BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF046J23

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002316767.2|  hypothetical protein POPTR_0011s09280g             120   6e-29   
gb|EPS65378.1|  hypothetical protein M569_09399                         114   7e-29   Genlisea aurea
ref|XP_011012481.1|  PREDICTED: uncharacterized protein LOC105116724    120   7e-29   Populus euphratica
ref|XP_004302887.1|  PREDICTED: uncharacterized protein LOC101313133    120   8e-29   Fragaria vesca subsp. vesca
gb|ABK96275.1|  unknown                                                 120   8e-29   Populus trichocarpa x Populus deltoides
gb|KDP39134.1|  hypothetical protein JCGZ_00891                         119   1e-28   Jatropha curcas
gb|EYU27337.1|  hypothetical protein MIMGU_mgv1a006702mg                118   3e-28   Erythranthe guttata [common monkey flower]
ref|XP_011095401.1|  PREDICTED: uncharacterized protein LOC105174869    118   3e-28   Sesamum indicum [beniseed]
ref|XP_010063011.1|  PREDICTED: uncharacterized protein LOC104450241    118   3e-28   Eucalyptus grandis [rose gum]
ref|XP_008342667.1|  PREDICTED: uncharacterized protein LOC103405443    118   5e-28   Malus domestica [apple tree]
ref|XP_009353598.1|  PREDICTED: uncharacterized protein LOC103944...    117   5e-28   Pyrus x bretschneideri [bai li]
ref|XP_002280015.1|  PREDICTED: uncharacterized protein LOC100253742    117   6e-28   Vitis vinifera
ref|XP_009353594.1|  PREDICTED: uncharacterized protein LOC103944...    117   6e-28   Pyrus x bretschneideri [bai li]
ref|XP_010097813.1|  hypothetical protein L484_000961                   117   6e-28   
ref|XP_009353597.1|  PREDICTED: uncharacterized protein LOC103944...    117   7e-28   
ref|XP_009338054.1|  PREDICTED: uncharacterized protein LOC103930437    117   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_002532562.1|  conserved hypothetical protein                     116   1e-27   Ricinus communis
ref|NP_001242486.1|  uncharacterized protein LOC100786070               116   1e-27   Glycine max [soybeans]
gb|KHM99560.1|  HAUS augmin-like complex subunit 4                      116   2e-27   Glycine soja [wild soybean]
ref|XP_006452374.1|  hypothetical protein CICLE_v10008353mg             116   2e-27   Citrus clementina [clementine]
ref|XP_007146480.1|  hypothetical protein PHAVU_006G044000g             116   2e-27   Phaseolus vulgaris [French bean]
ref|XP_003551881.1|  PREDICTED: uncharacterized protein LOC100790889    116   2e-27   Glycine max [soybeans]
ref|XP_004500070.1|  PREDICTED: uncharacterized protein LOC101512734    116   2e-27   Cicer arietinum [garbanzo]
ref|XP_009797126.1|  PREDICTED: uncharacterized protein LOC104243609    116   2e-27   Nicotiana sylvestris
gb|KJB62820.1|  hypothetical protein B456_009G438400                    114   5e-27   Gossypium raimondii
gb|KJB62817.1|  hypothetical protein B456_009G438400                    114   6e-27   Gossypium raimondii
gb|KJB62818.1|  hypothetical protein B456_009G438400                    114   7e-27   Gossypium raimondii
ref|XP_007020817.1|  HAUS augmin-like complex subunit 4 isoform 3       113   8e-27   
ref|XP_010545512.1|  PREDICTED: uncharacterized protein LOC104817858    114   9e-27   Tarenaya hassleriana [spider flower]
gb|KJB62821.1|  hypothetical protein B456_009G438500                    114   1e-26   Gossypium raimondii
ref|XP_009360993.1|  PREDICTED: uncharacterized protein LOC103951...    113   2e-26   
ref|XP_007020815.1|  HAUS augmin-like complex subunit 4 isoform 1       113   3e-26   Theobroma cacao [chocolate]
ref|XP_008447737.1|  PREDICTED: uncharacterized protein LOC103490141    113   3e-26   Cucumis melo [Oriental melon]
ref|XP_004139788.1|  PREDICTED: uncharacterized protein LOC101203307    113   3e-26   
gb|KGN44163.1|  hypothetical protein Csa_7G210080                       112   3e-26   Cucumis sativus [cucumbers]
ref|XP_009360992.1|  PREDICTED: uncharacterized protein LOC103951...    112   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_009592787.1|  PREDICTED: uncharacterized protein LOC104089563    112   5e-26   Nicotiana tomentosiformis
ref|XP_008365005.1|  PREDICTED: HAUS augmin-like complex subunit 4      110   2e-25   
ref|XP_010670158.1|  PREDICTED: uncharacterized protein LOC104887254    110   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009420825.1|  PREDICTED: uncharacterized protein LOC104000482    110   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010935259.1|  PREDICTED: uncharacterized protein LOC105055...    110   3e-25   Elaeis guineensis
ref|XP_010935260.1|  PREDICTED: uncharacterized protein LOC105055...    110   3e-25   Elaeis guineensis
ref|XP_004251462.1|  PREDICTED: uncharacterized protein LOC101257536    110   3e-25   Solanum lycopersicum
ref|XP_008781274.1|  PREDICTED: uncharacterized protein LOC103701...    110   3e-25   Phoenix dactylifera
ref|XP_008781277.1|  PREDICTED: uncharacterized protein LOC103701...    110   3e-25   Phoenix dactylifera
ref|XP_006365955.1|  PREDICTED: uncharacterized protein LOC102604282    109   4e-25   Solanum tuberosum [potatoes]
ref|XP_006858187.1|  hypothetical protein AMTR_s00062p00162950          109   4e-25   Amborella trichopoda
gb|KEH27912.1|  SKIP interacting protein                                109   4e-25   Medicago truncatula
ref|XP_003600108.1|  HAUS augmin-like complex subunit                   109   5e-25   Medicago truncatula
ref|XP_009144940.1|  PREDICTED: uncharacterized protein LOC103868607    109   5e-25   
gb|AAG51195.1|AC079279_16  unknown protein                              109   5e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002894271.1|  hypothetical protein ARALYDRAFT_474203             109   6e-25   
ref|XP_009147810.1|  PREDICTED: uncharacterized protein LOC103871323    109   6e-25   Brassica rapa
emb|CDY22815.1|  BnaA06g02620D                                          109   6e-25   Brassica napus [oilseed rape]
ref|XP_006305844.1|  hypothetical protein CARUB_v10010894mg             109   6e-25   Capsella rubella
emb|CDY37107.1|  BnaC06g03920D                                          109   6e-25   Brassica napus [oilseed rape]
ref|XP_010479537.1|  PREDICTED: uncharacterized protein LOC104758377    109   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010500647.1|  PREDICTED: uncharacterized protein LOC104777995    109   6e-25   Camelina sativa [gold-of-pleasure]
ref|NP_175486.2|  uncharacterized protein                               109   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393115.1|  hypothetical protein EUTSA_v10011513mg             109   6e-25   Eutrema salsugineum [saltwater cress]
ref|XP_010461924.1|  PREDICTED: uncharacterized protein LOC104742601    107   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_008228485.1|  PREDICTED: uncharacterized protein LOC103327892    105   9e-24   Prunus mume [ume]
ref|XP_007215411.1|  hypothetical protein PRUPE_ppa005986mg             105   9e-24   Prunus persica
ref|XP_010276096.1|  PREDICTED: uncharacterized protein LOC104610933    103   6e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010278680.1|  PREDICTED: uncharacterized protein LOC104612800    103   7e-23   Nelumbo nucifera [Indian lotus]
ref|XP_008226896.1|  PREDICTED: HAUS augmin-like complex subunit ...    102   1e-22   Prunus mume [ume]
ref|XP_008226895.1|  PREDICTED: HAUS augmin-like complex subunit ...    102   1e-22   Prunus mume [ume]
ref|XP_008226894.1|  PREDICTED: HAUS augmin-like complex subunit ...    102   1e-22   Prunus mume [ume]
ref|XP_007213462.1|  hypothetical protein PRUPE_ppa024388mg             102   1e-22   Prunus persica
emb|CDP04568.1|  unnamed protein product                              99.8    1e-21   Coffea canephora [robusta coffee]
dbj|BAJ90177.1|  predicted protein                                    99.4    2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573417.1|  PREDICTED: uncharacterized protein LOC100821831  99.4    2e-21   
gb|KFK35913.1|  hypothetical protein AALP_AA4G052600                  99.0    3e-21   Arabis alpina [alpine rockcress]
ref|XP_002453194.1|  hypothetical protein SORBIDRAFT_04g001450        98.6    3e-21   Sorghum bicolor [broomcorn]
ref|XP_004952114.1|  PREDICTED: uncharacterized protein LOC101756520  98.6    5e-21   Setaria italica
emb|CDP05762.1|  unnamed protein product                              97.8    8e-21   Coffea canephora [robusta coffee]
ref|NP_001045698.1|  Os02g0119100                                     95.5    1e-20   
ref|XP_006646792.1|  PREDICTED: uncharacterized protein LOC102709140  96.3    1e-20   
gb|ACG37880.1|  hypothetical protein                                  94.7    2e-20   Zea mays [maize]
gb|EAZ21518.1|  hypothetical protein OsJ_05142                        96.3    3e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84227.1|  hypothetical protein OsI_05607                        96.3    3e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_004295822.1|  PREDICTED: uncharacterized protein LOC101299752  95.5    4e-20   Fragaria vesca subsp. vesca
gb|AFW69843.2|  hypothetical protein ZEAMMB73_576256                  94.7    5e-20   
gb|ACN31535.1|  unknown                                               95.1    7e-20   Zea mays [maize]
ref|XP_002989789.1|  hypothetical protein SELMODRAFT_235871           86.3    8e-17   
ref|XP_002990133.1|  hypothetical protein SELMODRAFT_235950           86.3    1e-16   
ref|XP_001768748.1|  predicted protein                                79.3    4e-14   
gb|EMS60102.1|  hypothetical protein TRIUR3_07799                     69.7    9e-11   Triticum urartu
gb|KHG14666.1|  HAUS augmin-like complex subunit 4                    56.2    2e-06   Gossypium arboreum [tree cotton]



>ref|XP_002316767.2| hypothetical protein POPTR_0011s09280g [Populus trichocarpa]
 gb|EEE97379.2| hypothetical protein POPTR_0011s09280g [Populus trichocarpa]
Length=376

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLKRLP 
Sbjct  313  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLKRLPD  372

Query  323  YPGA  312
            +P A
Sbjct  373  HPRA  376



>gb|EPS65378.1| hypothetical protein M569_09399, partial [Genlisea aurea]
Length=131

 Score =   114 bits (286),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            ESTEEASLAYNKA TRLREYQGVDPHFD IA+QYHDIVKKLENM+WTIQQVEMDL R P
Sbjct  72   ESTEEASLAYNKAVTRLREYQGVDPHFDSIAKQYHDIVKKLENMQWTIQQVEMDLNRSP  130



>ref|XP_011012481.1| PREDICTED: uncharacterized protein LOC105116724 [Populus euphratica]
Length=430

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLKRLP 
Sbjct  367  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLKRLPD  426

Query  323  YPGA  312
            +P A
Sbjct  427  HPRA  430



>ref|XP_004302887.1| PREDICTED: uncharacterized protein LOC101313133 [Fragaria vesca 
subsp. vesca]
Length=434

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTIQQVEMDLKRLP 
Sbjct  371  EATEEASMAYNKAVTRLREYQGVDPHFDNIARQYHDIVKKLENMQWTIQQVEMDLKRLPD  430

Query  323  YPGA  312
            +  A
Sbjct  431  HANA  434



>gb|ABK96275.1| unknown [Populus trichocarpa x Populus deltoides]
Length=429

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLKRLP 
Sbjct  366  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLKRLPD  425

Query  323  YPGA  312
            +P A
Sbjct  426  HPRA  429



>gb|KDP39134.1| hypothetical protein JCGZ_00891 [Jatropha curcas]
Length=435

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEEAS+AYNKAATRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLKRLP
Sbjct  372  EATEEASMAYNKAATRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLKRLP  430



>gb|EYU27337.1| hypothetical protein MIMGU_mgv1a006702mg [Erythranthe guttata]
Length=434

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  518  KEIFGESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  339
            ++   ESTEEASL+YNKA TRLREYQGVDPHFD IARQYH+IVKKLENM+WTI QVEMDL
Sbjct  366  RKFLVESTEEASLSYNKAVTRLREYQGVDPHFDTIARQYHEIVKKLENMQWTIHQVEMDL  425

Query  338  KRLPAYP  318
            KRLP +P
Sbjct  426  KRLPDHP  432



>ref|XP_011095401.1| PREDICTED: uncharacterized protein LOC105174869 [Sesamum indicum]
Length=433

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            ESTEEASLAYNKA TRLREYQGVD HFD IARQYHDIVKKLENM+WTI QVEMDLKRLP 
Sbjct  370  ESTEEASLAYNKAVTRLREYQGVDAHFDTIARQYHDIVKKLENMQWTIHQVEMDLKRLPD  429

Query  323  YPG  315
            +P 
Sbjct  430  HPS  432



>ref|XP_010063011.1| PREDICTED: uncharacterized protein LOC104450241 [Eucalyptus grandis]
 gb|KCW70186.1| hypothetical protein EUGRSUZ_F03470 [Eucalyptus grandis]
Length=436

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLKR+P 
Sbjct  373  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLKRMPD  432

Query  323  YPG  315
            +P 
Sbjct  433  HPN  435



>ref|XP_008342667.1| PREDICTED: uncharacterized protein LOC103405443 [Malus domestica]
Length=430

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDI+KKLENM+WTI QVEMDLKRLP 
Sbjct  367  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIIKKLENMQWTIHQVEMDLKRLPD  426

Query  323  YPGA  312
            +  A
Sbjct  427  HANA  430



>ref|XP_009353598.1| PREDICTED: uncharacterized protein LOC103944849 isoform X3 [Pyrus 
x bretschneideri]
Length=400

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDI+KKLENM+WTI QVEMDLKRLP 
Sbjct  337  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIIKKLENMQWTIHQVEMDLKRLPD  396

Query  323  YPGA  312
            +  A
Sbjct  397  HANA  400



>ref|XP_002280015.1| PREDICTED: uncharacterized protein LOC100253742 [Vitis vinifera]
 emb|CBI26640.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYH+IVKKLENM+WTI QVEMDLKRLP 
Sbjct  374  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHEIVKKLENMQWTIHQVEMDLKRLPD  433

Query  323  YPG  315
            +P 
Sbjct  434  HPS  436



>ref|XP_009353594.1| PREDICTED: uncharacterized protein LOC103944849 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009353595.1| PREDICTED: uncharacterized protein LOC103944849 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009353596.1| PREDICTED: uncharacterized protein LOC103944849 isoform X1 [Pyrus 
x bretschneideri]
Length=435

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDI+KKLENM+WTI QVEMDLKRLP 
Sbjct  372  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIIKKLENMQWTIHQVEMDLKRLPD  431

Query  323  YPGA  312
            +  A
Sbjct  432  HANA  435



>ref|XP_010097813.1| hypothetical protein L484_000961 [Morus notabilis]
 gb|EXB72071.1| hypothetical protein L484_000961 [Morus notabilis]
Length=408

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  518  KEIFGESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  339
            ++  GE+TEEAS+AYNKA TRLREYQGVDPHFD IA+QY DIVKKLE M+WTI QVEMDL
Sbjct  340  RKYLGEATEEASIAYNKAVTRLREYQGVDPHFDNIAKQYRDIVKKLETMQWTIHQVEMDL  399

Query  338  KRLPAYPGA  312
            KRLP +P A
Sbjct  400  KRLPDHPNA  408



>ref|XP_009353597.1| PREDICTED: uncharacterized protein LOC103944849 isoform X2 [Pyrus 
x bretschneideri]
Length=407

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDI+KKLENM+WTI QVEMDLKRLP 
Sbjct  344  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIIKKLENMQWTIHQVEMDLKRLPD  403

Query  323  YPGA  312
            +  A
Sbjct  404  HANA  407



>ref|XP_009338054.1| PREDICTED: uncharacterized protein LOC103930437 [Pyrus x bretschneideri]
 ref|XP_009338055.1| PREDICTED: uncharacterized protein LOC103930438 [Pyrus x bretschneideri]
Length=430

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDI+KKLENM+WTI QVEMDLKRLP
Sbjct  367  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIIKKLENMQWTIHQVEMDLKRLP  425



>ref|XP_002532562.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29823.1| conserved hypothetical protein [Ricinus communis]
Length=432

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVK+LE+M+WTI QVEMDLKRLP 
Sbjct  369  EATEEASMAYNKAVTRLREYQGVDPHFDTIARQYHDIVKRLESMQWTIHQVEMDLKRLPD  428

Query  323  YPG  315
            +P 
Sbjct  429  HPS  431



>ref|NP_001242486.1| uncharacterized protein LOC100786070 [Glycine max]
 gb|ACU20702.1| unknown [Glycine max]
Length=425

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIV+KLENM+WTI QVEMDLKRLP 
Sbjct  362  EATEEASIAYNKAVTRLREYQGVDPHFDNIARQYHDIVQKLENMQWTIHQVEMDLKRLPD  421

Query  323  YPG  315
             P 
Sbjct  422  KPS  424



>gb|KHM99560.1| HAUS augmin-like complex subunit 4 [Glycine soja]
Length=425

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIV+KLENM+WTI QVEMDLKRLP 
Sbjct  362  EATEEASIAYNKAVTRLREYQGVDPHFDNIARQYHDIVQKLENMQWTIHQVEMDLKRLPD  421

Query  323  YPG  315
             P 
Sbjct  422  KPS  424



>ref|XP_006452374.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
 ref|XP_006475067.1| PREDICTED: uncharacterized protein LOC102629463 [Citrus sinensis]
 gb|ESR65614.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
 gb|KDO62727.1| hypothetical protein CISIN_1g014093mg [Citrus sinensis]
Length=431

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDP FD IARQYHDIVKKLENM+WTI QVEMDLKRLP 
Sbjct  368  EATEEASVAYNKAVTRLREYQGVDPRFDNIARQYHDIVKKLENMQWTIHQVEMDLKRLPD  427

Query  323  YPGA  312
            +P +
Sbjct  428  HPSS  431



>ref|XP_007146480.1| hypothetical protein PHAVU_006G044000g [Phaseolus vulgaris]
 gb|ESW18474.1| hypothetical protein PHAVU_006G044000g [Phaseolus vulgaris]
Length=425

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIV+KLENM+WTI QVEMDLKRLP 
Sbjct  362  EATEEASIAYNKAVTRLREYQGVDPHFDNIARQYHDIVQKLENMQWTIHQVEMDLKRLPD  421

Query  323  YPGA  312
             P  
Sbjct  422  KPST  425



>ref|XP_003551881.1| PREDICTED: uncharacterized protein LOC100790889 [Glycine max]
 gb|KHN02840.1| HAUS augmin-like complex subunit 4 [Glycine soja]
Length=425

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIV+KLENM+WTI QVEMDLKRLP 
Sbjct  362  EATEEASIAYNKAVTRLREYQGVDPHFDNIARQYHDIVQKLENMQWTIHQVEMDLKRLPD  421

Query  323  YPG  315
             P 
Sbjct  422  KPN  424



>ref|XP_004500070.1| PREDICTED: uncharacterized protein LOC101512734 [Cicer arietinum]
Length=431

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLKRLP
Sbjct  368  EATEEASIAYNKAVTRLREYQGVDPHFDNIARQYHDIVKKLENMQWTIDQVEMDLKRLP  426



>ref|XP_009797126.1| PREDICTED: uncharacterized protein LOC104243609 [Nicotiana sylvestris]
Length=433

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEASLAY KAA RLREYQGVDPHFD IARQYHDIVKKLE+M+WTI QVEMDL  LPA
Sbjct  370  EATEEASLAYEKAAARLREYQGVDPHFDEIARQYHDIVKKLESMQWTINQVEMDLNPLPA  429

Query  323  YPGA  312
            +PGA
Sbjct  430  HPGA  433



>gb|KJB62820.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=380

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHD+VKKLENM+WTI QVEMDLKRLP
Sbjct  317  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDVVKKLENMQWTIHQVEMDLKRLP  375



>gb|KJB62817.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=402

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHD+VKKLENM+WTI QVEMDLKRLP
Sbjct  339  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDVVKKLENMQWTIHQVEMDLKRLP  397



>gb|KJB62818.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=425

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHD+VKKLENM+WTI QVEMDLKRLP
Sbjct  362  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDVVKKLENMQWTIHQVEMDLKRLP  420



>ref|XP_007020817.1| HAUS augmin-like complex subunit 4 isoform 3 [Theobroma cacao]
 gb|EOY12342.1| HAUS augmin-like complex subunit 4 isoform 3 [Theobroma cacao]
Length=313

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYH+IVKKLENM+WTI QVEMDLKRLP
Sbjct  250  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHEIVKKLENMQWTIHQVEMDLKRLP  308



>ref|XP_010545512.1| PREDICTED: uncharacterized protein LOC104817858 [Tarenaya hassleriana]
Length=427

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIV+KLENM+WTI QVEMDLKRLP
Sbjct  367  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVQKLENMQWTIHQVEMDLKRLP  425



>gb|KJB62821.1| hypothetical protein B456_009G438500 [Gossypium raimondii]
Length=418

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHD+VKKLENM+WTI QVEMDLKRLP
Sbjct  355  EATEEASPAYNKAVTRLREYQGVDPHFDTIARQYHDVVKKLENMQWTIHQVEMDLKRLP  413



>ref|XP_009360993.1| PREDICTED: uncharacterized protein LOC103951362 isoform X2 [Pyrus 
x bretschneideri]
Length=339

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  509  FGESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRL  330
              ++TEEAS+ YNKA TRL EYQGVDPHFD IARQY DIVKKLENM WTI QVEMDLKRL
Sbjct  274  LTDATEEASVTYNKAVTRLHEYQGVDPHFDQIARQYRDIVKKLENMNWTIHQVEMDLKRL  333

Query  329  PAYPGA  312
            P +P A
Sbjct  334  PDHPNA  339



>ref|XP_007020815.1| HAUS augmin-like complex subunit 4 isoform 1 [Theobroma cacao]
 gb|EOY12340.1| HAUS augmin-like complex subunit 4 isoform 1 [Theobroma cacao]
Length=420

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYH+IVKKLENM+WTI QVEMDLKRLP
Sbjct  357  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHEIVKKLENMQWTIHQVEMDLKRLP  415



>ref|XP_008447737.1| PREDICTED: uncharacterized protein LOC103490141 [Cucumis melo]
Length=430

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEEAS++YNKA TRLREYQGVDPHFD IARQYHDIV KLENM+WTI QVEMDLKRLP
Sbjct  367  EATEEASISYNKAVTRLREYQGVDPHFDNIARQYHDIVMKLENMQWTIHQVEMDLKRLP  425



>ref|XP_004139788.1| PREDICTED: uncharacterized protein LOC101203307 [Cucumis sativus]
 ref|XP_004166476.1| PREDICTED: uncharacterized LOC101203307 [Cucumis sativus]
Length=438

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEEAS++YNKA TRLREYQGVDPHFD IARQYHDIV KL+NM+WTI QVEMDLKRLP
Sbjct  367  EATEEASISYNKAVTRLREYQGVDPHFDTIARQYHDIVMKLDNMQWTIHQVEMDLKRLP  425



>gb|KGN44163.1| hypothetical protein Csa_7G210080 [Cucumis sativus]
Length=430

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEEAS++YNKA TRLREYQGVDPHFD IARQYHDIV KL+NM+WTI QVEMDLKRLP
Sbjct  367  EATEEASISYNKAVTRLREYQGVDPHFDTIARQYHDIVMKLDNMQWTIHQVEMDLKRLP  425



>ref|XP_009360992.1| PREDICTED: uncharacterized protein LOC103951362 isoform X1 [Pyrus 
x bretschneideri]
Length=409

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  518  KEIFGESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  339
            ++   ++TEEAS+ YNKA TRL EYQGVDPHFD IARQY DIVKKLENM WTI QVEMDL
Sbjct  341  RKYLTDATEEASVTYNKAVTRLHEYQGVDPHFDQIARQYRDIVKKLENMNWTIHQVEMDL  400

Query  338  KRLPAYPGA  312
            KRLP +P A
Sbjct  401  KRLPDHPNA  409



>ref|XP_009592787.1| PREDICTED: uncharacterized protein LOC104089563 [Nicotiana tomentosiformis]
Length=433

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEASLAY KAA RLREYQGVDPHFD IARQYHDIVKKLE+M+WTI QVEMDL  LPA
Sbjct  370  EATEEASLAYEKAAARLREYQGVDPHFDEIARQYHDIVKKLESMQWTINQVEMDLNPLPA  429

Query  323  YPGA  312
            +P A
Sbjct  430  HPRA  433



>ref|XP_008365005.1| PREDICTED: HAUS augmin-like complex subunit 4 [Malus domestica]
Length=409

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  518  KEIFGESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  339
            ++   ++TEEAS+ YNKA TRL EYQGVDPHFD IAR+Y DIVKKLENM WTI QVEMDL
Sbjct  341  RKYLTDATEEASVTYNKAVTRLHEYQGVDPHFDQIARRYRDIVKKLENMNWTIHQVEMDL  400

Query  338  KRLPAYPGA  312
            KRLP +P A
Sbjct  401  KRLPDHPNA  409



>ref|XP_010670158.1| PREDICTED: uncharacterized protein LOC104887254 [Beta vulgaris 
subsp. vulgaris]
Length=430

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+TEE+S AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTIQ+VEMDL  LP
Sbjct  367  EATEESSTAYNKAVTRLREYQGVDPHFDSIARQYHDIVKKLENMQWTIQEVEMDLNYLP  425



>ref|XP_009420825.1| PREDICTED: uncharacterized protein LOC104000482 [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  333
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLE M+WTI QVEMDLKR
Sbjct  371  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLEGMQWTIHQVEMDLKR  427



>ref|XP_010935259.1| PREDICTED: uncharacterized protein LOC105055203 isoform X1 [Elaeis 
guineensis]
Length=436

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  333
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLE M+WTI QVEMDLKR
Sbjct  373  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLEGMQWTIHQVEMDLKR  429



>ref|XP_010935260.1| PREDICTED: uncharacterized protein LOC105055203 isoform X2 [Elaeis 
guineensis]
Length=435

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  333
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLE M+WTI QVEMDLKR
Sbjct  372  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLEGMQWTIHQVEMDLKR  428



>ref|XP_004251462.1| PREDICTED: uncharacterized protein LOC101257536 [Solanum lycopersicum]
Length=427

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEASLAY KAA+RLREYQGVDPHFD IARQYHDIVKKLE+M+WTI QVEMDL  LPA
Sbjct  364  EATEEASLAYEKAASRLREYQGVDPHFDEIARQYHDIVKKLESMQWTINQVEMDLNPLPA  423

Query  323  Y  321
            +
Sbjct  424  H  424



>ref|XP_008781274.1| PREDICTED: uncharacterized protein LOC103701092 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008781275.1| PREDICTED: uncharacterized protein LOC103701092 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008781276.1| PREDICTED: uncharacterized protein LOC103701092 isoform X1 [Phoenix 
dactylifera]
Length=434

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  333
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLE M+WTI QVEMDLKR
Sbjct  371  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLEGMQWTIHQVEMDLKR  427



>ref|XP_008781277.1| PREDICTED: uncharacterized protein LOC103701092 isoform X2 [Phoenix 
dactylifera]
Length=433

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  333
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLE M+WTI QVEMDLKR
Sbjct  370  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLEGMQWTIHQVEMDLKR  426



>ref|XP_006365955.1| PREDICTED: uncharacterized protein LOC102604282 [Solanum tuberosum]
Length=433

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEASLAY KAA+RLREYQGVDPHFD IARQYHDIVKKLE+M+WTI QVEMDL  LPA
Sbjct  370  EATEEASLAYEKAASRLREYQGVDPHFDEIARQYHDIVKKLESMQWTINQVEMDLNPLPA  429

Query  323  Y  321
            +
Sbjct  430  H  430



>ref|XP_006858187.1| hypothetical protein AMTR_s00062p00162950 [Amborella trichopoda]
 gb|ERN19654.1| hypothetical protein AMTR_s00062p00162950 [Amborella trichopoda]
Length=435

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDI++KLE M+WTI+QVEMDLKR   
Sbjct  372  EATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDILQKLEEMQWTIRQVEMDLKRTME  431

Query  323  YP  318
            +P
Sbjct  432  HP  433



>gb|KEH27912.1| SKIP interacting protein [Medicago truncatula]
Length=424

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRL  330
            E+TEEAS+AYNKAATRLREYQGVDPHFD IARQYHD+VKKLENM+WTI QVE DLKR+
Sbjct  367  EATEEASIAYNKAATRLREYQGVDPHFDDIARQYHDVVKKLENMQWTINQVEDDLKRM  424



>ref|XP_003600108.1| HAUS augmin-like complex subunit [Medicago truncatula]
 gb|AES70359.1| SKIP interacting protein [Medicago truncatula]
Length=424

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRL  330
            E+TEEAS+AYNKAATRLREYQGVDPHFD IARQYHD+VKKLENM+WTI QVE DLKR+
Sbjct  367  EATEEASIAYNKAATRLREYQGVDPHFDDIARQYHDVVKKLENMQWTINQVEDDLKRM  424



>ref|XP_009144940.1| PREDICTED: uncharacterized protein LOC103868607 [Brassica rapa]
 emb|CDY29600.1| BnaA05g15700D [Brassica napus]
Length=406

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLK
Sbjct  348  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLK  403



>gb|AAG51195.1|AC079279_16 unknown protein [Arabidopsis thaliana]
Length=420

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLK
Sbjct  362  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLK  417



>ref|XP_002894271.1| hypothetical protein ARALYDRAFT_474203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70530.1| hypothetical protein ARALYDRAFT_474203 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLK
Sbjct  365  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLK  420



>ref|XP_009147810.1| PREDICTED: uncharacterized protein LOC103871323 [Brassica rapa]
Length=419

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLK
Sbjct  361  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLK  416



>emb|CDY22815.1| BnaA06g02620D [Brassica napus]
Length=419

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLK
Sbjct  361  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLK  416



>ref|XP_006305844.1| hypothetical protein CARUB_v10010894mg [Capsella rubella]
 gb|EOA38742.1| hypothetical protein CARUB_v10010894mg [Capsella rubella]
Length=423

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLK
Sbjct  365  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLK  420



>emb|CDY37107.1| BnaC06g03920D [Brassica napus]
Length=419

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLK
Sbjct  361  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLK  416



>ref|XP_010479537.1| PREDICTED: uncharacterized protein LOC104758377 [Camelina sativa]
Length=423

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLK
Sbjct  365  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLK  420



>ref|XP_010500647.1| PREDICTED: uncharacterized protein LOC104777995 [Camelina sativa]
Length=423

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLK
Sbjct  365  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLK  420



>ref|NP_175486.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42179.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63929.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32582.1| uncharacterized protein AT1G50710 [Arabidopsis thaliana]
Length=423

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLK
Sbjct  365  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLK  420



>ref|XP_006393115.1| hypothetical protein EUTSA_v10011513mg [Eutrema salsugineum]
 gb|ESQ30401.1| hypothetical protein EUTSA_v10011513mg [Eutrema salsugineum]
Length=423

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLK
Sbjct  365  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLK  420



>ref|XP_010461924.1| PREDICTED: uncharacterized protein LOC104742601 [Camelina sativa]
Length=423

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQYH+IVKKLENM+WTI QVEMDLK
Sbjct  365  EATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHEIVKKLENMQWTIHQVEMDLK  420



>ref|XP_008228485.1| PREDICTED: uncharacterized protein LOC103327892 [Prunus mume]
Length=433

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  339
            E+T+EAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI Q+EMDL
Sbjct  371  EATDEASIAYNKAVTRLREYQGVDPHFDSIARQYHDIVKKLENMQWTIDQIEMDL  425



>ref|XP_007215411.1| hypothetical protein PRUPE_ppa005986mg [Prunus persica]
 gb|EMJ16610.1| hypothetical protein PRUPE_ppa005986mg [Prunus persica]
Length=433

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  339
            E+T+EAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI Q+EMDL
Sbjct  371  EATDEASIAYNKAVTRLREYQGVDPHFDSIARQYHDIVKKLENMQWTIDQIEMDL  425



>ref|XP_010276096.1| PREDICTED: uncharacterized protein LOC104610933 [Nelumbo nucifera]
Length=430

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+T+EA++AYNKA TRLREYQGVDPHFD IA+QY DIVKKLE M+WTI QVEMDL R P
Sbjct  370  EATKEATIAYNKAVTRLREYQGVDPHFDTIAKQYQDIVKKLEGMQWTIHQVEMDLNRSP  428



>ref|XP_010278680.1| PREDICTED: uncharacterized protein LOC104612800 [Nelumbo nucifera]
 ref|XP_010278681.1| PREDICTED: uncharacterized protein LOC104612800 [Nelumbo nucifera]
Length=434

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  333
            E+T+EAS+AY+K  TRLREYQGVDPHFD IARQYHDIVKKLE M+W I QVEMDLKR
Sbjct  371  EATKEASIAYSKVVTRLREYQGVDPHFDTIARQYHDIVKKLEGMQWAIHQVEMDLKR  427



>ref|XP_008226896.1| PREDICTED: HAUS augmin-like complex subunit 4 isoform X3 [Prunus 
mume]
Length=380

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            ++T+EA   Y+KA TRLREYQ VDPHFD IARQYHDIVK+LENM+WTI QVEMDLK LP 
Sbjct  317  DATKEADATYDKAITRLREYQDVDPHFDKIARQYHDIVKELENMQWTIHQVEMDLKHLPD  376

Query  323  YPGA  312
             P A
Sbjct  377  QPNA  380



>ref|XP_008226895.1| PREDICTED: HAUS augmin-like complex subunit 4 isoform X2 [Prunus 
mume]
Length=414

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            ++T+EA   Y+KA TRLREYQ VDPHFD IARQYHDIVK+LENM+WTI QVEMDLK LP 
Sbjct  351  DATKEADATYDKAITRLREYQDVDPHFDKIARQYHDIVKELENMQWTIHQVEMDLKHLPD  410

Query  323  YPGA  312
             P A
Sbjct  411  QPNA  414



>ref|XP_008226894.1| PREDICTED: HAUS augmin-like complex subunit 4 isoform X1 [Prunus 
mume]
Length=415

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            ++T+EA   Y+KA TRLREYQ VDPHFD IARQYHDIVK+LENM+WTI QVEMDLK LP 
Sbjct  352  DATKEADATYDKAITRLREYQDVDPHFDKIARQYHDIVKELENMQWTIHQVEMDLKHLPD  411

Query  323  YPGA  312
             P A
Sbjct  412  QPNA  415



>ref|XP_007213462.1| hypothetical protein PRUPE_ppa024388mg [Prunus persica]
 gb|EMJ14661.1| hypothetical protein PRUPE_ppa024388mg [Prunus persica]
Length=414

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            ++T+EA   Y+KA TRLREYQ VDPHFD IARQYHDIVK+LENM+WTI QVEMDLK LP 
Sbjct  351  DATKEADATYDKAITRLREYQDVDPHFDKIARQYHDIVKELENMQWTIHQVEMDLKHLPD  410

Query  323  YPGA  312
             P A
Sbjct  411  QPNA  414



>emb|CDP04568.1| unnamed protein product [Coffea canephora]
Length=427

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 2/57 (4%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  333
            +ST+EASLAYNKA TRLREYQGVDPHFD IARQYH+I  KLEN+RWTI QVEMDL R
Sbjct  371  DSTDEASLAYNKAVTRLREYQGVDPHFDSIARQYHEI--KLENLRWTIHQVEMDLNR  425



>dbj|BAJ90177.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91025.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86731.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=429

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+T+EAS +YN+A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  370  EATKEASNSYNEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  425



>ref|XP_003573417.1| PREDICTED: uncharacterized protein LOC100821831 [Brachypodium 
distachyon]
Length=419

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 2/60 (3%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+T+EAS +YN+A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK  PA
Sbjct  360  EATKEASNSYNEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK--PA  417



>gb|KFK35913.1| hypothetical protein AALP_AA4G052600 [Arabis alpina]
Length=421

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  333
            E+TEEAS AYNKA TRLREYQGVDPHFD IARQY DIVKKL NM+WTI Q+E DL +
Sbjct  365  EATEEASAAYNKAVTRLREYQGVDPHFDAIARQYQDIVKKLANMQWTIDQLESDLNK  421



>ref|XP_002453194.1| hypothetical protein SORBIDRAFT_04g001450 [Sorghum bicolor]
 gb|EES06170.1| hypothetical protein SORBIDRAFT_04g001450 [Sorghum bicolor]
Length=424

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+T+EAS +YN+A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  361  EATKEASNSYNEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  416



>ref|XP_004952114.1| PREDICTED: uncharacterized protein LOC101756520 [Setaria italica]
Length=425

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+T+EAS +YN+A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  362  EATKEASNSYNEAISRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  417



>emb|CDP05762.1| unnamed protein product [Coffea canephora]
Length=427

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 2/57 (4%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  333
            +S +EASLAYNKA TRLREYQGVDPHFD IARQYH+I  KLEN+RWTI QVEMDL R
Sbjct  371  DSADEASLAYNKAVTRLREYQGVDPHFDSIARQYHEI--KLENLRWTIHQVEMDLNR  425



>ref|NP_001045698.1| Os02g0119100 [Oryza sativa Japonica Group]
 dbj|BAF07612.1| Os02g0119100, partial [Oryza sativa Japonica Group]
Length=227

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+T+EAS +Y +A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  164  EATKEASNSYTEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  219



>ref|XP_006646792.1| PREDICTED: uncharacterized protein LOC102709140 [Oryza brachyantha]
Length=360

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+T+EAS +Y +A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  297  EATKEASNSYTEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  352



>gb|ACG37880.1| hypothetical protein [Zea mays]
Length=218

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+T+EAS +YN+A +RLREYQGVDP FD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  155  EATKEASNSYNEAVSRLREYQGVDPRFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  210



>gb|EAZ21518.1| hypothetical protein OsJ_05142 [Oryza sativa Japonica Group]
Length=428

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+T+EAS +Y +A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  365  EATKEASNSYTEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  420



>gb|EAY84227.1| hypothetical protein OsI_05607 [Oryza sativa Indica Group]
 gb|ACA64829.1| SKIP interacting protein 9 [Oryza sativa]
Length=428

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+T+EAS +Y +A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  365  EATKEASNSYTEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  420



>ref|XP_004295822.1| PREDICTED: uncharacterized protein LOC101299752 [Fragaria vesca 
subsp. vesca]
Length=409

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  327
            E+T+EAS+ ++KA TRLREYQ VD  F+ IARQYHDIV+KLENM+WTIQQVEMDLKR P
Sbjct  350  EATKEASITHDKAVTRLREYQSVDADFNKIARQYHDIVQKLENMQWTIQQVEMDLKRPP  408



>gb|AFW69843.2| hypothetical protein ZEAMMB73_576256 [Zea mays]
Length=353

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+T+EAS +YN+A +RLREYQGVDP FD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  290  EATKEASNSYNEAVSRLREYQGVDPRFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  345



>gb|ACN31535.1| unknown [Zea mays]
Length=422

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  336
            E+T+EAS +YN+A +RLREYQGVDP FD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  359  EATKEASNSYNEAVSRLREYQGVDPRFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  414



>ref|XP_002989789.1| hypothetical protein SELMODRAFT_235871 [Selaginella moellendorffii]
 gb|EFJ09056.1| hypothetical protein SELMODRAFT_235871 [Selaginella moellendorffii]
Length=392

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  339
            E+ +EA+  YN+A TRLREYQGVD +FD IAR+YHD+VKKLE ++WTI+QVEMDL
Sbjct  332  EADDEATAGYNRAVTRLREYQGVDQYFDDIARRYHDVVKKLEGIQWTIRQVEMDL  386



>ref|XP_002990133.1| hypothetical protein SELMODRAFT_235950 [Selaginella moellendorffii]
 gb|EFJ08850.1| hypothetical protein SELMODRAFT_235950 [Selaginella moellendorffii]
Length=401

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  339
            E+ +EA+  YN+A TRLREYQGVD +FD IAR+YHD+VKKLE ++WTI+QVEMDL
Sbjct  341  EADDEATAGYNRAVTRLREYQGVDQYFDDIARRYHDVVKKLEGIQWTIRQVEMDL  395



>ref|XP_001768748.1| predicted protein [Physcomitrella patens]
 gb|EDQ66480.1| predicted protein [Physcomitrella patens]
Length=433

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPA  324
            E+ EEA+ AYN+A TRLREYQGVD  FD IAR+YHD+V KL  ++WTI++VE DL     
Sbjct  370  EANEEATAAYNRAVTRLREYQGVDQDFDEIARRYHDLVTKLVGIQWTIREVEKDLSNPHE  429

Query  323  YP  318
            +P
Sbjct  430  HP  431



>gb|EMS60102.1| hypothetical protein TRIUR3_07799 [Triticum urartu]
Length=487

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVK  387
            E+T+EAS +YN+A +RLREYQGVDPHFD+IARQYH+IVK
Sbjct  273  EATKEASNSYNEAVSRLREYQGVDPHFDVIARQYHEIVK  311



>gb|KHG14666.1| HAUS augmin-like complex subunit 4 [Gossypium arboreum]
Length=360

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  503  ESTEEASLAYNKAATRLREYQGVDPHFDM  417
            E+TEEAS AYNKA TRLREYQGVDPHF++
Sbjct  322  EATEEASAAYNKAVTRLREYQGVDPHFEL  350



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000