothetical protein AMTR_s00025p00080690        73.6    5e-12   
ref|XP_004229431.1|  PREDICTED: basic 7S globulin-like                73.6    5e-12   
gb|KDO59527.1|  hypothetical protein CISIN_1g0364392mg                68.9    6e-12   
ref|XP_010233253.1|  PREDICTED: basic 7S globulin 2-like              73.6    6e-12   
ref|XP_010492959.1|  PREDICTED: basic 7S globulin 2-like              73.2    6e-12   
ref|XP_002520766.1|  conserved hypothetical protein                   71.6    6e-12   
gb|KDO74799.1|  hypothetical protein CISIN_1g045937mg                 68.6    7e-12   
gb|KEH36786.1|  extracellular dermal glycoprotein                     73.2    7e-12   
ref|XP_003556387.1|  PREDICTED: basic 7S globulin                     73.2    8e-12   
ref|XP_003536212.1|  PREDICTED: basic 7S globulin-like                73.2    8e-12   
gb|KHN30567.1|  Basic 7S globulin                                     73.2    8e-12   
gb|AEG74550.1|  xyloglucan specific endoglucanase inhibitor           72.8    9e-12   
ref|XP_010492950.1|  PREDICTED: basic 7S globulin-like                72.8    9e-12   
ref|XP_006432971.1|  hypothetical protein CICLE_v10003177mg           70.5    9e-12   
gb|AED02502.1|  xyloglucan-specific endoglucanase inhibitor           72.8    1e-11   
ref|XP_002529699.1|  basic 7S globulin 2 precursor small subunit,...  72.8    1e-11   
ref|XP_006349257.1|  PREDICTED: basic 7S globulin-like                72.8    1e-11   
ref|NP_197411.1|  Eukaryotic aspartyl protease family protein         72.4    1e-11   
ref|XP_006388014.1|  hypothetical protein POPTR_0397s00220g           72.8    1e-11   
ref|XP_009790669.1|  PREDICTED: basic 7S globulin-like                70.1    1e-11   
ref|XP_007034631.1|  Basic 7S globulin precursor, putative            72.8    1e-11   
gb|ABK28703.1|  unknown                                               72.4    1e-11   
ref|XP_009625013.1|  PREDICTED: basic 7S globulin-like                72.4    1e-11   
gb|KCW45650.1|  hypothetical protein EUGRSUZ_L006051                  70.1    1e-11   
ref|XP_010039919.1|  PREDICTED: basic 7S globulin-like                70.1    1e-11   
ref|XP_011091045.1|  PREDICTED: basic 7S globulin 2                   72.0    1e-11   
ref|XP_010045849.1|  PREDICTED: basic 7S globulin 2-like              72.0    2e-11   
ref|XP_010492954.1|  PREDICTED: basic 7S globulin-like                72.0    2e-11   
emb|CDX92557.1|  BnaA10g15960D                                        72.0    2e-11   
ref|XP_002873931.1|  hypothetical protein ARALYDRAFT_351013           72.0    2e-11   
ref|XP_009120918.1|  PREDICTED: basic 7S globulin-like                72.0    2e-11   
ref|XP_010039917.1|  PREDICTED: basic 7S globulin 2-like              71.6    2e-11   
gb|EYU22657.1|  hypothetical protein MIMGU_mgv1a022346mg              71.6    2e-11   
gb|KHN19878.1|  Basic 7S globulin                                     67.4    2e-11   
ref|XP_004229562.1|  PREDICTED: basic 7S globulin-like                71.6    3e-11   
ref|XP_009613161.1|  PREDICTED: basic 7S globulin-like                71.6    3e-11   
ref|XP_006289574.1|  hypothetical protein CARUB_v10003127mg           70.9    3e-11   
ref|XP_010492951.1|  PREDICTED: basic 7S globulin-like                70.9    4e-11   
gb|KEH36787.1|  extracellular dermal glycoprotein                     70.9    4e-11   
gb|KDP40115.1|  hypothetical protein JCGZ_02113                       70.9    5e-11   
ref|XP_010045848.1|  PREDICTED: basic 7S globulin 2-like              69.3    5e-11   
ref|XP_010694712.1|  PREDICTED: basic 7S globulin-like                70.1    5e-11   
emb|CDY47196.1|  BnaAnng08660D                                        70.5    5e-11   
ref|XP_006654380.1|  PREDICTED: basic 7S globulin-like                70.9    5e-11   
ref|XP_004170870.1|  PREDICTED: basic 7S globulin 2-like              70.9    5e-11   
ref|XP_006400466.1|  hypothetical protein EUTSA_v10013672mg           70.5    5e-11   
ref|XP_002517173.1|  pepsin A, putative                               70.5    6e-11   
ref|XP_004148901.1|  PREDICTED: basic 7S globulin 2-like              70.5    6e-11   
gb|KCW84275.1|  hypothetical protein EUGRSUZ_B01126                   68.9    6e-11   
ref|NP_199654.1|  aspartyl protease family protein                    70.1    6e-11   
ref|XP_002873930.1|  hypothetical protein ARALYDRAFT_488794           70.1    7e-11   
emb|CDY19949.1|  BnaA09g03020D                                        70.1    7e-11   
emb|CDY02589.1|  BnaC02g08460D                                        68.9    7e-11   
gb|EMS52873.1|  Basic 7S globulin                                     68.2    7e-11   
emb|CAC16394.1|  conglutin gamma                                      70.1    8e-11   
ref|XP_009111839.1|  PREDICTED: basic 7S globulin 2                   70.1    8e-11   
ref|XP_002517174.1|  conserved hypothetical protein                   70.1    9e-11   
emb|CDY00058.1|  BnaC09g02430D                                        69.7    1e-10   
ref|XP_004971203.1|  PREDICTED: basic 7S globulin 2-like              69.7    1e-10   
ref|XP_003626314.1|  Basic 7S globulin                                69.7    1e-10   
gb|KFK26148.1|  hypothetical protein AALP_AA8G210000                  69.7    1e-10   
ref|XP_004486143.1|  PREDICTED: basic 7S globulin-like                69.7    1e-10   
prf||0402194A  conglutin gamma smaller subunit                        66.6    1e-10
emb|CAC10209.1|  putative extracellular dermal glycoprotein           69.3    1e-10   
ref|XP_010667343.1|  PREDICTED: basic 7S globulin-like                69.3    1e-10   
ref|NP_001274908.1|  xyloglucan-specific endoglucanase inhibitor ...  69.3    1e-10   
gb|ADX66725.1|  xyloglucan-specific endoglucanase inhibitor prote...  69.3    1e-10   
ref|XP_009126297.1|  PREDICTED: basic 7S globulin-like                69.3    1e-10   
ref|XP_010492955.1|  PREDICTED: basic 7S globulin-like                68.9    2e-10   
gb|EMT33249.1|  hypothetical protein F775_43919                       66.2    2e-10   
ref|XP_006349240.1|  PREDICTED: basic 7S globulin-like                68.9    2e-10   
ref|XP_010045844.1|  PREDICTED: basic 7S globulin-like                68.9    2e-10   
gb|KCW84248.1|  hypothetical protein EUGRSUZ_B01106                   68.9    2e-10   
emb|CDY70079.1|  BnaC09g54300D                                        68.9    2e-10   
ref|XP_004971200.1|  PREDICTED: basic 7S globulin 2-like              68.6    2e-10   
gb|KDP40113.1|  hypothetical protein JCGZ_02111                       68.6    3e-10   
ref|XP_006400467.1|  hypothetical protein EUTSA_v10013760mg           68.2    3e-10   
gb|AEB33720.1|  conglutin gamma 2                                     68.6    3e-10   
emb|CDY02584.1|  BnaC02g08510D                                        65.1    3e-10   



>ref|XP_009611838.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=420

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 93/125 (74%), Gaps = 12/125 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A SM L++V+ +AP E+CFS        VG +VP  + VLQSEMVKWR+   NSMVKV D
Sbjct  293  AISMELNKVEAIAPFELCFSTKGIDVTKVGPNVPTTDLVLQSEMVKWRIYGRNSMVKVSD  352

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSM  262
             VMCLGFL+GG+ Q AS+VIGGYQLEDNLLEFNLGTSMLGFTS   MA TSCS F   S+
Sbjct  353  EVMCLGFLNGGVNQKASIVIGGYQLEDNLLEFNLGTSMLGFTSSLSMAETSCSDFMFHSV  412

Query  261  ERDSA  247
             +DSA
Sbjct  413  SKDSA  417



>ref|XP_006339396.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=416

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 87/108 (81%), Gaps = 7/108 (6%)
 Frame = -1

Query  579  SMGLSRVDPVAPXEVCFSGV--GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            SMGL++V+P+AP  +CFS    G +VP ++ VLQSEMVKWR+   NSMVKV D VMCLGF
Sbjct  298  SMGLTKVEPIAPFGLCFSTKVEGLNVPSIDLVLQSEMVKWRIYESNSMVKVSDEVMCLGF  357

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA--GTSCSHF  277
            LDGG+ Q AS+VIGG+QLEDNLLEFNLGTSMLGFTS +A   TSCS F
Sbjct  358  LDGGVNQKASIVIGGHQLEDNLLEFNLGTSMLGFTSSLAMVETSCSDF  405



>ref|XP_004229435.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=417

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 85/109 (78%), Gaps = 8/109 (7%)
 Frame = -1

Query  579  SMGLSRVDPVAPXEVCFSGV---GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLG  418
            SMGL++V+P+AP  +CFS     G +VP V+ VLQSEMVKWR+   NSMVKV D VMCLG
Sbjct  298  SMGLTKVEPIAPFGLCFSTKLEEGLNVPSVDLVLQSEMVKWRIYESNSMVKVSDEVMCLG  357

Query  417  FLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            FLDGG  Q AS+VIGG+QLEDNLLEFNLGTSMLGFTS   M  TSCS F
Sbjct  358  FLDGGANQKASIVIGGHQLEDNLLEFNLGTSMLGFTSSLSMVETSCSDF  406



>ref|XP_011090791.1| PREDICTED: basic 7S globulin [Sesamum indicum]
Length=417

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 82/123 (67%), Gaps = 12/123 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A SM L+ V PVAP E+CFS        +G +VP ++ +LQSEMVKWR+   NSMV V D
Sbjct  293  ATSMNLTLVTPVAPFEICFSSKGVENQRIGPNVPIIDLILQSEMVKWRIYGRNSMVPVSD  352

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSM  262
             VMCL FLDGGL    S+VIGGYQ+ED LLEFNLG SMLGF+S  LM    CS F    M
Sbjct  353  EVMCLAFLDGGLSPKDSIVIGGYQIEDYLLEFNLGNSMLGFSSSLLMGQKGCSDFEASVM  412

Query  261  ERD  253
             R+
Sbjct  413  SRE  415



>ref|XP_007034626.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05552.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=420

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 85/113 (75%), Gaps = 12/113 (11%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSGVGSD-------VPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A SM ++RV  VAP E+CFS  G +       VP+++ +LQSEMVKWR+   NSMVKV +
Sbjct  296  ADSMNMTRVAAVAPFELCFSSKGIENTILGPLVPEIDLILQSEMVKWRIQGRNSMVKVSN  355

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  283
             VMCLGFLDGGL Q +S+VIGG QLEDNLLEF++G+SMLGF+S  L+  T+CS
Sbjct  356  QVMCLGFLDGGLEQSSSIVIGGLQLEDNLLEFDVGSSMLGFSSSLLLKETTCS  408



>gb|KEH36785.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=417

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 87/125 (70%), Gaps = 12/125 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A SM +SRVD VAP E+CF       S +G +VP ++ VLQSEMVKWR+   NSMV+V D
Sbjct  293  ALSMNISRVDSVAPFEICFGSNGIGASKIGPNVPVIDLVLQSEMVKWRIHGRNSMVRVSD  352

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSM  262
             VMCLG LDGG  Q   +VIGGYQLED L++F+  +SM+GF+S  L+  TSCS+F   SM
Sbjct  353  DVMCLGILDGGDEQKNLIVIGGYQLEDVLVQFDFDSSMVGFSSSLLIRDTSCSNFRFGSM  412

Query  261  ERDSA  247
            +  S+
Sbjct  413  DVQSS  417



>gb|KJB61114.1| hypothetical protein B456_009G341600 [Gossypium raimondii]
Length=403

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 5/106 (5%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            A  M ++RV+ VAP  +CFS  G  VP+++ VLQSEMVKWR+   NSMVKV +  MCLGF
Sbjct  286  ATKMNMTRVESVAPFGLCFSSKGPLVPEIDLVLQSEMVKWRIQGRNSMVKVSEESMCLGF  345

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  283
            LDGGL Q + +V+GG Q+EDNLLEF++G+SMLGF+S  L+  T+CS
Sbjct  346  LDGGLEQSSPIVLGGLQMEDNLLEFDIGSSMLGFSSSLLLKETTCS  391



>gb|EYU41534.1| hypothetical protein MIMGU_mgv1a008121mg [Erythranthe guttata]
Length=384

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 7/101 (7%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF--SGVGS--DVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
             ++M ++RV  VAP EVCF   GVG+  DVP V+ VLQSEMV+WR+   NSMV VGDGV 
Sbjct  268  TSAMNMTRVSAVAPFEVCFGSKGVGNIPDVPIVDLVLQSEMVRWRIHGRNSMVDVGDGVF  327

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSL  304
            CLGFLDGGL    ++V+GGYQ+ED LLEFNLG SMLGF+SL
Sbjct  328  CLGFLDGGLSPRDAIVLGGYQMEDYLLEFNLGNSMLGFSSL  368



>ref|XP_002517162.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45325.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=411

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 81/120 (68%), Gaps = 12/120 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A SM L RV  VAP  +CFS        +G +VP ++ VLQSEMVKWR+   NSMV+V D
Sbjct  288  ANSMNLIRVASVAPFGLCFSSKGIERSILGPNVPAIDLVLQSEMVKWRLHGGNSMVEVND  347

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFT--SLMAGTSCSHFTRFSM  262
              MCLGFLDGGL    S+VIGG QLED LLEF+LGTSMLGF+   L   TSCS+F   SM
Sbjct  348  EAMCLGFLDGGLDPKNSIVIGGLQLEDTLLEFDLGTSMLGFSLPLLQRQTSCSNFLLESM  407



>ref|XP_002280508.1| PREDICTED: basic 7S globulin [Vitis vinifera]
Length=388

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 5/96 (5%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSGVGSD--VPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            AASM ++RV+ +AP  VCF    S+  VP ++ VLQSEMVKWR+   NSMV+V D VMCL
Sbjct  269  AASMNITRVESMAPFGVCFRSESSEPAVPTIDLVLQSEMVKWRILGRNSMVRVSDKVMCL  328

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGF  313
            GFLDGG+  G ++VIGG+QLEDNLLEF+L TSMLGF
Sbjct  329  GFLDGGVDPGTAIVIGGHQLEDNLLEFDLSTSMLGF  364



>ref|XP_009342158.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin [Pyrus x bretschneideri]
Length=408

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 74/111 (67%), Gaps = 14/111 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A SM ++RV PVAP   CFS        VG  VP ++ VLQSEMVKWR+   NSMV+V D
Sbjct  290  ATSMNITRVSPVAPFGQCFSSRENDGTLVGPKVPAIDLVLQSEMVKWRIHGRNSMVQVSD  349

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCS  283
             VMCLGFLDGGL    S+VIGGYQLED LL F++G S LGFT      SCS
Sbjct  350  EVMCLGFLDGGLNLKTSMVIGGYQLEDTLLHFDVGASRLGFTQ----QSCS  396



>ref|XP_004486144.1| PREDICTED: basic 7S globulin-like [Cicer arietinum]
Length=411

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 13/118 (11%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A SM ++RV  VAP +VCF       S VG +VP ++FVLQSEMVKW +   NSMVK+ D
Sbjct  289  AFSMNMTRVTSVAPFDVCFDSNGIDESKVGPNVPVIDFVLQSEMVKWSIYGRNSMVKLSD  348

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRF  268
             VMCLG LDGG+ Q   +VIGGYQ ED L++F+  +SM+GF+S  LM  +SCS+F RF
Sbjct  349  DVMCLGLLDGGVEQKNPIVIGGYQFEDVLVQFDFDSSMVGFSSSLLMRDSSCSNF-RF  405



>ref|XP_006489306.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=394

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 85/116 (73%), Gaps = 7/116 (6%)
 Frame = -1

Query  579  SMGLSRVDPVAPXEVCFSGVG---SDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLG  418
            S  +S V PVAP  +CFS  G   S VP ++FVLQSEMVKWR    NSMVKV + V+CLG
Sbjct  279  SRDMSVVAPVAPFSLCFSSKGFNGSAVPVIDFVLQSEMVKWRFYGSNSMVKVNEEVVCLG  338

Query  417  FLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCSHFTRFSMERDS  250
            FLDGG    +S+V+GG+QLEDN+++F+LGTSMLGF++L  GT CS F+  S+  +S
Sbjct  339  FLDGGSDLTSSIVLGGFQLEDNVMDFDLGTSMLGFSTL-RGTCCSDFSPNSVLDES  393



>gb|KDO74801.1| hypothetical protein CISIN_1g040581mg [Citrus sinensis]
Length=394

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 85/116 (73%), Gaps = 7/116 (6%)
 Frame = -1

Query  579  SMGLSRVDPVAPXEVCFSGVG---SDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLG  418
            S  +S V PVAP  +CFS  G   S VP ++FVLQSEMVKWR    NSMVKV + V+CLG
Sbjct  279  SRDMSVVAPVAPFSLCFSSKGFNGSAVPVIDFVLQSEMVKWRFYGSNSMVKVNEEVVCLG  338

Query  417  FLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCSHFTRFSMERDS  250
            FLDGG    +S+V+GG+QLEDN+++F+LGTSMLGF++L  GT CS F+  S+  +S
Sbjct  339  FLDGGSDLTSSIVLGGFQLEDNVMDFDLGTSMLGFSTL-RGTCCSDFSPNSVLDES  393



>emb|CDO98999.1| unnamed protein product [Coffea canephora]
Length=440

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 80/123 (65%), Gaps = 11/123 (9%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSGV-------GSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A  M ++   PVAP  +CF           S+VP ++ VLQSEMVKWR+   NS V+V D
Sbjct  317  AIGMNMTMAPPVAPFGICFRSERLEANRDASNVPIIDLVLQSEMVKWRIEGRNSFVQVND  376

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSL-MAGTSCSHFTRFSME  259
             VMCLGFLDGG    ASVV+GGYQLEDNL+EF LGT MLGF++L M  T+CS      + 
Sbjct  377  KVMCLGFLDGGSSSKASVVLGGYQLEDNLVEFKLGTKMLGFSALAMGHTTCSDLRTSYIP  436

Query  258  RDS  250
            R++
Sbjct  437  REA  439



>ref|NP_001239980.1| uncharacterized protein LOC100806719 precursor [Glycine max]
 gb|ACU23537.1| unknown [Glycine max]
Length=414

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (71%), Gaps = 9/112 (8%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSGVGSDV----PKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            A +M ++RV  VAP E+CFS  GS V    P +E VLQSEMVKW +   NSMV+V D V+
Sbjct  292  AVAMNITRVASVAPFELCFSSRGSQVGPSMPVIELVLQSEMVKWTIHGRNSMVRVSDEVL  351

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            CLGFLDGG+    S+VIGGYQLED +++F+L TSM+GF+S  +   T CS F
Sbjct  352  CLGFLDGGVNPRNSIVIGGYQLEDVIVQFDLATSMVGFSSSLVAKNTKCSDF  403



>gb|KHN03053.1| Basic 7S globulin [Glycine soja]
Length=414

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (71%), Gaps = 9/112 (8%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSGVGSDV----PKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            A +M ++RV  VAP E+CFS  GS V    P +E VLQSEMVKW +   NSMV+V D V+
Sbjct  292  AVAMNMTRVASVAPFELCFSSRGSQVGPSMPVIELVLQSEMVKWTIHGRNSMVRVSDEVL  351

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            CLGFLDGG+    S+VIGGYQLED +++F+L TSM+GF+S  +   T CS F
Sbjct  352  CLGFLDGGVNPRNSIVIGGYQLEDVIVQFDLATSMVGFSSSLVAKNTKCSDF  403



>ref|XP_006419821.1| hypothetical protein CICLE_v10005127mg [Citrus clementina]
 gb|ESR33061.1| hypothetical protein CICLE_v10005127mg [Citrus clementina]
Length=394

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 86/116 (74%), Gaps = 7/116 (6%)
 Frame = -1

Query  579  SMGLSRVDPVAPXEVCFSGVG---SDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLG  418
            S  +S V PVAP  +CFS  G   S VP ++FVLQSEMVKWR+   NSMVKV + V+CLG
Sbjct  279  SRDMSVVAPVAPFGLCFSSKGFNGSAVPVIDFVLQSEMVKWRIYGSNSMVKVNEEVVCLG  338

Query  417  FLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCSHFTRFSMERDS  250
            FLDGG    +S+V+GG+QLEDN+++F+LGTSMLGF++L  GT CS F+  S+  +S
Sbjct  339  FLDGGSDLTSSIVLGGFQLEDNVMDFDLGTSMLGFSALR-GTCCSDFSPNSVLDES  393



>ref|XP_007224886.1| hypothetical protein PRUPE_ppa022337mg [Prunus persica]
 gb|EMJ26085.1| hypothetical protein PRUPE_ppa022337mg [Prunus persica]
Length=400

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 77/111 (69%), Gaps = 13/111 (12%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A +M ++RV PVAP  +CFS       GVG  VP ++ VLQSEMVKWR+   NSMV+V +
Sbjct  281  AMAMNMTRVAPVAPFVLCFSSEQAEGRGVGPKVPAIDLVLQSEMVKWRIHGRNSMVQVSN  340

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCS  283
             VMCLGFLDGG     S+VIGGYQLED LL F+L  S+LGF+S    TSCS
Sbjct  341  QVMCLGFLDGGSDLKTSIVIGGYQLEDTLLHFDLSASVLGFSS---QTSCS  388



>ref|XP_007154121.1| hypothetical protein PHAVU_003G092100g [Phaseolus vulgaris]
 gb|ESW26115.1| hypothetical protein PHAVU_003G092100g [Phaseolus vulgaris]
Length=416

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 77/110 (70%), Gaps = 7/110 (6%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG--VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            A SM ++RV  VAP E+CFS   VG  VP +E VLQSEMVKW +   NSMV+V D V CL
Sbjct  296  AVSMNMTRVASVAPFELCFSSSQVGPSVPVIELVLQSEMVKWSIHGRNSMVRVSDEVACL  355

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF DGG+    S+VIGGYQLED +++F+L TSM+GF+S  L   T CS F
Sbjct  356  GFSDGGVNLRNSIVIGGYQLEDVIVQFDLATSMVGFSSSLLTKKTKCSDF  405



>ref|XP_008222998.1| PREDICTED: basic 7S globulin 2 [Prunus mume]
Length=411

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 76/111 (68%), Gaps = 13/111 (12%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A +M ++RV PVAP  +CFS       GVG  VP ++ VLQSEMVKWR+   NSMV+V  
Sbjct  292  AMAMNMTRVTPVAPFGLCFSSEQAEGRGVGPKVPAIDLVLQSEMVKWRIHGRNSMVQVST  351

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCS  283
             VMCLGFLDGG     S+VIGGYQLED LL F+L  S+LGF+S    TSCS
Sbjct  352  QVMCLGFLDGGSDLKTSIVIGGYQLEDTLLHFDLSASVLGFSS---QTSCS  399



>gb|KDP40108.1| hypothetical protein JCGZ_02106 [Jatropha curcas]
Length=425

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 85/126 (67%), Gaps = 15/126 (12%)
 Frame = -1

Query  585  AASMGLSRVDP--VAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  442
            A SM L+RVDP   +P  +CFS        +G  VP ++ VLQSEMVKWR+   NSMV+V
Sbjct  300  ANSMNLTRVDPEPSSPFGLCFSSKGIANTIMGPMVPAIDLVLQSEMVKWRIHGRNSMVQV  359

Query  441  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFT--SLMAGTSCSHFTRF  268
             D +MCLG LDGGL    S+VIGG+QLED LLEF+LG SMLGF+   LM  TSCS F   
Sbjct  360  SDEMMCLGLLDGGLESENSIVIGGFQLEDTLLEFDLGNSMLGFSFPILMRQTSCSSFLD-  418

Query  267  SMERDS  250
            SM +DS
Sbjct  419  SMGKDS  424



>ref|XP_003550008.2| PREDICTED: basic 7S globulin 2-like [Glycine max]
Length=432

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 78/112 (70%), Gaps = 9/112 (8%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG----VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            A +M ++RV  VAP E+CFS      G  VP +E VLQSEMVKW +   NSMV+V D V+
Sbjct  310  AVAMNMTRVASVAPFELCFSSRGEQAGPSVPVIELVLQSEMVKWTIHGRNSMVRVSDEVV  369

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            CLGFLDGG+    S+VIGGYQLED +++F+L TSM+GF+S  +   T CS F
Sbjct  370  CLGFLDGGVNPRNSIVIGGYQLEDVVVQFDLATSMVGFSSSLVAKNTKCSDF  421



>gb|KHN03449.1| Basic 7S globulin [Glycine soja]
Length=410

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 78/112 (70%), Gaps = 9/112 (8%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG----VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            A +M ++RV  VAP E+CFS      G  VP +E VLQSEMVKW +   NSMV+V D V+
Sbjct  288  AVAMNMTRVASVAPFELCFSSRGEQAGPSVPVIELVLQSEMVKWTIHGRNSMVRVSDEVV  347

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            CLGFLDGG+    S+VIGGYQLED +++F+L TSM+GF+S  +   T CS F
Sbjct  348  CLGFLDGGVNPRNSIVIGGYQLEDVVVQFDLATSMVGFSSSLVAKNTKCSDF  399



>ref|XP_004298169.1| PREDICTED: basic 7S globulin-like [Fragaria vesca subsp. vesca]
Length=414

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 79/114 (69%), Gaps = 13/114 (11%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF--------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  439
            A +M ++RV  VAP  +CF        + VGS VP V+  LQSEMVKWR+   NSMV+V 
Sbjct  289  AMAMNMTRVASVAPFGLCFGSKNIDGSTRVGSRVPVVDLGLQSEMVKWRLHGRNSMVQVS  348

Query  438  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  283
            D VMCLGFLDGGL Q  S+V+GG+QLED LL F+LG SMLGF+S  LM   +CS
Sbjct  349  DEVMCLGFLDGGLEQKTSIVLGGHQLEDTLLHFDLGASMLGFSSSKLMDQNTCS  402



>gb|KDP21480.1| hypothetical protein JCGZ_21951 [Jatropha curcas]
Length=434

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA M +SRV  VAP EVCFS        +G  VP +  VLQ+E V WR+   NS+V+V D
Sbjct  314  AAEMNISRVGSVAPFEVCFSRRNVVSTRLGYRVPSISLVLQNENVVWRIFGANSIVQVSD  373

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLG ++GGL    S+VIGGYQLEDNL++F+L TS LGF+SL+ G  T+CS+F
Sbjct  374  DVLCLGLINGGLNPRTSIVIGGYQLEDNLVQFDLATSRLGFSSLLFGRQTTCSNF  428



>ref|XP_002272235.1| PREDICTED: basic 7S globulin [Vitis vinifera]
Length=436

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 78/115 (68%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA++ ++RV  VAP  VCFS        VG  VP ++ VLQ+E V WR+   NSMV V D
Sbjct  316  AAAINITRVAAVAPFNVCFSSKNVYSTRVGPSVPSIDLVLQNESVFWRIFGANSMVYVSD  375

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CLGF+DGG     S+VIGGYQLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  376  DVLCLGFVDGGANPRTSIVIGGYQLEDNLLQFDLATSRLGFSSSLLFRRTTCANF  430



>emb|CAN80378.1| hypothetical protein VITISV_038701 [Vitis vinifera]
Length=436

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 78/115 (68%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA++ ++RV  VAP  VCFS        VG  VP ++ VLQ+E V WR+   NSMV V D
Sbjct  316  AAAINITRVAAVAPFNVCFSSKNVYSTRVGPSVPSIDLVLQNESVFWRIFGANSMVYVSD  375

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CLGF+DGG     S+VIGGYQLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  376  DVLCLGFVDGGANPRTSIVIGGYQLEDNLLQFDLATSRLGFSSSLLFRRTTCANF  430



>emb|CBI32364.3| unnamed protein product [Vitis vinifera]
Length=400

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 78/115 (68%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA++ ++RV  VAP  VCFS        VG  VP ++ VLQ+E V WR+   NSMV V D
Sbjct  280  AAAINITRVAAVAPFNVCFSSKNVYSTRVGPSVPSIDLVLQNESVFWRIFGANSMVYVSD  339

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CLGF+DGG     S+VIGGYQLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  340  DVLCLGFVDGGANPRTSIVIGGYQLEDNLLQFDLATSRLGFSSSLLFRRTTCANF  394



>emb|CAN68736.1| hypothetical protein VITISV_030193 [Vitis vinifera]
Length=441

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 81/115 (70%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSGVGSD-------VPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A +  ++RV PVAP +VCFS   ++       +P ++ VLQ++ V WR+   NSMV VGD
Sbjct  321  AMAHNVTRVSPVAPFDVCFSTKNTNGAFSTPAIPVIDLVLQNKKVFWRIFETNSMVLVGD  380

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V CLGFLDGGL Q  S+VIGG+QLEDNLL+F+L +S LGFTS  L+  TSC++F
Sbjct  381  DVACLGFLDGGLNQRTSIVIGGHQLEDNLLQFDLESSRLGFTSSLLLRETSCANF  435



>ref|XP_002284868.1| PREDICTED: basic 7S globulin-like [Vitis vinifera]
Length=441

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 81/115 (70%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSGVGSD-------VPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A +  ++RV PVAP +VCFS   ++       +P ++ VLQ++ V WR+   NSMV VGD
Sbjct  321  AMAHNVTRVSPVAPFDVCFSTKNTNGAFSTPAIPVIDLVLQNKKVFWRIFETNSMVLVGD  380

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V CLGFLDGGL Q  S+VIGG+QLEDNLL+F+L +S LGFTS  L+  TSC++F
Sbjct  381  DVACLGFLDGGLNQRTSIVIGGHQLEDNLLQFDLESSRLGFTSSLLLRETSCANF  435



>gb|ACU24232.1| unknown [Glycine max]
Length=403

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A+SM + RVDPV+P  +CF       S VG +VP ++ VLQSEMVKW +   NSMV+V D
Sbjct  287  ASSMSMKRVDPVSPFGLCFESNGVGSSQVGPNVPVIDLVLQSEMVKWSIHGRNSMVQVND  346

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             VMCLGF+DGG      +VIGGYQLED L++ +  TSM+GF+   L    +CSHF
Sbjct  347  DVMCLGFVDGGENPRNPIVIGGYQLEDVLVQIDFDTSMVGFSPSLLTKHATCSHF  401



>ref|XP_003542884.1| PREDICTED: basic 7S globulin [Glycine max]
 gb|KHN37575.1| Basic 7S globulin [Glycine soja]
Length=403

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A+SM + RVDPV+P  +CF       S VG +VP ++ VLQSEMVKW +   NSMV+V D
Sbjct  287  ASSMSMKRVDPVSPFGLCFESNGVGSSQVGPNVPVIDLVLQSEMVKWSIHGRNSMVQVND  346

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             VMCLGF+DGG      +VIGGYQLED L++ +  TSM+GF+   L    +CSHF
Sbjct  347  DVMCLGFVDGGENPRNPIVIGGYQLEDVLVQIDFDTSMVGFSPSLLTKHATCSHF  401



>ref|XP_008340919.1| PREDICTED: basic 7S globulin [Malus domestica]
Length=406

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 74/111 (67%), Gaps = 14/111 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A SM ++RV PVAP   CFS        VG  VP ++ VLQSE+VKWR+   NSMV+V +
Sbjct  288  AMSMNMTRVSPVAPFGQCFSSRKKDGTLVGPKVPVIDLVLQSELVKWRIHGRNSMVQVRN  347

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCS  283
             VMCLGFLDGGL    S+VIGGYQLED LL F++G S LGFT      SCS
Sbjct  348  EVMCLGFLDGGLNLKTSMVIGGYQLEDTLLHFDVGASRLGFTQ----QSCS  394



>ref|XP_011014389.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=435

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 80/119 (67%), Gaps = 14/119 (12%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCFSG--------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGV  430
            + ++ V PVAP  +CFS         +G  VP ++ VLQSEMVKWR+   N+MV V D V
Sbjct  311  LNMTVVAPVAPFGLCFSSKEVPSSMLLGPMVPAIDLVLQSEMVKWRVHGRNAMVPVLDEV  370

Query  429  MCLGFLDGGLGQ--GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCSHFTRFSME  259
            MCLGFLDGG      +S+VIGG+QLEDNLLEFNLGTSMLGF+S    TSCS +    M+
Sbjct  371  MCLGFLDGGFKSKTSSSIVIGGFQLEDNLLEFNLGTSMLGFSS-TRHTSCSDYHTRMMQ  428



>ref|XP_004151001.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN47256.1| Basic 7S globulin 2 small subunit [Cucumis sativus]
Length=414

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 78/117 (67%), Gaps = 12/117 (10%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            M +  V PVAP EVCF       +  G  VP++E +LQSEMV W++   NSMVKV D   
Sbjct  293  MNMKEVAPVAPFEVCFESENMEMTAAGPKVPEIELILQSEMVGWKIYGRNSMVKVNDEAY  352

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSM  262
            CLGF+DGGL    ++V+GGYQ+ED +L+F++GTSMLGF+S  L    SCS F+  ++
Sbjct  353  CLGFVDGGLKPRNAIVLGGYQMEDIVLDFDMGTSMLGFSSSLLQRKRSCSEFSPVNL  409



>emb|CDP10858.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 78/115 (68%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  +SRV  VAP EVCFS        +G+ VP ++ VLQ + V W +   NSMV V D
Sbjct  318  AATRNISRVPGVAPFEVCFSSENVLGTRLGASVPYIDLVLQGQNVVWTITGSNSMVYVND  377

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGGL    S+VIGGYQLED LL+F+L TS LGFTS + G  T+CS+F
Sbjct  378  NVLCLGFVDGGLNPRTSIVIGGYQLEDLLLQFDLATSRLGFTSTLLGAQTTCSNF  432



>ref|XP_011026191.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=438

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 79/115 (69%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  ++RV  VAP +VCFS        +G+ VP +  VLQ+E V WR+   NSMV+V D
Sbjct  318  AAARNITRVASVAPFDVCFSRDNIFSTRLGAAVPTISLVLQNENVIWRIFGANSMVQVSD  377

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF++GG     S+VIGGYQLEDNL +F+L  S LGF+SL+ G  T+CS+F
Sbjct  378  NVLCLGFVNGGSNPTTSIVIGGYQLEDNLFQFDLAASRLGFSSLLFGRQTTCSNF  432



>ref|XP_010255899.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=448

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 78/115 (68%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKW---RMNSMVKVGD  436
            AASM +SRV  VAP  VCFS        +G  VP ++ VL S+ V W   R NSMV+V D
Sbjct  328  AASMKMSRVASVAPFGVCFSSKSIKRTRMGPLVPAIDLVLHSQDVYWSISRSNSMVQVKD  387

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GVMCLG +D G     S+VIGG+QLEDNLL+F+L +SMLGFTS  L  GT+C++F
Sbjct  388  GVMCLGLVDAGKNPRTSIVIGGHQLEDNLLQFDLASSMLGFTSSLLGHGTNCANF  442



>ref|XP_008458562.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=417

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 75/113 (66%), Gaps = 12/113 (11%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            M +  V PVAP E CF       +  G  VP++E +LQSEMV W++   NSMVKV D   
Sbjct  296  MNMKEVAPVAPFEACFESENMEMTAAGPKVPEIELILQSEMVGWKIYGRNSMVKVNDKAY  355

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  274
            CLGF+DGGL    ++V+GGYQ+ED +L+F++GTSMLGF+S  L    SCS F+
Sbjct  356  CLGFVDGGLKPRNAIVLGGYQMEDIVLDFDIGTSMLGFSSSLLQRKRSCSEFS  408



>ref|XP_010242827.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=434

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 79/117 (68%), Gaps = 12/117 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF----SGVGSD--VPKVEFVLQSEMVKWRM---NSMVKVGDG  433
            A S G  R  PV+P EVC      G+G D  VPK++ VLQSE V WR    NSMV VGD 
Sbjct  313  ATSTGFIREAPVSPFEVCIRANVPGIGPDDHVPKLDLVLQSESVYWRFEHRNSMVTVGDS  372

Query  432  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLM-AGTSCS--HFTR  271
            V+CLG LDGGL    S+VIGG+QLEDNLL+F+L  S LGF+SL+ +  +CS  +FTR
Sbjct  373  VLCLGMLDGGLKPETSIVIGGHQLEDNLLQFDLRGSKLGFSSLLSSAATCSSFNFTR  429



>ref|XP_009411762.1| PREDICTED: basic 7S globulin-like [Musa acuminata subsp. malaccensis]
Length=434

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA  G+ RV PVAP  +CF       + VG  VP+++ VL S+ V WR+   NSMV+V D
Sbjct  314  AALAGVRRVPPVAPFGLCFDPSSIGSTRVGPAVPQIDLVLPSQNVYWRIFGANSMVQVRD  373

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CLGF+DGG     S+VIGGYQLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  374  KVLCLGFVDGGAEPRTSIVIGGYQLEDNLLQFDLATSRLGFSSSLLFRQTTCANF  428



>ref|XP_003546133.1| PREDICTED: basic 7S globulin [Glycine max]
 gb|KHN33057.1| Basic 7S globulin [Glycine soja]
Length=403

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A+SM + RVDPV+P  +CF       S VG +VP ++ VLQSEMVKW +   NSMV+V D
Sbjct  287  ASSMDMKRVDPVSPFGLCFESNGVGSSQVGPNVPIIDLVLQSEMVKWSIYGRNSMVQVSD  346

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             VMCLGF+DGG     S+VIGG+QLED L++ +  TSM+GF+   L    SCS F
Sbjct  347  DVMCLGFVDGGENPRNSIVIGGFQLEDVLVQIDFDTSMVGFSPSLLTKQASCSDF  401



>ref|XP_010111673.1| Basic 7S globulin [Morus notabilis]
 gb|EXC31441.1| Basic 7S globulin [Morus notabilis]
Length=421

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 80/114 (70%), Gaps = 11/114 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A SM ++RV+ VAP  +CF       +  G +VP VE  LQSE+VKWR+   N MVKV D
Sbjct  298  ALSMNMTRVESVAPFGLCFGVETVPKTRFGPEVPDVELGLQSELVKWRIHGRNLMVKVSD  357

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA-GTSCSHF  277
             V+CLGFLDGGL  GAS+V+GG+QLED +L F++G+SM+GF+ L+    SCS F
Sbjct  358  EVVCLGFLDGGLELGASIVLGGFQLEDVVLHFDVGSSMMGFSPLLKWKRSCSDF  411



>ref|XP_004170412.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
Length=414

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 77/117 (66%), Gaps = 12/117 (10%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            M +  V PVAP EVCF       +  G  VP++E +LQSEMV W++   NSMVKV D   
Sbjct  293  MNMKEVAPVAPFEVCFESENMEMTAAGPKVPEIELILQSEMVGWKIYGRNSMVKVNDEAY  352

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSM  262
            CLGF+DGGL    ++V+GGYQ+ED +L+F++GTSMLGF+S  L     CS F+  ++
Sbjct  353  CLGFVDGGLKPRNAIVLGGYQMEDIVLDFDMGTSMLGFSSSLLQRKRFCSEFSPVNL  409



>ref|XP_010035593.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=436

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV PV P   CF       + VG  VP+++ VLQS  V WR+   NSMV+V +GV+CL
Sbjct  321  VRRVAPVKPFRACFDSNSIGSTRVGPGVPQIDLVLQSSSVYWRIFGANSMVQVKEGVLCL  380

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGGL    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  381  GFVDGGLSPKTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRQTTCSNF  430



>ref|XP_002302122.1| hypothetical protein POPTR_0002s05580g [Populus trichocarpa]
 gb|EEE81395.1| hypothetical protein POPTR_0002s05580g [Populus trichocarpa]
Length=438

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 79/115 (69%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            +A+  ++RV  VAP +VCFS        +G+ VP +  VLQ+E V WR+   NSMV+V D
Sbjct  318  SAARNITRVASVAPFDVCFSSDNIFSTRLGAAVPTISLVLQNENVIWRIFGANSMVQVSD  377

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF++GG     S+VIGGYQLEDNL +F+L  S LGF+SL+ G  T+C++F
Sbjct  378  NVLCLGFVNGGSNPTTSIVIGGYQLEDNLFQFDLAASRLGFSSLLFGRQTTCANF  432



>emb|CDP03612.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 78/115 (68%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  +SRV  VAP EVC S        +G  VP+++ VLQS+ V W +   NSMV V D
Sbjct  135  AAAWNISRVAGVAPFEVCVSSKNVFSTRLGPSVPQIDLVLQSQSVVWSITGSNSMVYVND  194

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF++GG+    S+VIGGYQLED LL+F+L TS LGFTS + G  T+C++F
Sbjct  195  NVLCLGFVNGGVNPRTSIVIGGYQLEDLLLQFDLATSRLGFTSTLLGSRTTCANF  249



>ref|XP_003590668.1| Basic 7S globulin [Medicago truncatula]
 gb|AES60919.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=434

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 79/113 (70%), Gaps = 11/113 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSGV-----GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGV  430
            +A+  + RVD VAP E C++ V     G+DVP +E  LQ+ ++ WR+   NSMV + D V
Sbjct  317  SAARNIKRVDSVAPFEFCYTNVTGTRLGADVPTIELYLQNNVI-WRIFGANSMVNINDEV  375

Query  429  MCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            +CLGF+ GG    AS+VIGGYQLE+NLL+F+L  S LGF+SL+ G  T+CS+F
Sbjct  376  LCLGFVIGGENTWASIVIGGYQLENNLLQFDLAASKLGFSSLLFGRQTTCSNF  428



>ref|XP_006489581.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 75/111 (68%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             + RV PVAP   CF+        VG  VP+++ VLQS  V WR+   NSMV+V D V+C
Sbjct  321  NIPRVTPVAPFGACFNSTFVGSTRVGPAVPQIDLVLQSNTVIWRIFGANSMVQVRDDVLC  380

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  381  LGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHQTTCANF  431



>gb|KDO74788.1| hypothetical protein CISIN_1g036132mg [Citrus sinensis]
Length=437

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 75/111 (68%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             + RV PVAP   CF+        VG  VP+++ VLQS  V WR+   NSMV+V D V+C
Sbjct  321  NIPRVTPVAPFGACFNSTFVGSTRVGPAVPQIDLVLQSNTVIWRIFGANSMVQVRDDVLC  380

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  381  LGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHQTTCANF  431



>ref|XP_011082548.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=432

 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 76/115 (66%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  +SRV  VAP +VCFS        VG  VP ++ VLQ +   W +   NSMV+V D
Sbjct  312  AAARNISRVAGVAPFDVCFSSENVFSTRVGPSVPYIDLVLQGQDAVWTITGSNSMVQVND  371

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGFLDGG     S+VIGGYQLEDNLL+F+L  S LGF+S + G  T+C++F
Sbjct  372  NVLCLGFLDGGSNPRTSIVIGGYQLEDNLLQFDLAASRLGFSSTLLGRRTTCANF  426



>ref|XP_004290668.1| PREDICTED: basic 7S globulin 2-like [Fragaria vesca subsp. vesca]
Length=439

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 79/115 (69%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            +A+  +SRV+ VAP EVCFS        +G  VP+++ VLQ+E   WR+   NSMV V D
Sbjct  319  SAARNISRVNAVAPFEVCFSTENVLSTRLGPSVPEIDLVLQNESTYWRIFGANSMVYVSD  378

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF++GG     S+VIGG+QLEDNL++F+L  S +GF+S + G  T+CS+F
Sbjct  379  NVVCLGFVNGGEDARTSIVIGGHQLEDNLVQFDLAASRVGFSSTLLGRQTTCSNF  433



>ref|XP_003518926.1| PREDICTED: basic 7S globulin [Glycine max]
Length=435

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 80/116 (69%), Gaps = 13/116 (11%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            +++  ++RV  VAP EVCFS        +G+ VP +E VLQ++   WR+   NSMV V D
Sbjct  314  SSARNITRVASVAPFEVCFSRENVLATRLGAAVPTIELVLQNQKTVWRIFGANSMVSVSD  373

Query  435  -GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
              V+CLGF++GG     S+VIGGYQLEDNLL+F+L TS LGF+SL+ G  T+C++F
Sbjct  374  DKVLCLGFVNGGENPRTSIVIGGYQLEDNLLQFDLATSRLGFSSLLYGSRTTCANF  429



>gb|KFK42682.1| hypothetical protein AALP_AA1G026200 [Arabis alpina]
Length=433

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 80/115 (70%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A++  +SRV  V P   CFS        VG  VP+++ VLQS+ V WR+   NSMV VG+
Sbjct  313  ASARNISRVSSVKPFGACFSTANVGVTRVGYAVPEIQLVLQSKDVVWRIFGANSMVSVGN  372

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+ +  SVVIGG+QLEDNL+EF+L ++ LGF+S + G  T+C++F
Sbjct  373  DVICLGFVDGGVNESTSVVIGGFQLEDNLIEFDLASNRLGFSSTLLGRSTNCANF  427



>ref|XP_004236054.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=436

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 75/109 (69%), Gaps = 12/109 (11%)
 Frame = -1

Query  567  SRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLG  418
            +RV  VAP E+CFS        VG  VP ++ VLQ+  V WR+   NSMVKV   V+CLG
Sbjct  322  TRVAAVAPFEICFSSKSVGSTRVGPAVPTIDLVLQTTRVYWRIFGANSMVKVSQDVICLG  381

Query  417  FLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            F++GG+ + AS+VIGGYQLEDNLL+F+L  S LGF+S  L+  T+C++ 
Sbjct  382  FVNGGIKRTASIVIGGYQLEDNLLQFDLARSTLGFSSSLLLHQTACANL  430



>emb|CAN61502.1| hypothetical protein VITISV_011733 [Vitis vinifera]
Length=415

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSGV-------GSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AASM ++RV  VAP  VCFS         G+ VP +  VLQ+  V WR+   NSMV V  
Sbjct  296  AASMNITRVAAVAPFSVCFSSKNVYSTRGGAAVPTIGLVLQNNSVVWRIFGANSMVFVNG  355

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CLGF+DGG     S+VIGGYQLEDNLL+F+L  S LGF+S  L + T+CS+F
Sbjct  356  DVLCLGFVDGGANPRTSIVIGGYQLEDNLLQFDLAASRLGFSSSLLFSQTTCSNF  410



>ref|XP_006345120.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=437

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 12/109 (11%)
 Frame = -1

Query  567  SRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLG  418
            +RV  VAP E CFS        VG  VP ++ VLQ+  V WR+   NSMVKV   V+CLG
Sbjct  323  TRVAAVAPFETCFSSKSVGSTRVGPAVPTIDLVLQTTRVYWRIFGANSMVKVSQDVICLG  382

Query  417  FLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            F++GG+ + AS+VIGGYQLEDNLL F+L  S LGF+S  L   T+C++F
Sbjct  383  FVNGGIKRTASIVIGGYQLEDNLLHFDLARSTLGFSSSLLFHQTTCANF  431



>ref|XP_003590665.1| Xyloglucan-specific endoglucanase inhibitor protein [Medicago 
truncatula]
 gb|AES60916.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=435

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 77/113 (68%), Gaps = 10/113 (9%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSGV-----GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGV  430
            +A+  + RV  VAP E C++ +     G+ VP +E  LQ+E V WR+   NSMV + D V
Sbjct  317  SAARNIKRVGSVAPFEFCYTNLTGTRLGAAVPTIELFLQNENVVWRIFGANSMVSINDEV  376

Query  429  MCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            +CLGF++GG     S+VIGGYQLE+NLL+F+L  S LGF+SL+ G  T+CS+F
Sbjct  377  LCLGFVNGGKNTRTSIVIGGYQLENNLLQFDLAASKLGFSSLLFGRQTTCSNF  429



>ref|XP_010255900.1| PREDICTED: basic 7S globulin 2-like [Nelumbo nucifera]
Length=434

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 78/115 (68%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A+SMG++RV  VAP  VCFS        VG  VP ++ VLQ++   WR+   NSMV+V +
Sbjct  314  ASSMGITRVAAVAPFGVCFSSKNISSTRVGPAVPTIDLVLQNQSTFWRIFGANSMVQVSN  373

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CLG ++GG     S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  374  DVLCLGIVNGGSNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRQTTCSNF  428



>gb|AFK46427.1| unknown [Medicago truncatula]
Length=435

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 76/112 (68%), Gaps = 10/112 (9%)
 Frame = -1

Query  582  ASMGLSRVDPVAPXEVCFSGV-----GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            A+  + RV  VAP E C++ +     G+ VP +E  LQ+E V WR+   NSMV + D V+
Sbjct  318  AARNIKRVGSVAPFEFCYTNLTGTRLGAAVPTIELFLQNENVVWRIFGANSMVSINDEVL  377

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            CLGF++GG     S+VIGGYQLE+NLL+F+L  S LGF+SL+ G  T+CS+F
Sbjct  378  CLGFVNGGKNTRTSIVIGGYQLENNLLQFDLAASKLGFSSLLFGRQTTCSNF  429



>gb|KJB46995.1| hypothetical protein B456_008G005100 [Gossypium raimondii]
Length=436

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 79/115 (69%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+M +SRV  VAP EVCFS        +G  VP ++ VLQ++ V WRM   NSMV+V  
Sbjct  316  AAAMNISRVAGVAPFEVCFSSSNIASTRLGPTVPSIDLVLQNQNVFWRMFGSNSMVEVNR  375

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF++GG     S+VIGG+QLE+ LL+F+L TS LGF++ + G  T+C++F
Sbjct  376  DVLCLGFVNGGSNPTTSIVIGGHQLENTLLQFDLATSRLGFSATLLGRQTTCANF  430



>ref|XP_011011197.1| PREDICTED: basic 7S globulin-like isoform X2 [Populus euphratica]
Length=429

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 73/110 (66%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF+        VG  VP+++ VLQS  V WR+   NSMV+V   VMCL
Sbjct  313  VPRVASVAPFGACFNSTNIGSTRVGPPVPQIDLVLQSSKVSWRIFGANSMVQVKSDVMCL  372

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGGL    S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  373  GFVDGGLNPRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  422



>ref|XP_008235257.1| PREDICTED: basic 7S globulin 2-like [Prunus mume]
Length=473

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            + SM ++RV  V P EVCFS        VG  VP ++ VLQ+E   WR+   NSMV+V D
Sbjct  353  SKSMNITRVSSVGPFEVCFSRDNVLSTRVGPAVPSIDLVLQNESTFWRVFGANSMVQVND  412

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CL  ++GG     SVVIGGYQLE+NLL+F+L TS LGF+S  L   T+CS+F
Sbjct  413  DVLCLAVVNGGESPRTSVVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCSNF  467



>ref|XP_011015097.1| PREDICTED: basic 7S globulin-like isoform X2 [Populus euphratica]
Length=429

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 73/110 (66%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF+        VG  VP+++ VLQS  V WR+   NSMV+V   VMCL
Sbjct  313  VPRVASVAPFGACFNSTNIGSTRVGPPVPQIDLVLQSSKVSWRIFGANSMVQVKSDVMCL  372

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGGL    S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  373  GFVDGGLNPRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  422



>ref|XP_006418255.1| hypothetical protein EUTSA_v10007672mg [Eutrema salsugineum]
 gb|ESQ36608.1| hypothetical protein EUTSA_v10007672mg [Eutrema salsugineum]
Length=437

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 77/115 (67%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  ++RV  V P   CFS        VG  VP+++ VLQS  V WR+   NSMV V D
Sbjct  317  AAARNITRVSSVKPFGACFSTQNVGVTRVGYAVPEIQLVLQSNNVVWRIFGANSMVSVSD  376

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++ LGF+S + G  T+C++F
Sbjct  377  DVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNRLGFSSTLLGRRTNCANF  431



>ref|XP_006419808.1| hypothetical protein CICLE_v10006987mg [Citrus clementina]
 gb|ESR33048.1| hypothetical protein CICLE_v10006987mg [Citrus clementina]
Length=436

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 74/111 (67%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             + RV PV+P   CFS        VG+ VP ++ VLQS  V W +   NSMV+V D V+C
Sbjct  320  NVPRVKPVSPFGTCFSSPHIGSTRVGAAVPLIDLVLQSSKVIWSIFGANSMVQVKDDVLC  379

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  380  LGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHRTTCSNF  430



>ref|XP_011011196.1| PREDICTED: basic 7S globulin-like isoform X1 [Populus euphratica]
Length=439

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 73/110 (66%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF+        VG  VP+++ VLQS  V WR+   NSMV+V   VMCL
Sbjct  323  VPRVASVAPFGACFNSTNIGSTRVGPPVPQIDLVLQSSKVSWRIFGANSMVQVKSDVMCL  382

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGGL    S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  383  GFVDGGLNPRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  432



>ref|XP_011015096.1| PREDICTED: basic 7S globulin-like isoform X1 [Populus euphratica]
Length=439

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 73/110 (66%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF+        VG  VP+++ VLQS  V WR+   NSMV+V   VMCL
Sbjct  323  VPRVASVAPFGACFNSTNIGSTRVGPPVPQIDLVLQSSKVSWRIFGANSMVQVKSDVMCL  382

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGGL    S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  383  GFVDGGLNPRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  432



>ref|XP_006489296.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 73/108 (68%), Gaps = 12/108 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            RVD V+P   CF       + VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF
Sbjct  324  RVDSVSPFGACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVKSNVMCLGF  383

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            +DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  384  VDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRRTTCSNF  431



>ref|XP_007147764.1| hypothetical protein PHAVU_006G153200g [Phaseolus vulgaris]
 gb|ESW19758.1| hypothetical protein PHAVU_006G153200g [Phaseolus vulgaris]
Length=410

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFS--GVGS-----DVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A+ + +SRV PV+P  +CFS  GVGS     +VP ++ VLQSEMVKW +   NSMV+V  
Sbjct  285  ASILNMSRVSPVSPFGLCFSSNGVGSSQMGPNVPVIDLVLQSEMVKWSIHGRNSMVQVSK  344

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             VMCLGF+DGG      +VIGGYQLED L++F+  TSM+GF+   L    SCS F
Sbjct  345  DVMCLGFVDGGENPRNPIVIGGYQLEDVLVQFDFDTSMVGFSPSLLTRHASCSDF  399



>ref|XP_006489297.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 73/108 (68%), Gaps = 12/108 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            RVD V+P   CF       + VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF
Sbjct  324  RVDSVSPFGACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVKSNVMCLGF  383

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            +DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  384  VDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRRTTCSNF  431



>ref|XP_007201544.1| hypothetical protein PRUPE_ppa017430mg, partial [Prunus persica]
 gb|EMJ02743.1| hypothetical protein PRUPE_ppa017430mg, partial [Prunus persica]
Length=412

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            + SM ++RV  V P EVCFS        VG  VP ++ VLQ+E   WR+   NSMV+V D
Sbjct  292  SKSMNITRVSSVGPFEVCFSRDNVLSTRVGPAVPSIDLVLQNESTFWRVFGANSMVQVND  351

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CL  ++GG     S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+CS+F
Sbjct  352  DVLCLAVVNGGESPRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCSNF  406



>ref|XP_011020124.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=431

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 12/114 (11%)
 Frame = -1

Query  582  ASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  433
            A   + RV  VAP   CF+        VG  VP+++ VLQS+ V WR+   NSMV+V D 
Sbjct  312  AKANVPRVASVAPFGACFNSKNIVGTRVGPAVPQIDLVLQSKNVYWRIFGANSMVQVKDD  371

Query  432  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            V+CLGF+DGG+    S+VIGG+QLEDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  372  VLCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLAASRLGFSSSLLFRQTTCANF  425



>ref|XP_002308984.2| hypothetical protein POPTR_0006s06820g [Populus trichocarpa]
 gb|EEE92507.2| hypothetical protein POPTR_0006s06820g [Populus trichocarpa]
Length=431

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 12/114 (11%)
 Frame = -1

Query  582  ASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  433
            A   + RV  VAP   CF+        VG  VP+++ VLQS+ V WR+   NSMV+V D 
Sbjct  312  AKANVPRVASVAPFGACFNSKNIGSTRVGPAVPQIDLVLQSKNVYWRIFGANSMVQVKDD  371

Query  432  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            V+CLGF+DGG+    S+VIGG+QLEDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  372  VLCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLAASRLGFSSSLLFRQTTCANF  425



>gb|EYU38145.1| hypothetical protein MIMGU_mgv1a006647mg [Erythranthe guttata]
Length=436

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  +SRV  VAP +VCFS        VG  VP ++ VLQ +   W +   NSMV+V D
Sbjct  316  AAARNISRVAGVAPFDVCFSSSNVFGTRVGPAVPYIDLVLQGQNAVWTITGSNSMVRVND  375

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGFLD G     S+VIGGYQ+EDNLL+F+L  S LGF+S + G  T+C++F
Sbjct  376  DVLCLGFLDAGSNPVTSIVIGGYQIEDNLLQFDLAASRLGFSSTLLGRQTTCANF  430



>ref|XP_002311834.1| hypothetical protein POPTR_0008s20730g [Populus trichocarpa]
 gb|EEE89201.1| hypothetical protein POPTR_0008s20730g [Populus trichocarpa]
Length=437

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 80/121 (66%), Gaps = 15/121 (12%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCFSG--------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGV  430
            + ++ V PVAP  +CFS         +G  VP ++ VLQSEMVKWR+   N+MV V D V
Sbjct  311  LNMTVVAPVAPFGLCFSSKEVPSSMLLGPMVPVIDLVLQSEMVKWRVHGRNAMVPVLDEV  370

Query  429  MCLGFLDGGLGQGAS--VVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSM  262
            MCLGFLDGG     S  +VIGG+QLEDNLLEFNLGTSMLGF+S  L   TSCS +    M
Sbjct  371  MCLGFLDGGSKSKTSSSIVIGGFQLEDNLLEFNLGTSMLGFSSSLLTRHTSCSDYHTRMM  430

Query  261  E  259
            +
Sbjct  431  Q  431



>ref|XP_006419833.1| hypothetical protein CICLE_v10006689mg [Citrus clementina]
 gb|ESR33073.1| hypothetical protein CICLE_v10006689mg [Citrus clementina]
Length=437

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             + RV PVAP    F+        VG  VP+++ VLQS  V WR+   NSMV+V D V+C
Sbjct  321  NIPRVTPVAPFGAYFNSTFVGSTRVGPAVPQIDLVLQSNTVIWRIFGANSMVQVRDDVLC  380

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  381  LGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHQTTCANF  431



>ref|XP_006419831.1| hypothetical protein CICLE_v10006962mg [Citrus clementina]
 gb|ESR33071.1| hypothetical protein CICLE_v10006962mg [Citrus clementina]
Length=435

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 74/110 (67%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSGV-------GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV PV+P   CF+         G+ VP+++ VLQS  V W +   NSMV+V D V+CL
Sbjct  320  VPRVKPVSPFGACFNSTHIGSTRAGAAVPQIDLVLQSSKVIWSIFGANSMVQVKDDVLCL  379

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  380  GFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHRTTCSNF  429



>emb|CDO98879.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
            G+ RV PVAP EVCF+        VG   P ++ VLQS+ V WR+   NSMV+V + V+C
Sbjct  315  GVPRVAPVAPFEVCFNSSKLGSTRVGPPAPTIDLVLQSQSVFWRIFGANSMVQVKEDVLC  374

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGGL    S+VIG +Q+ DNLL+F+L  S LGF+S  L   T+CS+F
Sbjct  375  LGFVDGGLNPRTSIVIGLHQIVDNLLQFDLARSRLGFSSTLLFQQTTCSNF  425



>ref|XP_007034630.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOY05556.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=375

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 72/110 (65%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF         VG  VP+++ VLQS+ V W +   NSMV+V + V+CL
Sbjct  260  IPRVPAVAPFSACFKAKSFGSTRVGPAVPQIDLVLQSKDVIWTIFGANSMVQVSNDVLCL  319

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGGL    S+VIGGYQ+E NLL+F+L TS LGFTS  L   T+CS+F
Sbjct  320  GFVDGGLEPTTSIVIGGYQIEHNLLQFDLATSRLGFTSSLLFRQTTCSNF  369



>ref|XP_002277699.1| PREDICTED: basic 7S globulin-like [Vitis vinifera]
Length=435

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 73/110 (66%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            ++RV  V+P   CFS        VG  VP ++ VLQ + V WR+   NSMV+V D V+CL
Sbjct  320  ITRVASVSPFGACFSSKDIGSTRVGPAVPPIDLVLQRQSVYWRVFGANSMVQVSDNVLCL  379

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGG+    S+VIGG QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  380  GFVDGGVNPRTSIVIGGRQLEDNLLQFDLATSRLGFSSSLLSRQTTCSNF  429



>ref|XP_008810759.1| PREDICTED: basic 7S globulin-like [Phoenix dactylifera]
Length=431

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 74/111 (67%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             ++R   V+P  VCF       + VG  VP ++ VL+SE V WR+   NSMV+V D V+C
Sbjct  315  NITRAAAVSPFTVCFDSKEIGSTRVGPAVPSIDLVLESESVFWRIFGSNSMVQVNDDVLC  374

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGG     SVVIGG+QLEDNLL+F+L T+ LGF+S  L   T+C++F
Sbjct  375  LGFVDGGANPRTSVVIGGHQLEDNLLQFDLATTRLGFSSSLLFRQTTCANF  425



>ref|XP_006489295.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=436

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             + RV PV+P   CFS        VG+ V +++ VLQS  V W +   NSMV+V D V+C
Sbjct  320  NVPRVKPVSPFGTCFSSPHIGSTRVGAAVAQIDLVLQSSKVIWSIFGANSMVQVKDDVLC  379

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  380  LGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHRTTCSNF  430



>ref|NP_563679.1| aspartyl protease-like protein [Arabidopsis thaliana]
 gb|AAG48774.1|AF332411_1 unknown protein [Arabidopsis thaliana]
 gb|AAC72120.1| Strong similarity to gb|D14550 extracellular dermal glycoprotein 
(EDGP) precursor from Daucus carota. ESTs gb|84105 and gb|AI100071 
come from this gene [Arabidopsis thaliana]
 gb|AEE27547.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=434

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 77/115 (67%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  + RV  V P   CFS        +G  VP+++ VL S+ V WR+   NSMV V D
Sbjct  314  AAARSIKRVASVKPFGACFSTKNVGVTRLGYAVPEIQLVLHSKDVVWRIFGANSMVSVSD  373

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+  GASVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  374  DVICLGFVDGGVNPGASVVIGGFQLEDNLIEFDLASNKFGFSSTLLGRQTNCANF  428



>ref|XP_006419809.1| hypothetical protein CICLE_v10004993mg [Citrus clementina]
 gb|ESR33049.1| hypothetical protein CICLE_v10004993mg [Citrus clementina]
Length=437

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 73/108 (68%), Gaps = 12/108 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            RV+ V+P   CF       + VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF
Sbjct  324  RVESVSPFGACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVKSNVMCLGF  383

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            +DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  384  VDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRRTTCSNF  431



>ref|XP_006419811.1| hypothetical protein CICLE_v10004995mg [Citrus clementina]
 gb|ESR33051.1| hypothetical protein CICLE_v10004995mg [Citrus clementina]
Length=437

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 73/108 (68%), Gaps = 12/108 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            RV+ V+P   CF       + VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF
Sbjct  324  RVESVSPFGACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVKSNVMCLGF  383

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            +DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  384  VDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRRTTCSNF  431



>ref|XP_011099700.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=433

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 75/118 (64%), Gaps = 15/118 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AAS  ++RV  VAP E CF       S  G DVP ++ VLQS+ + WR    NSMV+V +
Sbjct  313  AASKNITRVASVAPFEACFDSKTVGSSKTGPDVPTIDLVLQSKNIYWRFYGSNSMVRVSN  372

Query  435  GVMCLGFLDGG---LGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CL F+DGG    G   SVV+GG+QLE++LLEF++  S L F+S  L  GTSCS F
Sbjct  373  DVICLAFVDGGSNLTGPTTSVVVGGHQLENHLLEFDVAASRLRFSSSLLFHGTSCSQF  430



>ref|XP_008438716.1| PREDICTED: basic 7S globulin-like isoform X1 [Cucumis melo]
 ref|XP_008438717.1| PREDICTED: basic 7S globulin-like isoform X2 [Cucumis melo]
Length=425

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             + RVD VAP EVC+S        +G  V  ++ +LQ++ V WRM   NSMV V D V+C
Sbjct  312  NIPRVDAVAPFEVCYSSKSFGSTELGPGVASIDLILQNKKVIWRMFGANSMVLVNDEVLC  371

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            LGF+DGG+    +VVIG +Q+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  372  LGFVDGGVEAKTAVVIGAHQIEDNLLEFDLATSRLGFSSTLLGRNTNCANF  422



>ref|XP_002517165.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45328.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=434

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 74/110 (67%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV PV+P  VCF+        VG  VP+++ VLQS  V WR+   NSMV+V   V+CL
Sbjct  319  VPRVAPVSPFGVCFNSSNIGSTRVGPAVPQIDLVLQSSSVFWRIFGANSMVQVKSDVLCL  378

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGGL    S+VIGG+Q+EDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  379  GFVDGGLNPRTSIVIGGHQIEDNLLQFDLAASKLGFSSSLLFRQTTCANF  428



>ref|XP_006345119.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=436

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 12/114 (11%)
 Frame = -1

Query  567  SRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLG  418
            +RV  VAP E CFS        VG  VP ++ VLQ+  V WR+   NSMVKV   V+CLG
Sbjct  322  TRVAAVAPFETCFSSKSVGSTRVGPAVPTIDLVLQTTRVYWRIFGANSMVKVSQDVICLG  381

Query  417  FLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSM  262
            F++GG+    S+VIGGYQL DNLL+F+L  S LGF+S  L   T+C++F   +M
Sbjct  382  FVNGGIKPTTSIVIGGYQLADNLLQFDLAKSTLGFSSSLLFHQTTCANFNFTTM  435



>gb|KJB23117.1| hypothetical protein B456_004G081800 [Gossypium raimondii]
Length=433

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 77/115 (67%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  ++RV  VAP EVCFS        +G+ VP ++ VLQ+E   WR+   NSMV+V  
Sbjct  313  AAARNITRVAGVAPFEVCFSSRNIVGTRLGAAVPSIDLVLQNENTFWRIFGANSMVEVSR  372

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V CLGF++GG     S+VIGGYQLED LL+F+L TS LGF+S + G  T+C++F
Sbjct  373  EVSCLGFVNGGSNPMTSIVIGGYQLEDTLLQFDLATSRLGFSSTLLGRQTTCANF  427



>ref|XP_007034629.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY05555.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=436

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 72/110 (65%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF         VG  VP+++ VLQS+ V W +   NSMV+V + V+CL
Sbjct  321  IPRVPAVAPFSACFKAKSFGSTRVGPAVPQIDLVLQSKDVIWTIFGANSMVQVSNDVLCL  380

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGGL    S+VIGGYQ+E NLL+F+L TS LGFTS  L   T+CS+F
Sbjct  381  GFVDGGLEPTTSIVIGGYQIEHNLLQFDLATSRLGFTSSLLFRQTTCSNF  430



>ref|XP_009111159.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Brassica 
rapa]
Length=434

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA   ++RV  VAP   CFS        +G  VP+++ VL S  V WR+   NSMV V D
Sbjct  314  AAGRNITRVASVAPFGACFSTENVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVSD  373

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGGYQLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  374  DVICLGFVDGGVNARTSVVIGGYQLEDNLIEFDLASNRFGFSSTLLGRRTNCANF  428



>emb|CDX86682.1| BnaC08g00210D [Brassica napus]
Length=415

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA   ++RV  VAP   CFS        +G  VP+++ VL S  V WR+   NSMV V D
Sbjct  295  AAGRNITRVASVAPFGACFSTENVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVSD  354

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGGYQLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  355  DVICLGFVDGGVNARTSVVIGGYQLEDNLIEFDLASNRFGFSSTLLGRRTNCANF  409



>gb|KFK42681.1| hypothetical protein AALP_AA1G026100 [Arabis alpina]
Length=433

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 76/115 (66%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  +SRV  VAP   CFS        +G  VP+++ VL S  V WR+   NS+V V D
Sbjct  313  AAARNISRVASVAPFGACFSTKNVVPTRLGYAVPEIQLVLHSNNVVWRITGSNSVVSVSD  372

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  373  DVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNRFGFSSTLLGSRTTCANF  427



>ref|XP_006387875.1| hypothetical protein POPTR_0509s00200g, partial [Populus trichocarpa]
 gb|ERP46789.1| hypothetical protein POPTR_0509s00200g, partial [Populus trichocarpa]
Length=411

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 72/110 (65%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF+        VG  VP+++ VLQS  V W +   NSMV+V   VMCL
Sbjct  295  VPRVASVAPFGPCFNSTNIGSTRVGPPVPQIDLVLQSSKVSWTIFGANSMVQVKSDVMCL  354

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGGL    S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  355  GFVDGGLNPRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  404



>emb|CDY15456.1| BnaA08g27400D [Brassica napus]
Length=415

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA   ++RV  VAP   CFS        +G  VP+++ VL S  V WR+   NSMV V D
Sbjct  295  AAGRNITRVASVAPFGACFSTENVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVSD  354

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             ++CLGF+DGG+    SVVIGGYQLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  355  DIICLGFVDGGVNARTSVVIGGYQLEDNLIEFDLASNKFGFSSTLLGRRTNCANF  409



>gb|KDP40112.1| hypothetical protein JCGZ_02110 [Jatropha curcas]
Length=434

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 12/114 (11%)
 Frame = -1

Query  582  ASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  433
            A  G+ +V PVAP  +CF+        VG  VP+++ VLQS  V WR+   NSMV+V   
Sbjct  315  ALAGVPKVAPVAPFGLCFNSTNIGSTRVGPAVPQIDLVLQSSTVFWRIFGANSMVQVKSD  374

Query  432  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            V+CLGF DGG+    SVVIGG+QLE+NLL+F+L  S LGF+S  L   T+C++F
Sbjct  375  VLCLGFFDGGVNPRTSVVIGGHQLENNLLQFDLAASKLGFSSSLLFRQTTCANF  428



>ref|XP_007034625.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05551.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=115

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 70/115 (61%), Gaps = 12/115 (10%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            M + RV PVAP   CF       S  G  V  +  VLQS  V WR+   +SMVKV   VM
Sbjct  1    MKIKRVKPVAPFGACFNSRTIKNSRTGPAVTVLGLVLQSSRVIWRIYGHHSMVKVKKKVM  60

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRF  268
            CLGF+DGG     S+VIGG+QLEDNLLEF+L +S LG +S  L+  TS SH+  F
Sbjct  61   CLGFVDGGSEPTTSIVIGGHQLEDNLLEFDLASSKLGPSSSLLLKNTSSSHYRVF  115



>ref|XP_007154122.1| hypothetical protein PHAVU_003G092200g [Phaseolus vulgaris]
 gb|ESW26116.1| hypothetical protein PHAVU_003G092200g [Phaseolus vulgaris]
Length=445

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 74/119 (62%), Gaps = 17/119 (14%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA M + RV PVAP   CF+         G +VP +E VL+   V+WR+   NSMVKV  
Sbjct  325  AAVMKMKRVSPVAPFGACFNSRTVGKTVTGPNVPTIELVLRGG-VQWRIYGVNSMVKVNK  383

Query  435  GVMCLGFLDGGL----GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V CLGF+D GL        S+VIGGYQ+EDNLLEF+L +S LGF+S  L+   +CSHF
Sbjct  384  KVQCLGFVDAGLELEGPAATSIVIGGYQMEDNLLEFDLASSKLGFSSSLLLHNATCSHF  442



>ref|XP_010938774.1| PREDICTED: basic 7S globulin-like [Elaeis guineensis]
Length=431

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 73/111 (66%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             +++   VAP  VCF+        VG  VP ++ VLQ+  V WR+   NSMV+V D V+C
Sbjct  315  NVTKAAAVAPFTVCFNSKEIGSTRVGPAVPSIDLVLQNANVFWRIFGANSMVQVNDDVLC  374

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGG     SVVIGG+QLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  375  LGFVDGGAKPRTSVVIGGHQLEDNLLQFDLATSRLGFSSSLLFRQTTCANF  425



>ref|XP_002889446.1| EDGP precursor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65705.1| EDGP precursor [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  ++RV  V P   CFS        +G  VP+++ VL S  V WR+   NSMV V D
Sbjct  313  AAARNITRVASVKPFSACFSTKNVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVSD  372

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  373  DVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNRFGFSSTLLGRRTNCANF  427



>ref|XP_010039912.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
 gb|KCW45637.1| hypothetical protein EUGRSUZ_L00588 [Eucalyptus grandis]
Length=453

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 80/134 (60%), Gaps = 24/134 (18%)
 Frame = -1

Query  564  RVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            RV PVAP  VCF       +  G DVP ++ VLQSEMV+WR+   +SMV+V D   CLG 
Sbjct  296  RVPPVAPFGVCFDPRSVGATAAGPDVPAIDLVLQSEMVRWRIGGSSSMVRVSDEATCLGV  355

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGT--SCSHFTRFSMERDSA*L  241
            +DGG   G+SVV+GG+QLED LLEF+ G S LGF+  ++    SCS+F            
Sbjct  356  VDGGDRLGSSVVLGGHQLEDVLLEFDFGGSRLGFSPSLSTMQLSCSNFR-----------  404

Query  240  LANFGEISLVQVDG  199
             +NF  ++  ++D 
Sbjct  405  -SNFNSMACRRIDA  417



>ref|XP_006380060.1| hypothetical protein POPTR_0008s20740g [Populus trichocarpa]
 gb|ERP57857.1| hypothetical protein POPTR_0008s20740g [Populus trichocarpa]
Length=439

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 72/110 (65%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF+        VG  VP+++ VLQS  V W +   NSMV+V   VMCL
Sbjct  323  VPRVASVAPFGPCFNSTNIGSTRVGPPVPQIDLVLQSSKVSWTIFGANSMVQVKSDVMCL  382

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGGL    S+VIGGYQLE+NLL+F++ TS LGF+S  L   T+C++F
Sbjct  383  GFVDGGLNPRTSIVIGGYQLENNLLQFDIATSRLGFSSSLLFRQTTCANF  432



>ref|XP_007034624.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05550.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=387

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 75/118 (64%), Gaps = 12/118 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA++ +SRV  VAP  +CFS         G  V  ++ VL+S    WR+   NSMVKV  
Sbjct  270  AAALKISRVASVAPFGLCFSSKTTRNSETGPAVRVIDLVLESNSAPWRIYGHNSMVKVDK  329

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRF  268
             VMCLGF+DGG     S+VIGG+Q+EDNL EF+L +S LGF+S  L+  TSCSHF  F
Sbjct  330  NVMCLGFVDGGSKPRTSIVIGGHQVEDNLGEFDLVSSKLGFSSSLLLKNTSCSHFRVF  387



>ref|XP_009773897.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=433

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 74/108 (69%), Gaps = 9/108 (8%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFS--GVGSD--VPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
             ++RV  VAP E CFS   +GS   VP ++ VLQS+ V WR+   NSMV+V   V+CLGF
Sbjct  320  NVTRVAAVAPFETCFSSKNIGSTRAVPAIDLVLQSKQVYWRIFGSNSMVEVSPDVICLGF  379

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            ++GG+    S+VIGGYQLEDNLL+F+L  S LGF+S  L    +C++F
Sbjct  380  VNGGIKPTTSIVIGGYQLEDNLLQFDLPRSTLGFSSSLLFRQITCANF  427



>ref|NP_171821.1| aspartyl protease-like protein [Arabidopsis thaliana]
 gb|AAK17160.1|AF325092_1 unknown protein [Arabidopsis thaliana]
 gb|AAC72119.1| Strong similarity to gb|D14550 extracellular dermal glycoprotein 
(EDGP) precursor from Daucus carota. ESTs gb|H37281, gb|T44167, 
gb|T21813, gb|N38437, gb|Z26470, gb|R65072, gb|N76373, 
gb|F15470, gb|Z35182, gb|H76373, gb|Z34678 and gb|Z35387 
come from this gene [Arabidopsis thaliana]
 gb|AAK59531.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15204.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27546.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=433

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  + RV  V P   CFS        +G  VP++E VL S+ V WR+   NSMV V D
Sbjct  313  AAARSIKRVASVKPFGACFSTKNVGVTRLGYAVPEIELVLHSKDVVWRIFGANSMVSVSD  372

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  373  DVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNKFGFSSTLLGRQTNCANF  427



>ref|XP_004134152.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 ref|XP_004170541.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57019.1| hypothetical protein Csa_3G149990 [Cucumis sativus]
Length=429

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 76/111 (68%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             + RV  VAP EVC+S        +G  VP ++ +LQ++ V WRM   NSMV V + V+C
Sbjct  313  NIPRVAAVAPFEVCYSSKSFGSTELGPSVPSIDLILQNKKVIWRMFGANSMVVVTEEVLC  372

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            LGF++GG+    ++VIGG+Q+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  373  LGFVEGGVEAETAMVIGGHQIEDNLLEFDLATSRLGFSSTLLGRNTNCANF  423



>ref|XP_010522713.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=429

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 74/108 (69%), Gaps = 12/108 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCFS--GVGSD-----VPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            RV  VAP   CFS  GVGS      VP+++ VLQS  V WR+   NSMV V D V+CLGF
Sbjct  316  RVAAVAPFGACFSTEGVGSTRLGPAVPEIDLVLQSNDVVWRIFGANSMVSVRDDVICLGF  375

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            +DGG+    S+VIGGYQLEDN+++F+L  S LGF+S + G  T+C++F
Sbjct  376  VDGGVNPRTSIVIGGYQLEDNVVQFDLAASRLGFSSTLLGRRTNCANF  423



>gb|AAX81588.1| nectarin IV [Nicotiana langsdorffii x Nicotiana sanderae]
Length=437

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 75/112 (67%), Gaps = 12/112 (11%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            + ++RV  VAP   CF       + VG  VP+++ VLQ+E V W +   NSMV+V + V+
Sbjct  320  VNITRVASVAPFGACFDSRTIVSTRVGPAVPQIDLVLQNENVFWTIFGANSMVQVSENVL  379

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            CLGF+DGG+    S+VIGGY +EDNLL+F+L +S LGFTS  L   T+C++F
Sbjct  380  CLGFVDGGINPRTSIVIGGYTIEDNLLQFDLASSRLGFTSSILFRQTTCANF  431



>ref|XP_009595035.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=436

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 73/111 (66%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             ++RV  VAP E CFS        VG  VP ++ VLQS+ V WR+   NSMV+V   V+C
Sbjct  320  NVTRVTAVAPFETCFSSKNIVSAKVGQAVPAIDLVLQSKQVYWRIFGSNSMVEVSQDVIC  379

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LG ++GG+    S+VIGG+QLEDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  380  LGIVNGGIKPTTSIVIGGHQLEDNLLQFDLPRSTLGFSSSLLFRQTTCANF  430



>ref|XP_010474940.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=432

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 76/115 (66%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  ++RV  V P   CF       + VG  VP+++ VL S+ V WR+   NSMV V D
Sbjct  312  AAARNMTRVASVKPFGACFRTENVGVTRVGYAVPEIQLVLHSKDVVWRIFGANSMVSVRD  371

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L T+  GF+S + G  T+C++F
Sbjct  372  DVICLGFVDGGVDAKTSVVIGGFQLEDNLVEFDLATNRFGFSSTLLGRSTNCANF  426



>ref|XP_006296506.1| hypothetical protein CARUB_v10025694mg [Capsella rubella]
 gb|EOA29404.1| hypothetical protein CARUB_v10025694mg [Capsella rubella]
Length=437

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 76/115 (66%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  ++RV  V P   CFS        VG  VP+++ VL S+ V WR+   NSMV V D
Sbjct  317  AAARNITRVASVKPFGACFSTQNVGVTRVGYAVPEIQLVLHSKDVVWRIFGGNSMVSVRD  376

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  377  DVICLGFVDGGVNARTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  431



>ref|XP_008222987.1| PREDICTED: basic 7S globulin-like [Prunus mume]
Length=438

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF       + VG  VP ++ VLQSE V WR+   NSMV V D V+CL
Sbjct  323  IPRVKAVAPFGACFDSKNIGSTRVGPAVPAIDLVLQSESVYWRVFGANSMVAVSDDVLCL  382

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGG     S+VIGG+QLEDNLL+F+L  S LGF+S    + T+C++F
Sbjct  383  GFVDGGERPRTSIVIGGHQLEDNLLQFDLAASRLGFSSSLFFSRTTCANF  432



>ref|XP_006304586.1| hypothetical protein CARUB_v10011636mg [Capsella rubella]
 gb|EOA37484.1| hypothetical protein CARUB_v10011636mg [Capsella rubella]
Length=434

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 76/115 (66%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  ++RV  V P   CFS        VG  VP+++ VL S+ V WR+   NSMV V D
Sbjct  314  AAARNITRVASVKPFGACFSTQNIGVTRVGYAVPEIQLVLHSKDVVWRIFGANSMVSVRD  373

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  374  DVICLGFVDGGVNARTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  428



>ref|XP_010457326.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 76/115 (66%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  ++RV  V P   CFS        VG  VP+++ VL S+ V WR+   NSMV V D
Sbjct  313  AAARNMTRVASVKPFGACFSTKNVGVTRVGYAVPEIQLVLHSKDVVWRIFGANSMVSVRD  372

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  373  DVICLGFVDGGVNAKTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  427



>ref|XP_010278299.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=426

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 76/124 (61%), Gaps = 12/124 (10%)
 Frame = -1

Query  582  ASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  433
            A+  ++RV  V P  VCFS         G  VP ++ VLQSEMV WR+   NSMV+V + 
Sbjct  303  AAFNMTRVASVGPFGVCFSSESVDITRTGPSVPTIDLVLQSEMVYWRISGANSMVQVSED  362

Query  432  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSME  259
            VMCLGFLDGG     S+V+GG+QLE+NL+  ++G S LGF+S  L    +CS F    + 
Sbjct  363  VMCLGFLDGGPNARTSIVVGGFQLENNLVLLDVGASRLGFSSSLLTRQMTCSDFNLRPIR  422

Query  258  RDSA  247
            R S+
Sbjct  423  RVSS  426



>dbj|BAK57511.1| extracellular dermal glycoprotein [Nicotiana benthamiana]
Length=440

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 74/112 (66%), Gaps = 12/112 (11%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            + ++RV  VAP   CF       + VG  VP ++ VLQ+E V W +   NSMV+V + V+
Sbjct  323  VNITRVASVAPFGACFDSRNIVSTRVGPTVPPIDLVLQNENVFWTIFGANSMVQVSENVL  382

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            CLGF+DGG+    S+VIGGY +EDNLL+F+L +S LGFTS  L   T+C++F
Sbjct  383  CLGFVDGGVNPRTSIVIGGYTIEDNLLQFDLASSRLGFTSSILFRQTTCANF  434



>gb|KEH36784.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=430

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 73/108 (68%), Gaps = 12/108 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            +V PV P ++CF       + VG  VP ++FVLQ++ V WRM   NSMV+V  GV CL F
Sbjct  317  KVKPVKPFKLCFNLQNLGVTRVGPAVPTIDFVLQNKDVFWRMFGANSMVQVSYGVYCLAF  376

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            +DGG+    S+VIGG+QLEDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  377  VDGGVEVTTSIVIGGHQLEDNLLQFDLHNSRLGFSSSLLSRQTTCANF  424



>ref|XP_006419829.1| hypothetical protein CICLE_v100071811mg, partial [Citrus clementina]
 gb|ESR33069.1| hypothetical protein CICLE_v100071811mg, partial [Citrus clementina]
Length=327

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSGV-------GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV PV+P   CF+         G  VP+++ VLQS    W +   NSMV+V   V+CL
Sbjct  212  VPRVKPVSPFGACFNSTHIGRTRAGPAVPQIDLVLQSSKAVWSIFGANSMVQVKRDVLCL  271

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGG+    S+VIGG+QLEDNLL+F+LGT+ LGF+S  L   T+CS+F
Sbjct  272  GFVDGGVHPRTSIVIGGHQLEDNLLQFDLGTARLGFSSSLLFRQTTCSNF  321



>ref|XP_010045855.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=376

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 12/107 (11%)
 Frame = -1

Query  561  VDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFL  412
            V PVAP  VCF       +  G DVP ++ VLQSEMV+WR+   +SMV+V D   CLG +
Sbjct  258  VPPVAPFGVCFDPRSVGATAAGPDVPAIDLVLQSEMVRWRIGGSSSMVRVSDEATCLGVV  317

Query  411  DGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGT--SCSHF  277
            DGG   G+SVV+GG+QLED LLEF+ G S LGF+  ++    SCS+F
Sbjct  318  DGGDRLGSSVVLGGHQLEDVLLEFDFGGSRLGFSPSLSTMQLSCSNF  364



>ref|XP_010481702.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=438

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 77/116 (66%), Gaps = 12/116 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  ++RV  V P   CFS        VG  VP+++ VL S+ V WR+   NSMV V D
Sbjct  318  AAARNITRVASVKPFGACFSTKNVGVTRVGYAVPEIQLVLHSKDVVWRIFGANSMVSVRD  377

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHFT  274
             V+CLGF+DGG+    SV+IGG+QLEDNL+EF+L ++  GF+S + G  T+C++F+
Sbjct  378  DVICLGFVDGGVNAKTSVMIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANFS  433



>emb|CDY37437.1| BnaC08g45750D [Brassica napus]
Length=118

 Score = 96.3 bits (238),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 70/112 (63%), Gaps = 12/112 (11%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRMN---SMVKVGDGVM  427
            M ++RV  V P   CFS        VG  VP ++ VL S  V WR+N   SMV V   V+
Sbjct  1    MNITRVPSVKPFGACFSTKNVFGTRVGYAVPNIQLVLHSSDVVWRINGANSMVSVSRDVI  60

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            CLGF+DGG+    SVVIGG QLEDNL+EF+L ++ L F+S + G  T+C++F
Sbjct  61   CLGFVDGGVNARTSVVIGGLQLEDNLIEFDLASNRLSFSSTLLGLRTNCANF  112



>ref|XP_007144622.1| hypothetical protein PHAVU_007G170900g [Phaseolus vulgaris]
 gb|ESW16616.1| hypothetical protein PHAVU_007G170900g [Phaseolus vulgaris]
Length=435

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 81/116 (70%), Gaps = 14/116 (12%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            +A+  ++RV  VAP EVCFS        +G+ VP +E +LQ++ + WR+   NS+V V D
Sbjct  315  SAARNITRVAGVAPFEVCFSSENVLATRLGASVPTIELLLQNQKI-WRIFGANSVVSVND  373

Query  435  G-VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
              ++CLGF++GG     S+VIGGYQLE+NLL+F+L TS LGF+SL+ G  T+C++F
Sbjct  374  DEILCLGFVNGGEKLRTSIVIGGYQLENNLLQFDLATSRLGFSSLLFGSRTTCANF  429



>ref|XP_008390829.1| PREDICTED: basic 7S globulin-like [Malus domestica]
Length=438

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 72/111 (65%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             + RV  VAP   CF+        VG  VP+++ VLQSE V WR+   NSMV+V D V+C
Sbjct  322  NIPRVKAVAPFGACFNSKNIGSTRVGPAVPQIDLVLQSESVYWRIFGANSMVQVSDDVLC  381

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGG     S+VIGG+QLEDNL++ +L  S LGF+S  L   T+C++F
Sbjct  382  LGFVDGGERPRTSIVIGGHQLEDNLVQIDLAASKLGFSSSLLFRQTTCANF  432



>ref|XP_006489309.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=435

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSGV-------GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV PV+P   CF+         G  VP+++ VLQS    W +   NSMV+V   V+CL
Sbjct  320  VPRVKPVSPFGACFNSTHIGRTRAGPAVPQIDLVLQSSKAVWSIFGANSMVQVKRDVLCL  379

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGG+    S+VIGG+QLEDNLL+F+LGT+ LGF+S  L   T+CS+F
Sbjct  380  GFVDGGVHPRTSIVIGGHQLEDNLLQFDLGTARLGFSSSLLFRQTTCSNF  429



>ref|XP_010278291.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=470

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 78/115 (68%), Gaps = 13/115 (11%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A SMG++RV  VAP   CFS        +G++VP ++ VLQ + V WR+   N+MV V +
Sbjct  350  AISMGITRVGAVAPFGACFSSESIRGSRMGAEVPSIDLVLQGQSV-WRIFGKNAMVDVRE  408

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLM--AGTSCSHF  277
            GV+CLGFLDGG     S+V+GG+QLED LL+F+L TS LGF+ L+    TSC++F
Sbjct  409  GVLCLGFLDGGRNPRTSIVLGGHQLEDILLQFDLKTSKLGFSPLLHYRQTSCANF  463



>ref|XP_004134154.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 ref|XP_004170543.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57020.1| Xyloglucan-specific endoglucanase inhibitor protein [Cucumis 
sativus]
Length=435

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP EVC+S        +G+ VP ++ VLQ++ V W M   NSMV+V D V+CL
Sbjct  320  VPRVGAVAPFEVCYSSKSFPSTRLGAGVPTIDLVLQNKKVIWSMFGANSMVQVNDEVLCL  379

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            GF+DGG+    ++VIG +Q+ED LLEF+L TS LGFT  + G  T+C++F
Sbjct  380  GFVDGGVDVRTAIVIGAHQIEDKLLEFDLATSRLGFTPTLLGRMTTCANF  429



>gb|KCW84284.1| hypothetical protein EUGRSUZ_B01136 [Eucalyptus grandis]
Length=403

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 12/107 (11%)
 Frame = -1

Query  561  VDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFL  412
            V PVAP  VCF       +  G DVP ++ VLQSEMV+WR+   +SMV+V D   CLG +
Sbjct  285  VPPVAPFGVCFDPRSVGATAAGPDVPAIDLVLQSEMVRWRIGGSSSMVRVSDEATCLGVV  344

Query  411  DGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGT--SCSHF  277
            DGG   G+SVV+GG+QLED LLEF+ G S LGF+  ++    SCS+F
Sbjct  345  DGGDRLGSSVVLGGHQLEDVLLEFDFGGSRLGFSPSLSTMQLSCSNF  391



>ref|XP_002877156.1| hypothetical protein ARALYDRAFT_484681 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53415.1| hypothetical protein ARALYDRAFT_484681 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 74/115 (64%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A +  ++RV  V P   CFS        +G  VP+++ VL S  V WR+   NSMV V D
Sbjct  300  ATARNMTRVASVKPFSACFSTQNVGVTRLGYAVPEIQLVLHSNDVVWRIFGGNSMVSVSD  359

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  360  DVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNRFGFSSTLLGRQTNCANF  414



>gb|KDO74795.1| hypothetical protein CISIN_1g037976mg [Citrus sinensis]
Length=435

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSGV-------GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV PV+P   CF+         G  VP+++ VLQS    W +   NSMV+V   V+CL
Sbjct  320  VPRVKPVSPFGACFNSTHIGRTRAGPAVPQIDLVLQSSKAVWSIFGANSMVQVKRDVLCL  379

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGG+    S+VIGG+QLEDNLL+F+LGT+ LGF+S  L   T+CS+F
Sbjct  380  GFVDGGVHPRTSIVIGGHQLEDNLLQFDLGTARLGFSSSLLFRQTTCSNF  429



>ref|XP_007034628.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05554.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=381

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 73/110 (66%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF+        +G  VP+++ VLQS+ V WR+   NSMV+V + V+CL
Sbjct  266  IPRVPAVAPLRACFNAKSFASTRLGPAVPQIDLVLQSKDVIWRIVGANSMVEVSNDVLCL  325

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGGL    S+VIGG Q+E+NLL+F+L T  LGF+S  L   T+CS+F
Sbjct  326  GFVDGGLKPTTSIVIGGRQIENNLLQFDLATLRLGFSSSLLFQQTTCSNF  375



>ref|XP_010483190.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  ++RV  V P   CFS        +G  VP+++ VL S  V WR+   NSMV V D
Sbjct  313  AAARNITRVASVKPFGACFSTKNVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVRD  372

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  373  DVICLGFVDGGVNARTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  427



>gb|KCW49915.1| hypothetical protein EUGRSUZ_K03382 [Eucalyptus grandis]
Length=422

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 74/115 (64%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A S+ ++RV  V+P E CF+        VG+ VP +  VLQ E   W +   NSMV+V  
Sbjct  302  ATSINITRVSAVSPFEYCFNSSSIGVTRVGAAVPYIFLVLQGEEAVWTITGSNSMVEVSQ  361

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG     S+VIGGYQL+DNL++F+L  S LGF+S + G  T+C++F
Sbjct  362  DVLCLGFVDGGSRPRTSIVIGGYQLQDNLVQFDLARSRLGFSSTLLGRRTTCANF  416



>ref|XP_010475063.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=434

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  ++RV  V P   CFS        +G  VP+++ VL S  V WR+   NSMV V D
Sbjct  314  AAARNITRVASVKPFGACFSTQNVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVRD  373

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  374  DVICLGFVDGGVNARTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  428



>ref|XP_010457449.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA+  ++RV  V P   CFS        +G  VP+++ VL S  V WR+   NSMV V D
Sbjct  313  AAARNITRVASVKPFGACFSTENVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVRD  372

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  373  DVICLGFVDGGVNARTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  427



>ref|XP_009118711.1| PREDICTED: basic 7S globulin-like [Brassica rapa]
Length=432

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 73/115 (63%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRMN---SMVKVGD  436
            AA+M ++RV  V P   CFS        VG  VP ++ VL S  V WR+N   SMV V  
Sbjct  312  AAAMNITRVPSVKPFGACFSTKNVFGTRVGYSVPAIQLVLHSNDVVWRINGANSMVSVSR  371

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG QLEDNL+EF+L ++ L F+S + G  T+C++F
Sbjct  372  DVICLGFVDGGVNARTSVVIGGLQLEDNLIEFDLASNRLSFSSTLLGLRTNCANF  426



>emb|CDY32500.1| BnaA09g50960D [Brassica napus]
Length=434

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 73/115 (63%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRMN---SMVKVGD  436
            AA+M ++RV  V P   CFS        VG  VP ++ VL S  V WR+N   SMV V  
Sbjct  314  AAAMNITRVPSVKPFGACFSTKNVFGTRVGYSVPAIQLVLHSNDVVWRINGANSMVSVSR  373

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG QLEDNL+EF+L ++ L F+S + G  T+C++F
Sbjct  374  DVICLGFVDGGVNARTSVVIGGLQLEDNLIEFDLASNRLSFSSTLLGLRTNCANF  428



>ref|XP_010522709.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=418

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 74/108 (69%), Gaps = 12/108 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            RV  VAP   CFS        +G+ VP+++ VLQS  V W++   NSMV V D V+CLGF
Sbjct  305  RVAAVAPFGACFSTEGVASTRLGAAVPEIDLVLQSSDVVWKIFGANSMVSVSDNVICLGF  364

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            +DGG+   +S+VIGG+QLEDNL++F+L  S LGF+S + G  T+C++F
Sbjct  365  VDGGVNPMSSIVIGGHQLEDNLVQFDLAASRLGFSSTLLGSRTNCANF  412



>gb|AAM61574.1| EDGP precursor [Arabidopsis thaliana]
Length=433

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 74/115 (64%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A +  + RV  V P   CFS        +G  VP++E VL S+ V WR+   NSMV V D
Sbjct  313  ALARSIKRVASVKPFGACFSTKNVGVTRLGYAVPEIELVLHSKDVVWRIFGANSMVSVSD  372

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  373  DVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNRFGFSSTLLGRQTNCANF  427



>gb|KCW49914.1| hypothetical protein EUGRSUZ_K03381, partial [Eucalyptus grandis]
Length=413

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 72/113 (64%), Gaps = 12/113 (11%)
 Frame = -1

Query  579  SMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGV  430
            +M ++R   V+P E CFS        VG  VP +  VLQS+ V W +   NSMV+V   V
Sbjct  295  AMNITRASAVSPFEYCFSSANILSTRVGPAVPYIYLVLQSDQVVWTITGSNSMVQVSQDV  354

Query  429  MCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            +CLGF+DGG     SVVIGGYQL+DNL++ +L  S LGF+S + G  T+C++F
Sbjct  355  LCLGFVDGGSSPRTSVVIGGYQLQDNLVQIDLARSRLGFSSTLLGRQTTCANF  407



>ref|XP_010038106.1| PREDICTED: basic 7S globulin 2-like [Eucalyptus grandis]
Length=438

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 72/113 (64%), Gaps = 12/113 (11%)
 Frame = -1

Query  579  SMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGV  430
            +M ++R   V+P E CFS        VG  VP +  VLQS+ V W +   NSMV+V   V
Sbjct  320  AMNITRASAVSPFEYCFSSANILSTRVGPAVPYIYLVLQSDQVVWTITGSNSMVQVSQDV  379

Query  429  MCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            +CLGF+DGG     SVVIGGYQL+DNL++ +L  S LGF+S + G  T+C++F
Sbjct  380  LCLGFVDGGSSPRTSVVIGGYQLQDNLVQIDLARSRLGFSSTLLGRQTTCANF  432



>ref|XP_010678844.1| PREDICTED: basic 7S globulin 2-like [Beta vulgaris subsp. vulgaris]
Length=432

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 75/124 (60%), Gaps = 21/124 (17%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG--------VGSDVPKVEFVL--------QSEMVKWRM--  460
            A +M ++RV PVAP   CF+          G +VP ++ +L             +WR+  
Sbjct  306  ATAMKMTRVAPVAPFGACFNAKSVVNSAKTGFNVPVIDMILDGKSSLLHNKNNARWRIYG  365

Query  459  -NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTS  289
             NSMVKV D V+CLGF+DGGL    S+VIGG Q+EDNL+EF+L ++ LG TS  L  GTS
Sbjct  366  ANSMVKVSDDVLCLGFVDGGLESRTSIVIGGKQMEDNLVEFDLESNKLGITSSLLRMGTS  425

Query  288  CSHF  277
            CS+F
Sbjct  426  CSNF  429



>ref|XP_010038107.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Eucalyptus 
grandis]
Length=437

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 74/115 (64%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A S+ ++RV  V+P E CF+        VG+ VP +  VLQ E   W +   NSMV+V  
Sbjct  317  ATSINITRVSAVSPFEYCFNSSSIGVTRVGAAVPYIFLVLQGEEAVWTITGSNSMVEVSQ  376

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG     S+VIGGYQL+DNL++F+L  S LGF+S + G  T+C++F
Sbjct  377  DVLCLGFVDGGSRPRTSIVIGGYQLQDNLVQFDLARSRLGFSSTLLGRRTTCANF  431



>ref|XP_010086743.1| Basic 7S globulin [Morus notabilis]
 gb|EXB23278.1| Basic 7S globulin [Morus notabilis]
Length=431

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 72/116 (62%), Gaps = 13/116 (11%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A  + + RV PVAP   CF       + +G  VP V+  L  +  +WR+   NSM++   
Sbjct  307  ANQLKIPRVQPVAPFGACFDAKGIASTRIGPAVPPVDLSLHDQSTRWRILGANSMIEARP  366

Query  435  GVMCLGFLDGGL-GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GVMCL F+DGG    G+S+VIG YQLEDNL++F+L  SMLGF+S  L   TSCS+F
Sbjct  367  GVMCLAFVDGGARPHGSSMVIGAYQLEDNLVQFDLVKSMLGFSSSLLFRRTSCSNF  422



>gb|KDO74796.1| hypothetical protein CISIN_1g038219mg [Citrus sinensis]
Length=435

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 66/109 (61%), Gaps = 8/109 (7%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCFSGV---GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
              + RV P+AP   CF+     G+  P++  VL      W++   NSMV+VG   MCL F
Sbjct  324  FNIPRVKPIAPFGACFNSSFIGGTTAPEIHLVLPGNNRVWKIYGANSMVRVGKDAMCLAF  383

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  274
            +DGG+    SVVIGGYQLEDNLLEFNL  S LGF+S  L   T+CS  T
Sbjct  384  VDGGVNPRTSVVIGGYQLEDNLLEFNLAKSRLGFSSSLLSWQTTCSKLT  432



>ref|XP_007034627.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05553.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=456

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 72/111 (65%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             +S+V  VAP   CF+         G  VP ++ VLQS++V WR+   NSMV V + V+C
Sbjct  337  NVSQVAAVAPLGACFNSNSIEKTRAGPAVPPIDLVLQSDLVYWRVFGANSMVHVSENVLC  396

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LG +DGG     S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  397  LGAVDGGSNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRQTTCSNF  447



>ref|XP_006419827.1| hypothetical protein CICLE_v10005000mg [Citrus clementina]
 ref|XP_006489579.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
 gb|ESR33067.1| hypothetical protein CICLE_v10005000mg [Citrus clementina]
Length=435

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 66/109 (61%), Gaps = 8/109 (7%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCFSGV---GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
              + RV P+AP   CF+     G+  P++  VL      W++   NSMV+VG   MCL F
Sbjct  324  FNIPRVKPIAPFGACFNSSFIGGTTAPEIHLVLPGNNRVWKIYGANSMVRVGKDAMCLAF  383

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  274
            +DGG+    SVVIGGYQLEDNLLEFNL  S LGF+S  L   T+CS  T
Sbjct  384  VDGGVNPRTSVVIGGYQLEDNLLEFNLAKSRLGFSSSLLSWQTTCSKLT  432



>ref|XP_009342159.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin [Pyrus x bretschneideri]
Length=440

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 69/111 (62%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             + RV PV P   CFS        VG  VP+++ VLQSE V W M   NSMV V + V+C
Sbjct  324  NIPRVKPVMPFGACFSSKNIDVTRVGPAVPQIDLVLQSENVYWTMFGANSMVYVSNDVLC  383

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGG      +VIGG  LEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  384  LGFVDGGERPMTXIVIGGNXLEDNLLQFDLATSKLGFSSSLLFRRTTCANF  434



>ref|XP_009356759.1| PREDICTED: basic 7S globulin [Pyrus x bretschneideri]
Length=439

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 72/115 (63%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A +M +++     P EVCFS        VG  VP ++FV Q+    WR+   NSMV+V D
Sbjct  319  AKAMNITQTGATGPFEVCFSTENVLSTRVGPSVPSIDFVFQNNSTFWRVFGANSMVQVND  378

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CLG ++GG     S+VIGG QLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  379  NVLCLGIVNGGENPRTSIVIGGLQLENNLLQFDLATSRLGFSSSLLFTQTTCANF  433



>ref|XP_008438715.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=436

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 75/110 (68%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP  VC+       + +G  +P ++ +LQ++ V WR+   NSMV+V D V+CL
Sbjct  321  IPRVAAVAPFGVCYKSKSFGSTRLGPGMPSIDLILQNKKVIWRIFGANSMVQVNDDVLCL  380

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            GF+DGG+    ++VIG +Q+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  381  GFVDGGVEARTAIVIGAHQMEDNLLEFDLATSRLGFSSTLLGRMTTCANF  430



>ref|XP_008438718.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=436

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 74/110 (67%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP EVC++        +G+ VP ++ VLQ++ V W +   NSMV+V D V+CL
Sbjct  320  VPRVAAVAPFEVCYNSKSFPSTRLGAGVPTIDLVLQNKKVIWSIFGANSMVQVNDDVLCL  379

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            GF+DGG+    ++VIG +Q+ED LLEF+L TS LGFT  + G  T+C++F
Sbjct  380  GFVDGGVDVRTAIVIGAHQIEDKLLEFDLATSRLGFTPTLLGRMTTCANF  429



>ref|XP_004134153.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57018.1| hypothetical protein Csa_3G149980 [Cucumis sativus]
Length=432

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 75/110 (68%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP  VC+       + +G  +P ++ +LQ++ V WR+   NSMV+V + V+CL
Sbjct  317  IPRVAAVAPFGVCYKSKSFGSTRLGPGMPSIDLILQNKKVIWRIFGANSMVQVNEEVLCL  376

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            GF+DGG+    ++VIG YQ+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  377  GFVDGGVEARTAIVIGAYQMEDNLLEFDLATSRLGFSSTLLGRMTTCANF  426



>ref|XP_004170542.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Cucumis 
sativus]
Length=432

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 75/110 (68%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP  VC+       + +G  +P ++ +LQ++ V WR+   NSMV+V + V+CL
Sbjct  317  IPRVAAVAPFGVCYKSKSFGSTRLGPGMPSIDLILQNKKVIWRIFGANSMVQVNEEVLCL  376

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            GF+DGG+    ++VIG YQ+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  377  GFVDGGVEARTAIVIGAYQMEDNLLEFDLATSRLGFSSTLLGRMTTCANF  426



>ref|XP_009611839.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=438

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 74/112 (66%), Gaps = 12/112 (11%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            + ++RV  VAP   CF       + VG  VP ++ VLQ+E V WR+   NSMV+V + V+
Sbjct  321  VNITRVASVAPFGACFDSRNIVSTRVGPAVPSIDLVLQNENVFWRIFGANSMVQVSENVL  380

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            CLGF+DGG+    S+VIGGY +E+NLL+F+L  S LGFTS  L   T+C++F
Sbjct  381  CLGFVDGGVNPRTSIVIGGYTIENNLLQFDLAGSRLGFTSSILSRLTTCANF  432



>gb|AIL30493.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Nicotiana tabacum]
Length=437

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 74/112 (66%), Gaps = 12/112 (11%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            + ++RV  VAP   CF       + VG  VP ++ VLQ+E V WR+   NSMV+V + V+
Sbjct  320  VNITRVASVAPFGACFDSRNIVSTRVGPAVPSIDLVLQNENVFWRIFGANSMVQVSENVL  379

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            CLGF+DGG+    S+VIGGY +E+NLL+F+L  S LGFTS  L   T+C++F
Sbjct  380  CLGFVDGGVNPRTSIVIGGYTIENNLLQFDLAGSRLGFTSSILSRLTTCANF  431



>ref|XP_009596039.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=440

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 71/107 (66%), Gaps = 8/107 (7%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG---VGSDVPKVEFVLQSEMVKW---RMNSMVKVGDGVMCLGFL  412
            G+SRV+P++P  +CF+      ++VP ++FV+Q+  V W   R NSMV+   GV CL F+
Sbjct  320  GVSRVNPISPFGLCFNSNNLTSTNVPNIDFVMQNRNVTWTITRANSMVQARPGVSCLAFV  379

Query  411  DGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            DGG  +   +VIG +QLEDN ++F+L  S LGF+S  L   TSCS+F
Sbjct  380  DGGENRKNPIVIGVHQLEDNFVQFDLVKSRLGFSSSLLSRNTSCSNF  426



>gb|KJB25917.1| hypothetical protein B456_004G215700 [Gossypium raimondii]
Length=442

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 80/126 (63%), Gaps = 17/126 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV--  442
            ++++ L+  D V P  VC+S        VG  VP V+FV+QS+ V WR+   NSMV++  
Sbjct  318  SSALNLTVTDTVKPFGVCYSAADITVTRVGPGVPTVDFVMQSDNVFWRVFGSNSMVRITR  377

Query  441  --GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  274
              G  V CLGF+DGG+    SVVIGG Q+ DNLL+F+L  S LGFTS  L+ GT+CS+F 
Sbjct  378  DGGGDVWCLGFVDGGVNPRTSVVIGGQQMVDNLLQFDLDNSRLGFTSSVLLKGTTCSNF-  436

Query  273  RFSMER  256
             F+  R
Sbjct  437  NFASTR  442



>ref|XP_010556788.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=464

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 73/108 (68%), Gaps = 12/108 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCFS--GVGSD-----VPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            RV  VAP   CFS  GVGS      VP ++ VLQ++ V W +   NS+V VG+ VMCLGF
Sbjct  351  RVKAVAPFGACFSSKGVGSTRLGPAVPAIDLVLQNKDVVWSIFGANSVVSVGNDVMCLGF  410

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            +DGG+    S+VIGGYQLEDNL++ +L  S LGF+S + G  T+C++F
Sbjct  411  VDGGVNPRTSIVIGGYQLEDNLIQLDLAASKLGFSSTLLGRRTTCANF  458



>ref|XP_002517164.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45327.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=433

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF         +G+ VP ++ VLQS  V WR+   NSMV+V + V+CL
Sbjct  318  VPRVASVAPFGACFDASKIVGTRLGAAVPSIDLVLQSSNVFWRIVGANSMVQVNEDVLCL  377

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLM--AGTSCSHF  277
            GF+DGG     S+VIGG+QLEDNLL+F+L TS LGF+S +    T+C++F
Sbjct  378  GFVDGGENPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLFSRQTTCANF  427



>ref|XP_006472113.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=273

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 69/106 (65%), Gaps = 12/106 (11%)
 Frame = -1

Query  558  DPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLD  409
             PVAP  VC+       +  G  VP ++FVLQ++ VKW +   NSMV+   GV CL F+D
Sbjct  162  KPVAPFSVCYDSRKLKSTRAGPGVPNIDFVLQNQNVKWTITGANSMVEARRGVTCLAFVD  221

Query  408  GGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GG+   AS++IG +QL+DNL++F+L  S LGF+S  L   TSCS+F
Sbjct  222  GGVRPRASIIIGSHQLQDNLVQFDLAGSRLGFSSSLLFRRTSCSNF  267



>gb|ACM68432.1| xyloglucanase-specific endoglucanase inhibitor protein [Petunia 
x hybrida]
Length=436

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 12/112 (11%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            + +  V  VAP  VCF       + VG  VP ++ VLQ+E V WR+   NSMV V + V+
Sbjct  319  LAIPTVPSVAPFGVCFDSRNITSTRVGPGVPSIDLVLQNENVFWRIFGANSMVLVSENVL  378

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            CLGF+DGG+    S+VIGG+ +EDNLL+F+L  S LGFTS  L   T+C++F
Sbjct  379  CLGFVDGGVNPRTSIVIGGHTIEDNLLQFDLAASRLGFTSSILFRQTTCANF  430



>dbj|BAA03413.1| EDGP precursor [Daucus carota]
Length=433

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            +A+  ++RV  VAP   CFS        +G  VP ++ VLQSE V W +   NSMV + D
Sbjct  315  SAARNITRVASVAPFGACFSTDNILSTRLGPSVPSIDLVLQSESVVWTITGSNSMVYIND  374

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLG +DGG     S+VIGG+QLEDNL++F+L TS +GF+  + G  T+C++F
Sbjct  375  NVVCLGVVDGGSNLRTSIVIGGHQLEDNLVQFDLATSRVGFSGTLLGSRTTCANF  429



>pdb|3VLB|A Chain A, Crystal Structure Of Xeg-edgp
 pdb|3VLB|C Chain C, Crystal Structure Of Xeg-edgp
Length=413

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            +A+  ++RV  VAP   CFS        +G  VP ++ VLQSE V W +   NSMV + D
Sbjct  295  SAARNITRVASVAPFGACFSTDNILSTRLGPSVPSIDLVLQSESVVWTITGSNSMVYIND  354

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLG +DGG     S+VIGG+QLEDNL++F+L TS +GF+  + G  T+C++F
Sbjct  355  NVVCLGVVDGGSNLRTSIVIGGHQLEDNLVQFDLATSRVGFSGTLLGSRTTCANF  409



>ref|XP_007050654.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOX94811.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=441

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 80/118 (68%), Gaps = 15/118 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-G  439
            ++++ L+  + V P  VC+S        VG  VP V+ V+QS+ V WR+   NSMV++ G
Sbjct  316  SSALNLTVTNAVKPFSVCYSAADIIVTRVGPGVPTVDLVMQSDDVFWRVFGSNSMVQIAG  375

Query  438  DG--VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            DG  V CLGF+DGG+    SVVIGG+Q+EDNLL+F+L ++ LGFTS  L+ GT+C+ F
Sbjct  376  DGGDVWCLGFVDGGVNPRTSVVIGGHQMEDNLLQFDLDSNRLGFTSSVLLKGTTCADF  433



>pdb|3VLA|A Chain A, Crystal Structure Of Edgp
Length=413

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            +A+  ++RV  VAP   CFS        +G  VP ++ VLQSE V W +   NSMV + D
Sbjct  295  SAARNITRVASVAPFGACFSTDNILSTRLGPSVPSIDLVLQSESVVWTITGSNSMVYIND  354

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLG +DGG     S+VIGG+QLEDNL++F+L TS +GF+  + G  T+C++F
Sbjct  355  NVVCLGVVDGGSNLRTSIVIGGHQLEDNLVQFDLATSRVGFSGTLLGSRTTCANF  409



>gb|KCW84282.1| hypothetical protein EUGRSUZ_B01133 [Eucalyptus grandis]
Length=437

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 71/113 (63%), Gaps = 12/113 (11%)
 Frame = -1

Query  579  SMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGV  430
            + G++RV  V P + C S        VG  VP ++  L  + V WR+   NSMV++ D V
Sbjct  319  TKGVTRVPSVKPFQYCISSKNLGSTRVGPPVPTIDLGLHHKSVSWRIFGANSMVQLKDDV  378

Query  429  MCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            +CLGF+DGGL    SVVIGG+QLEDNLL+F+L    LGFTS  L   T+C++F
Sbjct  379  LCLGFVDGGLNPRTSVVIGGHQLEDNLLQFDLVKRRLGFTSSLLYMQTTCTNF  431



>ref|XP_007030900.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY11402.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=424

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 70/111 (63%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
            G+ +V PV P  VCF       +  G  VP ++ VL ++ V WR+   NSMV+   GV C
Sbjct  308  GIPQVKPVKPFGVCFGSKSFKSTRFGPGVPNIDLVLHNQHVTWRIFGANSMVQAAPGVSC  367

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            L F+DGG+   AS+VIG YQ+E+NL++F+L  S LGF+S  L   TSC++F
Sbjct  368  LAFVDGGVNTRASIVIGAYQMENNLVQFDLARSRLGFSSSLLHFKTSCNNF  418



>ref|XP_010045852.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=456

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 71/113 (63%), Gaps = 12/113 (11%)
 Frame = -1

Query  579  SMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGV  430
            + G++RV  V P + C S        VG  VP ++  L  + V WR+   NSMV++ D V
Sbjct  338  TKGVTRVPSVKPFQYCISSKNLGSTRVGPPVPTIDLGLHHKSVSWRIFGANSMVQLKDDV  397

Query  429  MCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            +CLGF+DGGL    SVVIGG+QLEDNLL+F+L    LGFTS  L   T+C++F
Sbjct  398  LCLGFVDGGLNPRTSVVIGGHQLEDNLLQFDLVKRRLGFTSSLLYMQTTCTNF  450



>ref|XP_006433276.1| hypothetical protein CICLE_v10003944mg [Citrus clementina]
 gb|ESR46516.1| hypothetical protein CICLE_v10003944mg [Citrus clementina]
Length=422

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 69/106 (65%), Gaps = 12/106 (11%)
 Frame = -1

Query  558  DPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLD  409
             PVAP  VC+       +  G  VP ++FVLQ++ VKW +   NSMV+   GV CL F+D
Sbjct  311  KPVAPFSVCYDSRKLKSTRAGPGVPNIDFVLQNQNVKWTITGANSMVEARRGVTCLAFVD  370

Query  408  GGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GG+   AS++IG +QL+DNL++F+L  S LGF+S  L   TSCS+F
Sbjct  371  GGVRPRASIIIGSHQLQDNLVQFDLAGSRLGFSSSLLFRRTSCSNF  416



>gb|ABR17052.1| unknown [Picea sitchensis]
Length=422

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 75/116 (65%), Gaps = 13/116 (11%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF--SGVGSD-----VPKVEFVLQ-SEMVKWRM---NSMVKVG  439
            A  M ++RV  V+P   CF  SGVGS      VP ++ VLQ +    WR+   NSMV+V 
Sbjct  301  AKKMNITRVASVSPFGACFDSSGVGSTRVGPAVPTIDIVLQGNSTTTWRIFGANSMVRVN  360

Query  438  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            + V+CLGF+DGG     S+VIG YQ++DNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  361  NKVLCLGFVDGGDNLQQSIVIGTYQMQDNLLQFDLATSTLGFSSSLLFGQTTCSNF  416



>ref|XP_006495483.1| PREDICTED: basic 7S globulin-like, partial [Citrus sinensis]
Length=174

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 62/92 (67%), Gaps = 10/92 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            RVD V+P   CF       + VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF
Sbjct  83   RVDSVSPFGACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVKSNVMCLGF  142

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSML  319
            +DGG+    S+VIGG+QLEDNLL+F+L TS L
Sbjct  143  VDGGVNPRTSIVIGGHQLEDNLLQFDLATSRL  174



>ref|XP_004495218.1| PREDICTED: basic 7S globulin 2-like [Cicer arietinum]
Length=436

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 72/113 (64%), Gaps = 10/113 (9%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSGVG-----SDVPKVEFVLQSEMVKWRM---NSMVKVGDGV  430
            + +  L+RVD   P E C++ +G     + VP +E VLQ+E V W +   NSMV + D V
Sbjct  318  SVARNLTRVDSFHPFEFCYTNLGGTRLGAAVPTIELVLQNENVVWSIFGANSMVNINDEV  377

Query  429  MCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             CLGF++GG     S+VIGGYQL++NLL+F+L  S LGF+S + G  T C +F
Sbjct  378  SCLGFVNGGENVRTSIVIGGYQLDNNLLQFDLAASRLGFSSTLFGRQTGCYNF  430



>gb|AAP84703.1| putative xyloglucanase inhibitor [Solanum tuberosum]
Length=437

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 72/111 (65%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             ++RV  VAP +VCF       + VG  VP ++ VLQ+E V W +   NSMV+V + V+C
Sbjct  321  NVTRVAAVAPFKVCFDSRNIGSTRVGPAVPSIDLVLQNENVVWTIFGANSMVQVSENVLC  380

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LG LDGG+    S+VIGG+ +EDNLL+F+   S LGFTS  L   T+C++F
Sbjct  381  LGVLDGGVNSRTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFRQTTCANF  431



>ref|NP_001241217.1| uncharacterized protein LOC100818868 precursor [Glycine max]
 gb|ACU22861.1| unknown [Glycine max]
 gb|KHN03448.1| Basic 7S globulin [Glycine soja]
Length=450

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 75/119 (63%), Gaps = 17/119 (14%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AA   + RV  VAP   CF          G +VP ++ VL+   V+WR+   NSMVKV  
Sbjct  330  AALRKIKRVTSVAPFGACFDSRTIGKTVTGPNVPTIDLVLKGG-VQWRIYGANSMVKVSK  388

Query  435  GVMCLGFLDGGLGQGA----SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CLGF+DGGL  G+    S+VIGGYQ+EDNLLEF+L +S LGF+S  L+   SCSHF
Sbjct  389  NVLCLGFVDGGLEPGSPIATSIVIGGYQMEDNLLEFDLVSSKLGFSSSLLLHMASCSHF  447



>ref|XP_009769391.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=439

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 70/107 (65%), Gaps = 8/107 (7%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG---VGSDVPKVEFVLQSEMVKW---RMNSMVKVGDGVMCLGFL  412
            G+SRV+P++P  +CF+      ++VP ++FV+Q+  V W   R NSMV+   GV CL F+
Sbjct  320  GVSRVNPISPFGLCFNSNNLTSTNVPNIDFVMQNRNVTWTITRANSMVQARPGVSCLAFV  379

Query  411  DGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            DGG      +VIG +QLEDN ++F+L  S LGF+S  L   TSCS+F
Sbjct  380  DGGENPKNPIVIGVHQLEDNFVQFDLVRSRLGFSSSLLSRNTSCSNF  426



>gb|EMT02113.1| Basic 7S globulin [Aegilops tauschii]
Length=114

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP ++C+ G       VG  VP VE VLQSE   W +   NSMV    G +CL
Sbjct  2    IPRVRAVAPFKLCYDGSKVGSTRVGPAVPTVELVLQSEAASWVVFGANSMVAAKGGALCL  61

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            G +DGG     SVV+GG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  62   GVVDGGAAPRTSVVVGGHMMEDNLLEFDLQRSRLGFSSSLLFRQTTCNNF  111



>ref|XP_008355568.1| PREDICTED: basic 7S globulin-like [Malus domestica]
Length=439

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A +  +++     P EVCFS        VG  VP ++FV Q+    WR+   NSMV+V D
Sbjct  319  AKARNITQTGATGPFEVCFSTENVLSTRVGPSVPSIDFVFQNNSTFWRVFGANSMVQVND  378

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CLG ++GG     S+VIGG QLEDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  379  NVLCLGIVNGGENPRTSIVIGGLQLEDNLLQFDLAKSRLGFSSSLLFTQTTCANF  433



>ref|XP_009757289.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=437

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (63%), Gaps = 12/112 (11%)
 Frame = -1

Query  576  MGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            + ++RV  VAP   CF       + VG  VP ++ VLQ+E V W +   NSMV+V + V+
Sbjct  320  VNITRVASVAPFGACFDSRNIVSTRVGPAVPSIDLVLQNENVFWTIFGANSMVQVSENVL  379

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            CLGF+DGG+    S+VIGGY +EDNLL+F+L  S LGF S  L   T+C  F
Sbjct  380  CLGFVDGGVNTRTSIVIGGYTIEDNLLQFDLARSRLGFISSILFRQTTCPDF  431



>gb|KCW58886.1| hypothetical protein EUGRSUZ_H01512 [Eucalyptus grandis]
Length=351

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 75/118 (64%), Gaps = 15/118 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV--  442
            +A+  L+ + PV P  +C+S         G  VP ++ V+QSE V WR+   NSMV++  
Sbjct  226  SAAFNLTTIQPVKPFSLCYSARDVGVTRAGPAVPAIDLVMQSEEVFWRVFGANSMVRIQR  285

Query  441  -GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             G    CLG +DGG    A++VIGG+Q+EDNLL+F+LG+  LGF+S  L+ GT+C+ F
Sbjct  286  KGTDAWCLGLVDGGAEARAAIVIGGHQVEDNLLQFDLGSMRLGFSSSVLVRGTTCADF  343



>ref|XP_004508379.1| PREDICTED: basic 7S globulin-like [Cicer arietinum]
Length=448

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 74/117 (63%), Gaps = 17/117 (15%)
 Frame = -1

Query  570  LSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF       S  G +VP ++FVL+   V+WR    NSMVKVG  V+CL
Sbjct  333  IKRVKEVAPFGACFDSRTIGKSVTGPNVPTIDFVLKGG-VEWRFYGANSMVKVGRNVLCL  391

Query  420  GFLDGGLGQ----GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRF  268
            GF+DGG  +      S+VIGG+QLEDNLLEF+L +S LGF+S  L+   SCSHF  F
Sbjct  392  GFVDGGNEEVGPWDTSIVIGGHQLEDNLLEFDLVSSKLGFSSSLLLNKASCSHFKGF  448



>ref|NP_001234746.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
 gb|AAY97864.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
Length=438

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 71/111 (64%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             ++RV  VAP  VCF       + VG  VP ++ VLQ+  V W +   NSMV+V + V+C
Sbjct  322  NVTRVAVVAPFRVCFDSRDIGSTRVGPAVPSIDLVLQNANVVWTIFGANSMVQVSENVLC  381

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LG LDGG+  G S+VIGG+ +EDNLL+F+   S LGFTS  L   T+C++F
Sbjct  382  LGVLDGGVNAGTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFRQTTCANF  432



>ref|XP_010026234.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=389

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 75/118 (64%), Gaps = 15/118 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV--  442
            +A+  L+ + PV P  +C+S         G  VP ++ V+QSE V WR+   NSMV++  
Sbjct  264  SAAFNLTTIQPVKPFSLCYSARDVGVTRAGPAVPAIDLVMQSEEVFWRVFGANSMVRIQR  323

Query  441  -GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             G    CLG +DGG    A++VIGG+Q+EDNLL+F+LG+  LGF+S  L+ GT+C+ F
Sbjct  324  KGTDAWCLGLVDGGAEARAAIVIGGHQVEDNLLQFDLGSMRLGFSSSVLVRGTTCADF  381



>gb|EMS47745.1| Basic 7S globulin [Triticum urartu]
Length=329

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 68/110 (62%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP ++C+ G       VG  VP VE VLQSE   W +   NSMV V  G +CL
Sbjct  217  IPRVRAVAPFKLCYDGSKVGSTRVGPAVPTVELVLQSEAASWVVFGANSMVAVKGGALCL  276

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            G +DGG     SVV+GG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  277  GVVDGGAAPRTSVVVGGHMMEDNLLEFDLQRSRLGFSSSLLFRQTTCNNF  326



>ref|XP_002517167.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45330.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=435

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 73/111 (66%), Gaps = 13/111 (12%)
 Frame = -1

Query  555  PVAPXEVCFSGVGSD-------VPKVEFVLQSE-MVKWRM---NSMVKVGDGVMCLGFLD  409
            P+AP  +C+     D       VP ++ VL+S+  V WR+   NSMVK+   VMCLGF+D
Sbjct  325  PIAPFGLCYQSAAMDINEYGPVVPFIDLVLESQGSVYWRIWGANSMVKISSYVMCLGFVD  384

Query  408  GGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSM  262
            GGL   +S++IGG QLEDNLL+F+L ++ LGFTS  L+  T+CS+F   S+
Sbjct  385  GGLKPDSSIIIGGRQLEDNLLQFDLASARLGFTSSLLVRNTTCSNFNSKSV  435



>gb|KCW45638.1| hypothetical protein EUGRSUZ_L005902, partial [Eucalyptus grandis]
Length=224

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             L++V  V P + CFS        VG  VP ++ V+ +  V WR+   NSMV+V + V+C
Sbjct  108  NLTKVSSVKPFKYCFSSKNTPSTRVGPAVPLIDLVMHNSSVYWRIFGANSMVQVKEDVIC  167

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGG     S+VIGGYQLEDNL++ ++  + LGF+S  L   T+CS+F
Sbjct  168  LGFVDGGSNPRTSIVIGGYQLEDNLVQIDMEKARLGFSSSLLFKQTTCSNF  218



>ref|XP_006489307.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=422

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A    ++RV PVAP   CF       S +G  VP+++ VLQ+  V W +   NS+V+V +
Sbjct  303  AMPTKVTRVAPVAPFGACFNSRDIGSSRLGPSVPQIDLVLQNSKVLWSIIGANSIVRVSN  362

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V CLGF+DGG+    S+VIGG+QL++NL++F++ TS LGF++  L+  T CS+F
Sbjct  363  DVSCLGFVDGGVTPKTSIVIGGHQLDNNLVQFDIATSRLGFSNSLLLQRTMCSNF  417



>ref|XP_006419825.1| hypothetical protein CICLE_v10007108mg [Citrus clementina]
 gb|ESR33065.1| hypothetical protein CICLE_v10007108mg [Citrus clementina]
Length=409

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A    ++RV PVAP   CF       S +G  VP+++ VLQ+  V W +   NS+V+V +
Sbjct  290  AMPTKVTRVAPVAPFGACFNSRDIGSSRLGPSVPQIDLVLQNSKVLWSIVGANSIVRVSN  349

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V CLGF+DGG+    S+VIGG+QL++NL++F++ TS LGF++  L+  T CS+F
Sbjct  350  DVSCLGFVDGGVTPKTSIVIGGHQLDNNLVQFDIATSRLGFSNSLLLQRTMCSNF  404



>ref|XP_006419823.1| hypothetical protein CICLE_v10005035mg [Citrus clementina]
 gb|ESR33063.1| hypothetical protein CICLE_v10005035mg [Citrus clementina]
Length=422

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A    ++RV PVAP   CF       S +G  VP+++ VLQ+  V W +   NS+V+V +
Sbjct  303  AMPTKVTRVAPVAPFGACFNSRDIGSSRLGPSVPQIDLVLQNSKVFWSIIGANSIVRVSN  362

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V CLGF+DGG+    S+VIGG+QL++NL++F++ TS LGF++  L+  T CS+F
Sbjct  363  DVSCLGFVDGGVTPKTSIVIGGHQLDNNLVQFDIATSRLGFSNSLLLQRTMCSNF  417



>gb|KJB26455.1| hypothetical protein B456_004G242500 [Gossypium raimondii]
Length=383

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 71/112 (63%), Gaps = 13/112 (12%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             + +V PVAP  VCF       S VG  VP ++ VL  + V WR+   NS+V+   GV C
Sbjct  266  AIPQVKPVAPFGVCFNSKSFKKSRVGPGVPNIDLVLHDKHVMWRIYGANSLVEAAPGVSC  325

Query  423  LGFLDGGL-GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            L F+DGG+   GAS++IG YQ+E+NL++F++  S LGF+S  L   TSC++F
Sbjct  326  LAFVDGGMKNNGASIIIGAYQMENNLVQFDMAISRLGFSSSLLFYKTSCNNF  377



>gb|EYU20619.1| hypothetical protein MIMGU_mgv1a026442mg, partial [Erythranthe 
guttata]
Length=427

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 74/118 (63%), Gaps = 15/118 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A S  ++RV  VAP   CF       S  G  VP ++ V++ + V WR    NSMVKV  
Sbjct  307  AESKNITRVASVAPFGACFDSKTVLSSKTGPRVPTIDLVMEKKSVYWRFYGSNSMVKVSK  366

Query  435  GVMCLGFLDGGL---GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CL F++G +   GQ  S+ +GGYQ+E++LLEF++ +S LGF+S  L+ GTSCS+F
Sbjct  367  DVICLAFVEGTINVSGQTTSIEVGGYQMENHLLEFDVASSKLGFSSSLLLHGTSCSNF  424



>gb|KJB26454.1| hypothetical protein B456_004G242400 [Gossypium raimondii]
Length=425

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 70/112 (63%), Gaps = 13/112 (12%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             + +V PVAP   CF       S VG  VP ++ VL  + V WR+   NS+V+   GV C
Sbjct  308  AIPQVKPVAPFSACFNSKSFKNSRVGPGVPNIDLVLHDKHVMWRIYGANSLVEAAPGVSC  367

Query  423  LGFLDGGL-GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            L F+DGG+   GAS++IG YQ+E+NL++F++  S LGF+S  L   TSC++F
Sbjct  368  LAFVDGGMKNNGASIIIGAYQMENNLVQFDMARSRLGFSSSLLFYKTSCNNF  419



>gb|ACM68431.1| xyloglucan-specific endoglucanase inhibitor protein [Capsicum 
annuum]
Length=437

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (65%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             ++RV  VAP   CF       + VG  VP+++ VLQ+E V W +   NSMV+V + V+C
Sbjct  321  NVTRVASVAPFGACFDSRNIGSTRVGPAVPQIDLVLQNENVIWTIFGANSMVQVSENVLC  380

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGG+    S+VIGG+ +EDNLL+ ++  S LGFTS  L   T+C++F
Sbjct  381  LGFVDGGVNSRTSIVIGGHTIEDNLLQLDIARSRLGFTSSILFRQTTCANF  431



>gb|EEE63672.1| hypothetical protein OsJ_18490 [Oryza sativa Japonica Group]
Length=400

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSGV-------GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP ++C+ G        G  VP VE VLQS+ V W +   NSMV   DG +C 
Sbjct  288  IPRVPAVAPFKLCYDGTMVGSTRAGPAVPTVELVLQSKAVSWVVFGANSMVATKDGALCF  347

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA--GTSCSHF  277
            G +DGG+    SVVIGG+ +EDNLLEF+L  S LGFTS +    T+C+ F
Sbjct  348  GVVDGGVAPETSVVIGGHMMEDNLLEFDLEGSRLGFTSYLPLLQTTCNSF  397



>gb|EYU20615.1| hypothetical protein MIMGU_mgv1a006692mg [Erythranthe guttata]
Length=435

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 71/118 (60%), Gaps = 15/118 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AAS  + RV  VAP   CF       S  G  VP ++FVL  + V WR    NSMV+V D
Sbjct  315  AASQNIKRVASVAPFGACFGSKTVTSSKTGPQVPTIDFVLHKKSVYWRFYGANSMVRVSD  374

Query  435  GVMCLGFLDGG---LGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CL F++G    +G   S+ +GGYQ+E+ LLEF++ +S LGF+S  L+  TSCS F
Sbjct  375  EVICLAFVEGATNLVGPTTSIEVGGYQMENYLLEFDVASSKLGFSSSLLLHDTSCSKF  432



>gb|AAT85211.1| hypothetical protein [Oryza sativa Japonica Group]
Length=435

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSGV-------GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP ++C+ G        G  VP VE VLQS+ V W +   NSMV   DG +C 
Sbjct  323  IPRVPAVAPFKLCYDGTMVGSTRAGPAVPTVELVLQSKAVSWVVFGANSMVATKDGALCF  382

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA--GTSCSHF  277
            G +DGG+    SVVIGG+ +EDNLLEF+L  S LGFTS +    T+C+ F
Sbjct  383  GVVDGGVAPETSVVIGGHMMEDNLLEFDLEGSRLGFTSYLPLLQTTCNSF  432



>ref|XP_010255898.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=435

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 78/119 (66%), Gaps = 16/119 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVK-VG  439
            AAS+ L+  DP+ P  VC++        VG  VP ++ V++ + + WR+   NSMV+ VG
Sbjct  308  AASLNLTXTDPLKPFSVCYASNDVFSTRVGPAVPTIDLVMERDDIFWRIFGANSMVRMVG  367

Query  438  DG---VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLM--AGTSCSHF  277
            +    V+CLGF+DGG     S+VIGG+Q+EDNLL+F+LG   +GF+SL+    T+C++F
Sbjct  368  EKEEEVVCLGFVDGGANPRTSIVIGGHQMEDNLLQFDLGMKRVGFSSLLLIKQTNCANF  426



>ref|XP_004486304.1| PREDICTED: basic 7S globulin 2-like [Cicer arietinum]
Length=431

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 70/108 (65%), Gaps = 12/108 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            +   + P ++CF       + VG  VP ++F+LQ++ V WRM   NSMV+V + V CL F
Sbjct  318  KAKAIKPFKLCFKLKDLGVTRVGLAVPTIDFMLQNKDVFWRMFGANSMVQVNNKVSCLAF  377

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LDGG+    S+VIGGYQLEDN L+F+L  S LGF+S  L   T+C++F
Sbjct  378  LDGGVEVTTSIVIGGYQLEDNFLQFDLVNSRLGFSSSLLFLQTTCANF  425



>ref|XP_010026985.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=434

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 72/110 (65%), Gaps = 13/110 (12%)
 Frame = -1

Query  570  LSRVDPVAPXEVCF------SGV-GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + +  PVAP   CF      SGV GSDVP +  VL+ +  +WR+   NSMV+V   VMCL
Sbjct  326  IKKATPVAPFGACFDARTVRSGVAGSDVPAIVLVLRGD-AQWRIEGANSMVRVSKDVMCL  384

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GFLDGG G GA++ IGG Q+EDNLLE ++G+   GF++  L+  +SCSH 
Sbjct  385  GFLDGGSGAGAAIEIGGNQMEDNLLESDVGSLTFGFSNSLLLRNSSCSHL  434



>gb|KDO35982.1| hypothetical protein CISIN_1g037784mg, partial [Citrus sinensis]
Length=244

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 74/115 (64%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A    ++RV PV P   CF       S +G  VP+++ VLQ+  V W +   NS+V+V +
Sbjct  125  AMPTKVTRVAPVVPFGACFNSRDIGSSRLGPSVPQIDLVLQNSKVLWSIIGANSIVRVSN  184

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V CLGF+DGG+    S+VIGG+QL++NL++F++ +S LGF++  L+  T CS+F
Sbjct  185  DVSCLGFVDGGVTPKTSIVIGGHQLDNNLVQFDIASSRLGFSNSLLLQRTMCSNF  239



>gb|KCW60840.1| hypothetical protein EUGRSUZ_H03578 [Eucalyptus grandis]
Length=392

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 72/109 (66%), Gaps = 13/109 (12%)
 Frame = -1

Query  570  LSRVDPVAPXEVCF------SGV-GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + +  PVAP   CF      SGV GSDVP +  VL+ +  +WR+   NSMV+V   VMCL
Sbjct  284  IKKATPVAPFGACFDARTVRSGVAGSDVPAIVLVLRGD-AQWRIEGANSMVRVSKDVMCL  342

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSH  280
            GFLDGG G GA++ IGG Q+EDNLLE ++G+   GF++  L+  +SCSH
Sbjct  343  GFLDGGSGAGAAIEIGGNQMEDNLLESDVGSLTFGFSNSLLLRNSSCSH  391



>gb|KCW84281.1| hypothetical protein EUGRSUZ_B01132 [Eucalyptus grandis]
Length=302

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             L++V  V P + CFS        VG  VP ++ V+ +  V WR+   NSMV+V + V+C
Sbjct  186  NLTKVSSVKPFKYCFSSKNTPSTRVGPAVPLIDLVMHNSSVYWRIFGANSMVQVKEDVIC  245

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGG     S+VIGGYQLEDNL++ ++  + LGF+S  L   T+CS+F
Sbjct  246  LGFVDGGSNPRTSIVIGGYQLEDNLVQIDMEKARLGFSSSLLFKQTTCSNF  296



>gb|KCW60847.1| hypothetical protein EUGRSUZ_H03585 [Eucalyptus grandis]
Length=410

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 13/113 (12%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A    + +  PVAP  VCF          G DVP +  VLQ   V+WRM   NSMV+V  
Sbjct  296  AMDRKIKKASPVAPFGVCFDAKMVRSGKAGPDVPAIVLVLQGN-VQWRMEGANSMVRVSK  354

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  283
             VMCLGF+DGG     +VVIG +Q+EDNL+EF++G+S  GF++  L+  +SCS
Sbjct  355  DVMCLGFVDGGSKPRTAVVIGAHQMEDNLVEFDVGSSTFGFSNSLLLQNSSCS  407



>gb|KDP40110.1| hypothetical protein JCGZ_02108 [Jatropha curcas]
Length=437

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 68/108 (63%), Gaps = 12/108 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            RV  VAP   CF         +G  VP ++ +LQS  V WR+   NSMV+V   V+CLGF
Sbjct  324  RVASVAPFGACFDASKIASTRLGPAVPSIDLMLQSNNVVWRIIGANSMVQVNRDVLCLGF  383

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            +DGG+    S++IGG+QLEDN L+F+L  S LGF+S  L   T+C++F
Sbjct  384  VDGGVDARTSIIIGGHQLEDNFLQFDLAASRLGFSSSLLSRQTTCANF  431



>ref|XP_010024401.1| PREDICTED: basic 7S globulin 2-like [Eucalyptus grandis]
Length=441

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 13/113 (12%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A    + +  PVAP  VCF          G DVP +  VLQ   V+WRM   NSMV+V  
Sbjct  327  AMDRKIKKASPVAPFGVCFDAKMVRSGKAGPDVPAIVLVLQGN-VQWRMEGANSMVRVSK  385

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  283
             VMCLGF+DGG     +VVIG +Q+EDNL+EF++G+S  GF++  L+  +SCS
Sbjct  386  DVMCLGFVDGGSKPRTAVVIGAHQMEDNLVEFDVGSSTFGFSNSLLLQNSSCS  438



>ref|XP_009773278.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=459

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 74/118 (63%), Gaps = 15/118 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV--  442
            +  + L+  +PV P +VC++        VG  VP V+ V+Q + V WR+   NSMV++  
Sbjct  333  STKLNLTVTNPVEPFKVCYNADEVMETRVGPAVPTVDLVMQGDDVFWRIFGSNSMVRIFR  392

Query  441  -GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             G  V CLGFLDGG+    S++IGG+Q+EDNLL+F+L    LGF+S  L   T+CS+F
Sbjct  393  DGVDVWCLGFLDGGVKTKTSIIIGGHQMEDNLLQFDLRQQRLGFSSSVLAYNTTCSNF  450



>gb|KJB70565.1| hypothetical protein B456_011G080800 [Gossypium raimondii]
Length=434

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 73/110 (66%), Gaps = 13/110 (12%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            ++RV  VAP   C++        VG  VP+++ +L +++V WR+   NSMV+V   V+CL
Sbjct  320  VARVPAVAPFSACYNAKSLGSTRVGPAVPQIDLLLPNKVV-WRIFGANSMVQVNKDVLCL  378

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            GF+DGGL    S+VIGG+Q+EDNLL+ +L  S LGF+S  L   T+CS+F
Sbjct  379  GFVDGGLEPTTSIVIGGHQIEDNLLQIDLAASKLGFSSSLLFRRTTCSNF  428



>gb|AAT85209.1| unknown protein [Oryza sativa Japonica Group]
Length=255

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP ++C+ G       VG  VP VE V QSE   W +   NSMV    G +CL
Sbjct  143  IPRVPAVAPFKLCYDGSKVAGTRVGPAVPTVELVFQSEATSWVVFGANSMVATKGGALCL  202

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            G +DGG+    SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  203  GVVDGGVASETSVVIGGHMMEDNLLEFDLVGSRLGFSSSLLFRQTTCNNF  252



>ref|NP_001234249.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
 gb|AAN87262.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
Length=438

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 72/117 (62%), Gaps = 12/117 (10%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             ++RV  VAP  VCF       + VG  VP ++ VLQ+  V W +   NSMV+V + V+C
Sbjct  322  NVTRVAVVAPFRVCFDSRDIGSTRVGPAVPSIDLVLQNANVVWTIFGANSMVQVSENVLC  381

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSME  259
            LG LDGG+    S+VIGG+ +EDNLL+F+   S LGFTS  L   T+C +F   S++
Sbjct  382  LGVLDGGVNARTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFRQTTCDNFNFTSID  438



>ref|XP_006366973.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=361

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 73/118 (62%), Gaps = 15/118 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            +A + L+  +PV P +VC++        VG  VP V+ V+ +  V WR+   NSMV++  
Sbjct  235  SAKLNLTVTNPVEPFKVCYNADEVLDTKVGPTVPTVDLVMDNHDVFWRIFGSNSMVRIAR  294

Query  435  G---VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
                V CLGFLDGG+    S++IGG+Q+E+NLL+F+L    LGF+S  L   TSCS+F
Sbjct  295  NDVDVWCLGFLDGGIKTETSIIIGGHQMENNLLQFDLEQEKLGFSSSVLAYSTSCSNF  352



>ref|XP_009625778.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=439

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 74/118 (63%), Gaps = 15/118 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV--  442
            +  + L+  +PV P +VC++        VG  VP V+ V+  + V WR+   NSMV++  
Sbjct  313  STKLNLTVTNPVEPFKVCYNADEVMETRVGPAVPTVDLVMHGDDVFWRIFGSNSMVRIFR  372

Query  441  -GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             G  V CLGFLDGG+    S++IGG+Q+EDNLL+F+L    LGF+S  L+  T+CS+F
Sbjct  373  DGVNVWCLGFLDGGVKTKTSIIIGGHQMEDNLLQFDLRQQRLGFSSSVLVYNTTCSNF  430



>ref|XP_004231264.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=427

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 73/109 (67%), Gaps = 8/109 (7%)
 Frame = -1

Query  579  SMGLSRVDPVAPXEVCF-SGVGS--DVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLG  418
            S G+S+V+P++P  +CF S V S  +VP ++FV+Q++ V W +   NS+V+   GV CL 
Sbjct  310  SSGISQVNPISPFGLCFNSNVSSITNVPNIDFVMQNKNVTWTIVGTNSVVEARPGVSCLA  369

Query  417  FLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            F+DGG    A +VIG +QLEDN +EF+L  S LG +S  L   TSCS+F
Sbjct  370  FVDGGQNPKAPIVIGVHQLEDNFVEFDLVRSRLGVSSSLLSRNTSCSNF  418



>emb|CAN68737.1| hypothetical protein VITISV_030194 [Vitis vinifera]
Length=439

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 12/108 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            RV P+AP  +CF       + +G +V  ++ VL +    WR+   NSMV+   GV CLGF
Sbjct  316  RVQPIAPFGLCFDATKMTATQIGPEVANIDLVLHNRNNVWRIVGANSMVQPRPGVWCLGF  375

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            +DGG    A +++G YQLEDNLL+F+L  S LGF+S  L  GT C +F
Sbjct  376  VDGGSNPKAPIILGSYQLEDNLLQFDLARSKLGFSSSLLFRGTHCGNF  423



>ref|XP_010659830.1| PREDICTED: basic 7S globulin-like [Vitis vinifera]
Length=455

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 12/108 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            RV P+AP  +CF       + +G +V  ++ VL +    WR+   NSMV+   GV CLGF
Sbjct  332  RVQPIAPFGLCFDATKMTATQIGPEVANIDLVLHNRNNVWRIVGANSMVQPRPGVWCLGF  391

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            +DGG    A +++G YQLEDNLL+F+L  S LGF+S  L  GT C +F
Sbjct  392  VDGGSNPKAPIILGSYQLEDNLLQFDLARSKLGFSSSLLFRGTHCGNF  439



>emb|CDY15455.1| BnaA08g27390D [Brassica napus]
Length=432

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 72/115 (63%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A +  ++RV  V P   C S        +G  VP+++ VLQS+ V WR+   NSMV V  
Sbjct  312  ATARNITRVPSVKPFGACVSTKNVVVTRLGYAVPEIQLVLQSKDVVWRIFGANSMVSVHS  371

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SV+IGG QLEDNL+E +L  + LGF+S + G  T+C++F
Sbjct  372  DVICLGFVDGGVNAETSVIIGGLQLEDNLIEIDLAKNTLGFSSTLLGRQTNCANF  426



>ref|XP_002272199.2| PREDICTED: basic 7S globulin 2-like [Vitis vinifera]
Length=457

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 75/118 (64%), Gaps = 15/118 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKV--  442
            +A + L+   PV P  VCF       + VG  VP V+ V+QS+ V WR+   NSMV++  
Sbjct  331  SAGLNLTVHYPVKPFRVCFPADDVMETTVGPAVPTVDLVMQSDDVFWRIFGRNSMVRILE  390

Query  441  -GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             G  V CLGF+DGG+    S+VIGG+Q+EDNLL+F+LG   LGF+S  L+  T C++F
Sbjct  391  EGVDVWCLGFVDGGVRPRTSIVIGGHQMEDNLLQFDLGLKRLGFSSSVLVHHTMCANF  448



>ref|XP_010035585.1| PREDICTED: basic 7S globulin [Eucalyptus grandis]
Length=436

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             L++V  V P + CFS        VG  VP ++ V+ +  V WR+   NSMV+V + V+C
Sbjct  320  NLTKVSSVKPFKYCFSSKNTPSTRVGPAVPLIDLVMHNSSVYWRIFGANSMVQVKEDVIC  379

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LGF+DGG     S+VIGGYQLEDNL++ ++  + LGF+S  L   T+CS+F
Sbjct  380  LGFVDGGSNPRTSIVIGGYQLEDNLVQIDMEKARLGFSSSLLFKQTTCSNF  430



>ref|XP_011079830.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=399

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 76/116 (66%), Gaps = 15/116 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-G  439
            +A++ L+   PV P  VC++        +G  VP V+FVLQ + V WR+   NSM ++  
Sbjct  273  SAALNLTITQPVKPFNVCYNADEVMSTRIGPAVPTVDFVLQDDDVIWRIFGWNSMFRIFR  332

Query  438  DGV--MCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  283
            DGV   CLGFLDGG    +S+VIGG+Q++DNLL+F+L ++ LGF+S  L+ GT C+
Sbjct  333  DGVDLYCLGFLDGGPNPRSSIVIGGHQMDDNLLQFDLQSNRLGFSSSLLVHGTMCA  388



>dbj|BAJ94733.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91936.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 67/110 (61%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP ++C+ G       VG  VP VE VLQ+E   W +   NSMV    G +CL
Sbjct  318  IPRVRAVAPFKLCYDGSKVGSTRVGPAVPTVELVLQNEAASWVVFGANSMVAAKGGALCL  377

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            G +DGG     SVVIGG+ +EDNLLEF+L  + LGF+S  L   T+C++F
Sbjct  378  GVVDGGAAPRTSVVIGGHTMEDNLLEFDLQRARLGFSSSLLFRQTTCNNF  427



>ref|XP_009787261.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=436

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 69/118 (58%), Gaps = 15/118 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A +M L+   PV P EVCF         +G  VP ++ VLQ   V WR+   NSMV+V  
Sbjct  313  AKAMNLTVTTPVKPFEVCFPAKAIAFTRLGPAVPTIDLVLQKPDVFWRIFGSNSMVRVKA  372

Query  435  ---GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
                V CLGF+DGG     S+VIGG+Q+EDNLL+F+L     GF+S  L   T+C++F
Sbjct  373  QNVDVWCLGFVDGGPEPRTSIVIGGHQIEDNLLQFDLAQKRFGFSSSLLFKSTNCANF  430



>ref|XP_004495219.1| PREDICTED: basic 7S globulin-like [Cicer arietinum]
Length=440

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 71/115 (62%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            + +  ++R D   P E C+S        +G+ VP +E VLQ+E V W +   NSMV + D
Sbjct  319  SVARNITRTDSFEPFEFCYSFDNLSGTRLGAAVPTIELVLQNENVVWSIFGANSMVNIND  378

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFT-SLMA-GTSCSHF  277
             V+CLGF++GG     S+VIGGYQL++NLL+F+L  S LGF+ S+ A  T C  F
Sbjct  379  DVLCLGFMNGGENVRTSIVIGGYQLDNNLLQFDLAASRLGFSGSVFARQTDCFRF  433



>ref|XP_004229432.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=441

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 71/114 (62%), Gaps = 16/114 (14%)
 Frame = -1

Query  570  LSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVK-----WRMNSMVKVGDGVM  427
            + RV PVAP +VC+       + VG  VP +E VL+++        W +NSMV V D V+
Sbjct  322  VPRVKPVAPFKVCYNRTSLGSTRVGPGVPPIELVLRNKNATTSWTIWGVNSMVAVNDDVL  381

Query  426  CLGFLDGGLG--QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            CLGF+DGG+      S+VIG +Q+EDNLL+F++    LGFTS  L   T+C++F
Sbjct  382  CLGFVDGGVEFEPTTSIVIGAHQIEDNLLQFDIANKRLGFTSSLLFGQTTCANF  435



>gb|ADG23123.1| xyloglucan specific endoglucanase inhibitor [Solanum melongena]
Length=437

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 12/111 (11%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  424
             ++RV PV P   CF       + VG  VP ++ VLQ++ V W +   NSMV+V + V+C
Sbjct  321  NVTRVAPVTPFGACFDSRNIGSTRVGPAVPWIDLVLQNQNVVWTIFGANSMVQVSENVLC  380

Query  423  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            LG +DGG+    S+VIGG+ +EDNLL+F+   S LGFTS  L   T+C++F
Sbjct  381  LGIVDGGVNARTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFRQTTCANF  431



>gb|EEE63670.1| hypothetical protein OsJ_18488 [Oryza sativa Japonica Group]
Length=419

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP ++C+ G       VG  VP VE V QSE   W +   NSMV    G +CL
Sbjct  307  IPRVPAVAPFKLCYDGSKVAGTRVGPAVPTVELVFQSEATSWVVFGANSMVATKGGALCL  366

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            G +DGG+    SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  367  GVVDGGVASETSVVIGGHMMEDNLLEFDLVGSRLGFSSSLLFRQTTCNNF  416



>ref|XP_009111160.1| PREDICTED: basic 7S globulin-like [Brassica rapa]
Length=455

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 72/115 (63%), Gaps = 12/115 (10%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A +  ++RV  V P   C S        +G  VP+++ VLQS+ V WR+   NSMV V  
Sbjct  335  ATARNITRVPSVKPFGACVSTKNVVVTRLGYAVPEIQLVLQSKDVVWRIFGANSMVSVHS  394

Query  435  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
             V+CLGF+DGG+    SVV+GG QLEDNL+E +L  + LGF+S + G  T+C++F
Sbjct  395  DVICLGFVDGGVNAETSVVVGGLQLEDNLIEIDLAKNTLGFSSTLLGRQTNCANF  449



>gb|KDP40111.1| hypothetical protein JCGZ_02109 [Jatropha curcas]
Length=307

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 12/107 (11%)
 Frame = -1

Query  564  RVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            RV  V P +VCF         VG   P V+FVLQ+    WR+   NSMV V +  +CL F
Sbjct  195  RVKAVKPFDVCFDAKSFSSTRVGPGEPPVDFVLQNNETVWRIWGANSMVYVNEKTLCLAF  254

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSH  280
            +DGG     S+VIGGYQLE+NLL+F+L +  LGF+   L + T+CS+
Sbjct  255  IDGGAEPRTSIVIGGYQLENNLLQFDLASKRLGFSGSLLFSQTTCSN  301



>ref|NP_001055496.1| Os05g0402900 [Oryza sativa Japonica Group]
 dbj|BAF17410.1| Os05g0402900 [Oryza sativa Japonica Group]
Length=437

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP ++C+ G       VG  VP VE V QSE   W +   NSMV    G +CL
Sbjct  325  IPRVPAVAPFKLCYDGSKVAGTRVGPAVPTVELVFQSEATSWVVFGANSMVATKGGALCL  384

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            G +DGG+    SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  385  GVVDGGVASETSVVIGGHMMEDNLLEFDLVGSRLGFSSSLLFRQTTCNNF  434



>ref|XP_010693887.1| PREDICTED: basic 7S globulin-like [Beta vulgaris subsp. vulgaris]
Length=395

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 82/120 (68%), Gaps = 10/120 (8%)
 Frame = -1

Query  579  SMGLSRVDPVAPXEVCFSGVGSD---VPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLG  418
            ++ + RV      EVC+S V      VP ++ VLQSEMVKWR+   NSMVKV D VMCLG
Sbjct  274  NLNMKRVSSQGGFEVCYSVVERSTIVVPVIDLVLQSEMVKWRIYGHNSMVKVNDEVMCLG  333

Query  417  FLDGGLGQGA--SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSMERDS  250
            FLDGGL  G   S+++G +QLEDNLLEF+L +SMLGF+S  + + TSCS+ +  +M R +
Sbjct  334  FLDGGLDLGDGISIILGAHQLEDNLLEFDLVSSMLGFSSSLIKSKTSCSYLSSSAMHRSA  393



>ref|XP_006489308.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=429

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 12/111 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV P+AP   CF+        VG+  P++   +      W++   NSMV+VG   MCL
Sbjct  313  IPRVKPMAPFGACFNSSFIGSTHVGAAAPEIHLYMPGTNRMWKIFGANSMVRVGKHAMCL  372

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  274
             F+DGG+    S+VIG YQLEDNLL+F+L  S LGF+S  L   T+CS+ T
Sbjct  373  AFVDGGVNPTTSIVIGAYQLEDNLLQFDLAKSRLGFSSSLLARQTTCSNLT  423



>gb|KDP25943.1| hypothetical protein JCGZ_22848 [Jatropha curcas]
Length=434

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP  VCFS        VG  VP ++ VLQ+    WR+   NSMV + D  +CL
Sbjct  320  VPRVKAVAPFGVCFSAKHIGVTRVGPAVPTIDLVLQNNGTVWRIWGTNSMVNINDNALCL  379

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA--GTSCSHF  277
             F+DGG     S+VIGG+QLE+NLL+F+ G+  LGF+  +    T+C++F
Sbjct  380  AFVDGGADAETSIVIGGHQLEENLLQFDFGSKTLGFSGPLPFWRTTCANF  429



>ref|XP_004247154.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=431

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 73/118 (62%), Gaps = 15/118 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV--  442
            +  + L+  +PV P +VC++        VG  VP V+ V+ S+ V WR+   NSMV++  
Sbjct  305  STKLNLTVTNPVEPFKVCYNADEVLDTKVGPTVPTVDLVMDSDDVFWRIFGSNSMVRIAR  364

Query  441  -GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             G  V CLGFLDGG     S++IGG+Q+E+NLL+F+L    LGF+S  L   TSCS+F
Sbjct  365  NGVDVWCLGFLDGGSKTETSIIIGGHQMENNLLQFDLEQEKLGFSSSVLAYSTSCSNF  422



>gb|EAY97992.1| hypothetical protein OsI_19909 [Oryza sativa Indica Group]
Length=437

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 66/110 (60%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP ++C+ G       VG  VP VE V QSE   W +   NSMV    G +CL
Sbjct  325  IPRVPAVAPFKLCYDGSKVASTRVGPAVPTVELVFQSEATSWVVFGANSMVATKGGALCL  384

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            G +DGG     SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  385  GVVDGGAAPETSVVIGGHMMEDNLLEFDLVGSRLGFSSSLLFRQTTCNNF  434



>gb|KJB45207.1| hypothetical protein B456_007G295400 [Gossypium raimondii]
Length=425

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 68/111 (61%), Gaps = 13/111 (12%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCFSG--------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  427
            G+  V  V P EVCF+         VG  VP ++ VL  + V WR+   NS+V+   GV 
Sbjct  308  GIPLVKLVEPFEVCFNSKSIDKRTRVGPKVPNIDLVLHDQHVIWRIYGSNSLVEATPGVS  367

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSH  280
            CL F+DGGL   A++VIG YQ+E+NL++F++  S LGF+S  L   TSC++
Sbjct  368  CLAFVDGGLNTRAAIVIGAYQMENNLIQFDMARSRLGFSSSLLFFRTSCNN  418



>gb|KCW60850.1| hypothetical protein EUGRSUZ_H03588 [Eucalyptus grandis]
Length=403

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 69/107 (64%), Gaps = 10/107 (9%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGF  415
            AA   + RV+P+AP  V     G DVP +  VL+S+  +WR+   NSMV+V   VMCLGF
Sbjct  301  AAEKKIRRVEPIAPSGVA----GPDVPVIVLVLRSD-AQWRIEGANSMVRVSKEVMCLGF  355

Query  414  LDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSH  280
            ++GG     ++VIG +Q+EDNL+EF+  + M  F++  L+  TSCSH
Sbjct  356  VEGGSRPRTAIVIGAHQMEDNLVEFDAASLMFRFSNSLLLRNTSCSH  402



>ref|XP_008246503.1| PREDICTED: basic 7S globulin-like [Prunus mume]
Length=431

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 13/112 (12%)
 Frame = -1

Query  573  GLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEM-VKWRM---NSMVKVGDGVM  427
            G+  V PVAP   CF       S VG  VP ++ VL ++  + WR+   N+M++   GVM
Sbjct  309  GVPHVKPVAPFGACFDANRIPTSKVGPTVPTIDLVLDNKKNIMWRIFGANAMIQPRPGVM  368

Query  426  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            CL F+DGG+   A +VIG  QLEDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  369  CLAFVDGGMRPKAPIVIGTQQLEDNLLQFDLMNSRLGFSSSLLFRRTNCANF  420



>ref|XP_010524801.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin 2 [Tarenaya 
hassleriana]
Length=427

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 70/115 (61%), Gaps = 14/115 (12%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEM--VKWRM---NSMVKV  442
            A +MG+ +   VAP   CF       + +G +VP V+FV+   +  VKWR    NSMVK 
Sbjct  312  AKAMGIRKAPAVAPFMDCFDASSVRKNAIGPNVPAVDFVVPGRIGNVKWRFYGANSMVKA  371

Query  441  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  283
             + VMCL F+DGG     S+ IG +QL+++L+EF+L TS+ GF+   L+  TSCS
Sbjct  372  NEKVMCLAFVDGGTKSDNSITIGTHQLQNHLVEFDLTTSVFGFSESLLLHNTSCS  426



>ref|XP_009364261.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin, partial [Pyrus 
x bretschneideri]
Length=416

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 69/113 (61%), Gaps = 15/113 (13%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV P  P   CF+        VG  VP ++FVLQS  V WR    NSMV+V + V+CL
Sbjct  298  IPRVAPAEPFGACFNSTHIGRTRVGPAVPTIDFVLQSGSVYWRFLGANSMVQVNEEVLCL  357

Query  420  GFLDGGLGQG---ASVVIGGYQLEDNLLEFNLGTSMLGF-TSLMAG-TSCSHF  277
            GF+D GL       S+VIGG QLE+N L+F+L  S LGF  SL++G T+C+ F
Sbjct  358  GFVDAGLSPSNPMTSIVIGGLQLEENFLQFDLAASRLGFCNSLLSGPTTCADF  410



>ref|XP_006349243.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=441

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 69/114 (61%), Gaps = 16/114 (14%)
 Frame = -1

Query  570  LSRVDPVAPXEVCF-------SGVGSDVPKVEFVL-----QSEMVKWRMNSMVKVGDGVM  427
            + RV PVAP EVC+       + VG  VP +E VL      +    W +NSMV V + V+
Sbjct  322  VPRVKPVAPFEVCYNRTSLGSTRVGPGVPPIELVLGNKNATTSWTIWGVNSMVAVNNDVL  381

Query  426  CLGFLDGGLG--QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            CLGF+DGG+      S+VIG +Q+EDNLL+F++    LGFTS  L   T+C++F
Sbjct  382  CLGFVDGGVEFEPTTSIVIGAHQIEDNLLQFDIANKRLGFTSSLLFGQTTCANF  435



>ref|XP_011082639.1| PREDICTED: basic 7S globulin 2-like [Sesamum indicum]
Length=442

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = -1

Query  579  SMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG--D  436
            ++ L+RV PVAP  VC++        VG  VP ++ VL ++ V WR+   NSMV++   D
Sbjct  322  ALNLTRVKPVAPFSVCYAADKISSTRVGPAVPAIDLVLGNDKVLWRIYGSNSMVRMKNED  381

Query  435  G-VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            G   CLGF DGG     ++VIGG+QLEDNL++F+L    LGF+S  L+  T+C +F
Sbjct  382  GEAWCLGFEDGGADPKTAIVIGGHQLEDNLMQFDLERERLGFSSSLLLRSTTCGNF  437



>ref|XP_006361904.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=431

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 72/109 (66%), Gaps = 8/109 (7%)
 Frame = -1

Query  579  SMGLSRVDPVAPXEVCF-SGVGS--DVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLG  418
            S  +S+V+P++P  +CF S V S  +VP ++FV+Q++ V W +   NS+V+   GV CL 
Sbjct  310  SSRISQVNPISPFGLCFNSNVSSSTNVPNIDFVMQNKNVTWTIVGTNSVVEARPGVSCLA  369

Query  417  FLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            F+DGG    A +VIG +QLEDN +EF+L  S LG +S  L   TSCS+F
Sbjct  370  FVDGGQNPKAPIVIGVHQLEDNFVEFDLVRSRLGVSSSLLSRNTSCSNF  418



>emb|CDP19874.1| unnamed protein product [Coffea canephora]
Length=427

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 67/114 (59%), Gaps = 12/114 (11%)
 Frame = -1

Query  582  ASMGLSRVDPVAPXEVCFSGVGSDVPKVE-------FVLQSEMVKWRM---NSMVKVGDG  433
             ++G S+VDPV+P  VCF+ +   VPKV+       FV+++    W +   NS+VK   G
Sbjct  308  TAIGASQVDPVSPFGVCFNKLPPPVPKVDIAAPIIDFVMENRDTAWSIYGSNSIVKARPG  367

Query  432  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  277
            + CL F+DGG    A +V+G YQLED++ EF+L +S LGF   +     +C  F
Sbjct  368  IWCLAFVDGGYKPRAPIVLGAYQLEDHIFEFDLASSQLGFRVTLKADYNTCDQF  421



>ref|XP_007162407.1| hypothetical protein PHAVU_001G149500g [Phaseolus vulgaris]
 gb|ESW34401.1| hypothetical protein PHAVU_001G149500g [Phaseolus vulgaris]
Length=452

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 77/119 (65%), Gaps = 15/119 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            +++  L+  + V P  VC+         VG  VP V+ V+QSE V WR+   NSMV++  
Sbjct  325  SSAFNLTVTEGVEPFGVCYPAGDLTETRVGPAVPTVDLVMQSEEVFWRIFGGNSMVRIEK  384

Query  435  G---VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  274
            G   V CLGF+DGG  + ++VVIGG+QLEDN++EF++ ++  GFTS  L+ GT+C++ T
Sbjct  385  GGVDVWCLGFVDGGSRRRSAVVIGGHQLEDNVVEFDVDSNRFGFTSSLLLQGTNCANLT  443



>ref|NP_001174419.1| Os05g0403000 [Oryza sativa Japonica Group]
 gb|AAT85210.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EEE63671.1| hypothetical protein OsJ_18489 [Oryza sativa Japonica Group]
 dbj|BAH93147.1| Os05g0403000 [Oryza sativa Japonica Group]
Length=437

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 69/116 (59%), Gaps = 13/116 (11%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            A +  + RV  VAP E+C+ G        G  VP +E VLQ E V W M   NSMV    
Sbjct  319  AETATIPRVPAVAPFELCYDGRKVGSTRAGPAVPTIELVLQREAVSWIMYGANSMVPAKG  378

Query  435  GVMCLGFLDGGLG-QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA--GTSCSHF  277
            G +CLG +DGG     +SVVIGG+ +EDNLLEF+L  S LGF+S +    T+C++F
Sbjct  379  GALCLGVVDGGPALYPSSVVIGGHMMEDNLLEFDLEGSRLGFSSYLPLRQTTCNNF  434



>gb|KDO74789.1| hypothetical protein CISIN_1g014679mg [Citrus sinensis]
Length=420

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 72/112 (64%), Gaps = 13/112 (12%)
 Frame = -1

Query  570  LSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            ++RV PVAP   CF       + +G  VP+++ VLQ++ V W +   NSMV++G   +CL
Sbjct  306  VARVAPVAPFGACFRLQDIGFTRIGPVVPQIDLVLQNKNVVWSIHGQNSMVQIGGDALCL  365

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS-HFT  274
            GF+DGG+    S+VIG  QLE+NLL+F+L TS LGF+   L    +C+ +FT
Sbjct  366  GFVDGGVNPRTSIVIGARQLENNLLQFDLATSRLGFSDSLLFERATCTFNFT  417



>gb|KDO74797.1| hypothetical protein CISIN_1g044303mg [Citrus sinensis]
Length=428

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 12/111 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV P+AP   CF+        VG+  P++   +      W++   +SMV+VG   MCL
Sbjct  313  IPRVKPMAPFGACFNSSFIGSTHVGAAAPEIHLYMPGTNRMWKIFGAHSMVRVGKHAMCL  372

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  274
             F+DGG+    S+VIG YQLEDNLL+F+L  S LGF+S  L   T+CS+ T
Sbjct  373  AFVDGGVNPTTSIVIGAYQLEDNLLQFDLAKSRLGFSSSLLARQTTCSNLT  423



>gb|AFK34779.1| unknown [Medicago truncatula]
Length=454

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 75/117 (64%), Gaps = 17/117 (15%)
 Frame = -1

Query  570  LSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF       S  G +VP ++ VL+   V+WR+   NSMVKV + V+CL
Sbjct  339  IKRVKAVAPFGACFDSRTISKSVNGPNVPTIDLVLKGG-VEWRIFGANSMVKVNENVLCL  397

Query  420  GFLDGG---LGQGA-SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRF  268
            GF+D G   +G  A S++IGG+QLEDNL+EF+L +S LGF+S  L+   SCSHF  F
Sbjct  398  GFVDAGSEEVGPSATSIIIGGHQLEDNLVEFDLVSSKLGFSSSLLLNKASCSHFRGF  454



>ref|XP_003637703.1| Basic 7S globulin [Medicago truncatula]
 gb|KEH32186.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=454

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 75/117 (64%), Gaps = 17/117 (15%)
 Frame = -1

Query  570  LSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + RV  VAP   CF       S  G +VP ++ VL+   V+WR+   NSMVKV + V+CL
Sbjct  339  IKRVKAVAPFGACFDSRTISKSVNGPNVPTIDLVLKGG-VEWRIFGANSMVKVNENVLCL  397

Query  420  GFLDGG---LGQGA-SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRF  268
            GF+D G   +G  A S++IGG+QLEDNL+EF+L +S LGF+S  L+   SCSHF  F
Sbjct  398  GFVDAGSEEVGPSATSIIIGGHQLEDNLVEFDLVSSKLGFSSSLLLNKASCSHFRGF  454



>gb|EYU20620.1| hypothetical protein MIMGU_mgv1a006733mg [Erythranthe guttata]
Length=433

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 72/118 (61%), Gaps = 15/118 (13%)
 Frame = -1

Query  585  AASMGLSRVDPVAPXEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  436
            AAS  + RV  VAP   CF       S  G +VP ++FVLQ++ V WR    +SMV V  
Sbjct  313  AASQNIKRVAAVAPFGACFDSKTVTTSKTGPNVPIIDFVLQNKDVYWRFYGASSMVLVSA  372

Query  435  GVMCLGFLDGGL---GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
             V+CL F++G +   G   S+V+GGYQLE++LLEF++ +S L F+   L+  TSCS F
Sbjct  373  DVICLAFVEGQINLTGPTTSIVVGGYQLENHLLEFDVKSSKLSFSPSLLLINTSCSKF  430



>ref|XP_006654378.1| PREDICTED: basic 7S globulin-like [Oryza brachyantha]
Length=436

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 65/110 (59%), Gaps = 12/110 (11%)
 Frame = -1

Query  570  LSRVDPVAPXEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCL  421
            + R   VAP ++C+ G       VG  VP VE V QSE   W +   NSMV    G +CL
Sbjct  324  IPRAPAVAPFKLCYDGSKVGSTRVGPAVPTVELVFQSEAASWVVFGANSMVATKGGALCL  383

Query  420  GFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  277
            G +DGG     SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  384  GVVDGGATPETSVVIGGHMMEDNLLEFDLEGSRLGFSSSLLFRQTTCNNF  433



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690