BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF046E04

Length=509
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011100602.1|  PREDICTED: chlorophyll a-b binding protein 5...    262   8e-85   Sesamum indicum [beniseed]
gb|AHI85722.1|  stress-induced protein 17                               257   1e-84   Capsicum annuum
dbj|BAE46383.1|  chlorophyll a/b binding protein                        261   2e-84   Panax ginseng [Asiatic ginseng]
ref|XP_009626274.1|  PREDICTED: chlorophyll a-b binding protein 3...    261   2e-84   Nicotiana tomentosiformis
ref|XP_006352013.1|  PREDICTED: chlorophyll a-b binding protein 3...    261   3e-84   Solanum tuberosum [potatoes]
sp|P27494.1|CB23_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    260   4e-84   Nicotiana tabacum [American tobacco]
emb|CAA84525.1|  chlorophyll a,b binding protein type I                 260   5e-84   Solanum tuberosum [potatoes]
ref|XP_004251540.1|  PREDICTED: chlorophyll a-b binding protein 5...    260   5e-84   
ref|XP_009630805.1|  PREDICTED: chlorophyll a-b binding protein 3...    260   5e-84   Nicotiana tomentosiformis
gb|AEK26372.1|  chloroplast photosystem II chlorophyll a/b bindin...    260   6e-84   Sedum alfredii
ref|XP_002531690.1|  chlorophyll A/B binding protein, putative          260   7e-84   Ricinus communis
sp|P12062.1|CB26_PETSP  RecName: Full=Chlorophyll a-b binding pro...    260   7e-84   Petunia sp.
gb|AEW70716.1|  light harvesting chlorophyll a-b binding protein 2-1    259   8e-84   Phyllostachys edulis [kikko-chiku]
sp|P14279.1|CB25_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    258   8e-84   Solanum lycopersicum
ref|NP_001050586.1|  Os03g0592500                                       259   9e-84   
gb|ABF97414.1|  Chlorophyll a-b binding protein, chloroplast prec...    258   1e-83   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009802594.1|  PREDICTED: chlorophyll a-b binding protein 3...    259   1e-83   Nicotiana sylvestris
gb|AFV34723.1|  light harvesting chlorophyll a/b-binding protein 2-1    259   1e-83   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_010270182.1|  PREDICTED: chlorophyll a-b binding protein 1...    259   1e-83   Nelumbo nucifera [Indian lotus]
gb|ABR25974.1|  chloroplast chlorophyll a-b binding protein precu...    258   1e-83   Oryza sativa Indica Group [Indian rice]
gb|AHC95482.1|  chlorophyll A/B binding protein                         259   1e-83   Ziziphus jujuba [Chinese jujube]
ref|XP_008462084.1|  PREDICTED: chlorophyll a-b binding protein 1...    259   2e-83   Cucumis melo [Oriental melon]
gb|ABO10493.1|  light-harvesting chlorophyll a/b binding protein        259   2e-83   Bambusa oldhamii
gb|AEY78525.1|  chlorophyll a/b-binding protein                         259   2e-83   Tagetes erecta [big marigold]
ref|XP_004144543.1|  PREDICTED: chlorophyll a-b binding protein 1...    259   2e-83   Cucumis sativus [cucumbers]
ref|XP_006836754.1|  hypothetical protein AMTR_s00088p00153020          258   3e-83   Amborella trichopoda
gb|EYU42755.1|  hypothetical protein MIMGU_mgv1a011961mg                258   4e-83   Erythranthe guttata [common monkey flower]
ref|XP_006664981.1|  PREDICTED: chlorophyll a-b binding protein, ...    258   4e-83   Oryza brachyantha
gb|AAC15992.1|  chlorophyll a/b binding protein                         258   4e-83   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982492.1|  PREDICTED: chlorophyll a-b binding protein, ...    258   4e-83   Setaria italica
gb|AFO67217.1|  putative chlorophyll a/b binding protein                258   5e-83   Aralia elata
gb|ABR17446.1|  unknown                                                 254   5e-83   Picea sitchensis
dbj|BAA00537.1|  type II light-harvesting chlorophyll a/b-binding...    257   6e-83   Oryza sativa Japonica Group [Japonica rice]
gb|ABK22798.1|  unknown                                                 257   7e-83   Picea sitchensis
gb|ABQ02463.1|  chloroplast chlorophyll a/b binding protein             257   9e-83   Phyllostachys edulis [kikko-chiku]
ref|XP_009397219.1|  PREDICTED: chlorophyll a-b binding protein 1...    257   1e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002321186.1|  chlorophyll a/b-binding family protein             257   1e-82   Populus trichocarpa [western balsam poplar]
ref|XP_010908796.1|  PREDICTED: chlorophyll a-b binding protein 5...    256   1e-82   Elaeis guineensis
gb|ABK21429.1|  unknown                                                 256   1e-82   Picea sitchensis
gb|AHB24928.1|  chloroplast chlorophyll a-b binding protein 2/3         256   1e-82   Sedum alfredii
sp|P27518.2|CB21_GOSHI  RecName: Full=Chlorophyll a-b binding pro...    256   1e-82   Gossypium hirsutum [American cotton]
ref|XP_002301582.1|  chlorophyll a/b-binding family protein             256   1e-82   Populus trichocarpa [western balsam poplar]
gb|KJB10748.1|  hypothetical protein B456_001G220900                    256   1e-82   Gossypium raimondii
ref|XP_008810536.1|  PREDICTED: chlorophyll a-b binding protein 5...    256   1e-82   
gb|ABK21323.1|  unknown                                                 256   1e-82   Picea sitchensis
gb|ABK21859.1|  unknown                                                 256   1e-82   Picea sitchensis
ref|XP_011039316.1|  PREDICTED: chlorophyll a-b binding protein 5...    256   1e-82   Populus euphratica
gb|KJB06801.1|  hypothetical protein B456_001G192300                    256   2e-82   Gossypium raimondii
gb|AAC28490.1|  photosystem II type II chlorophyll a/b binding pr...    253   2e-82   Sorghum bicolor [broomcorn]
prf||1707316B  chlorophyll a/b binding protein 2                        256   2e-82
gb|AFJ25031.1|  chlorophyll a/b binding protein                         256   3e-82   Lonicera japonica [Japanese honeysuckle]
ref|XP_006363015.1|  PREDICTED: chlorophyll a-b binding protein 4...    256   3e-82   Solanum tuberosum [potatoes]
ref|NP_001234739.1|  chlorophyll a-b binding protein 4, chloropla...    256   3e-82   Solanum lycopersicum
ref|XP_009618965.1|  PREDICTED: chlorophyll a-b binding protein 3...    255   3e-82   Nicotiana tomentosiformis
gb|ACG30954.1|  chlorophyll a-b binding protein                         255   4e-82   Zea mays [maize]
ref|NP_001148271.1|  chlorophyll a-b binding protein                    255   4e-82   Zea mays [maize]
gb|AAV74408.1|  chloroplast chlorophyll A/B binding protein             254   4e-82   Manihot esculenta [manioc]
dbj|BAH57170.1|  AT3G27690                                              251   4e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006447758.1|  hypothetical protein CICLE_v10016280mg             255   4e-82   Citrus clementina [clementine]
gb|KDO58421.1|  hypothetical protein CISIN_1g024579mg                   255   5e-82   Citrus sinensis [apfelsine]
gb|ABQ02464.1|  chloroplast chlorophyll a/b binding protein             255   5e-82   Phyllostachys edulis [kikko-chiku]
ref|XP_002466863.1|  hypothetical protein SORBIDRAFT_01g015400          255   5e-82   Sorghum bicolor [broomcorn]
ref|XP_003617948.1|  Chlorophyll a/b binding protein                    255   6e-82   Medicago truncatula
emb|CAA82853.1|  light-harvesting chlorophyll a/b binding protein       251   6e-82   Trifolium repens [creeping white clover]
emb|CAA43907.1|  chlorophyll a/b-binding protein                        255   6e-82   Pinus thunbergii [green pine]
ref|XP_010112785.1|  Chlorophyll a-b binding protein 151                254   6e-82   Morus notabilis
ref|NP_001241179.1|  uncharacterized protein LOC100815789               254   6e-82   Glycine max [soybeans]
gb|KDO58422.1|  hypothetical protein CISIN_1g024579mg                   253   7e-82   Citrus sinensis [apfelsine]
ref|XP_009792415.1|  PREDICTED: chlorophyll a-b binding protein 3...    254   8e-82   Nicotiana sylvestris
ref|XP_009365212.1|  PREDICTED: chlorophyll a-b binding protein 1...    255   8e-82   Pyrus x bretschneideri [bai li]
gb|KJB06589.1|  hypothetical protein B456_001G192000                    254   9e-82   Gossypium raimondii
gb|ABK96530.1|  unknown                                                 254   9e-82   Populus trichocarpa x Populus deltoides
gb|AAD48017.1|AF165529_1  chlorophyll a/b binding protein               254   1e-81   Rumex palustris
ref|XP_002271687.1|  PREDICTED: chlorophyll a-b binding protein 1...    254   1e-81   Vitis vinifera
gb|AAB19040.1|  type 2 light-harvesting chlorophyll a/b-binding p...    253   1e-81   Pinus palustris [longleaf pine]
prf||1615137A  chlorophyll a/b binding protein P25                      253   1e-81
ref|XP_010557706.1|  PREDICTED: chlorophyll a-b binding protein 5...    254   1e-81   Tarenaya hassleriana [spider flower]
gb|AAL29886.1|M97171_1  chlorophyll a/b binding protein type II         254   1e-81   Glycine max [soybeans]
gb|ABD92879.1|  chloroplast chlorophyll a/b binding protein             254   1e-81   Pachysandra terminalis
ref|XP_008379987.1|  PREDICTED: chlorophyll a-b binding protein 1...    254   1e-81   
ref|NP_001240183.1|  uncharacterized protein LOC100793702               254   1e-81   Glycine max [soybeans]
emb|CAC84495.1|  putative chlorophyll A-B binding protein type I        251   1e-81   Pinus pinaster [cluster pine]
ref|XP_007142492.1|  hypothetical protein PHAVU_008G285100g             254   2e-81   Phaseolus vulgaris [French bean]
emb|CAA89823.1|  light-harvesting chlorophyll a/b binding protein...    253   2e-81   Pseudotsuga menziesii
gb|KDP29912.1|  hypothetical protein JCGZ_18481                         253   2e-81   Jatropha curcas
ref|XP_009111582.1|  PREDICTED: chlorophyll a-b binding protein 3...    253   2e-81   Brassica rapa
emb|CDP19007.1|  unnamed protein product                                253   2e-81   Coffea canephora [robusta coffee]
gb|ABK22497.1|  unknown                                                 253   2e-81   Picea sitchensis
ref|NP_189406.1|  photosystem II light harvesting complex protein...    253   2e-81   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17665.1|  unknown                                                 253   2e-81   Picea sitchensis
gb|ACJ84374.1|  unknown                                                 253   2e-81   Medicago truncatula
ref|XP_007215825.1|  hypothetical protein PRUPE_ppa010078mg             253   2e-81   Prunus persica
ref|XP_009151928.1|  PREDICTED: chlorophyll a-b binding protein 5...    253   2e-81   Brassica rapa
emb|CDY00149.1|  BnaC09g01520D                                          253   2e-81   
gb|AII25433.1|  light-harvesting chlorophyll a/b binding protein        253   3e-81   Sedum alfredii
ref|XP_007049308.1|  Photosystem II light harvesting complex gene...    253   3e-81   Theobroma cacao [chocolate]
ref|XP_010252708.1|  PREDICTED: chlorophyll a-b binding protein 1...    253   3e-81   Nelumbo nucifera [Indian lotus]
gb|AAC34983.1|  light harvesting chlorophyll A/B binding protein        253   3e-81   Prunus persica
emb|CDY13732.1|  BnaA06g31910D                                          253   3e-81   Brassica napus [oilseed rape]
emb|CDY03989.1|  BnaC02g37040D                                          253   3e-81   
ref|XP_010665939.1|  PREDICTED: chlorophyll a-b binding protein 5...    253   3e-81   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK33680.1|  hypothetical protein AALP_AA5G045800                    249   3e-81   Arabis alpina [alpine rockcress]
emb|CDY15050.1|  BnaC03g44110D                                          253   4e-81   Brassica napus [oilseed rape]
gb|AFW90566.1|  chlorophyll a/b-binding protein                         253   4e-81   Solanum tuberosum [potatoes]
gb|AAO62942.1|  chlorophyll a/b binding protein                         253   4e-81   Nicotiana tabacum [American tobacco]
emb|CAA52750.1|  chlorophyll a/b binding protein                        253   4e-81   Amaranthus hypochondriacus [prince's feather]
ref|XP_010045878.1|  PREDICTED: chlorophyll a-b binding protein 3...    253   4e-81   Eucalyptus grandis [rose gum]
ref|XP_008229895.1|  PREDICTED: chlorophyll a-b binding protein 1...    253   5e-81   Prunus mume [ume]
gb|AAF89205.1|AF279248_1  LHCII type II chlorophyll a/b-binding p...    253   5e-81   Vigna radiata [mung bean]
ref|XP_004293460.1|  PREDICTED: chlorophyll a-b binding protein 1...    253   5e-81   Fragaria vesca subsp. vesca
gb|AFK45300.1|  unknown                                                 253   5e-81   Medicago truncatula
ref|XP_008342193.1|  PREDICTED: chlorophyll a-b binding protein 1...    252   6e-81   Malus domestica [apple tree]
gb|ABK21446.1|  unknown                                                 252   7e-81   Picea sitchensis
ref|XP_006291684.1|  hypothetical protein CARUB_v10017845mg             252   7e-81   Capsella rubella
ref|XP_006291597.1|  hypothetical protein CARUB_v10017751mg             253   8e-81   Capsella rubella
gb|ABK22382.1|  unknown                                                 252   9e-81   Picea sitchensis
sp|P12328.1|CB21_LEMGI  RecName: Full=Chlorophyll a-b binding pro...    252   9e-81   Lemna gibba
ref|XP_010502775.1|  PREDICTED: chlorophyll a-b binding protein 5...    252   1e-80   Camelina sativa [gold-of-pleasure]
ref|XP_002875398.1|  LHCB2:4                                            251   1e-80   Arabidopsis lyrata subsp. lyrata
ref|XP_009343482.1|  PREDICTED: chlorophyll a-b binding protein 1...    251   1e-80   
gb|KFK33683.1|  hypothetical protein AALP_AA5G046000                    251   1e-80   Arabis alpina [alpine rockcress]
gb|KFK33681.1|  hypothetical protein AALP_AA5G045800                    251   2e-80   Arabis alpina [alpine rockcress]
ref|XP_002875397.1|  LHCB2:4                                            251   2e-80   
gb|KFK23428.1|  hypothetical protein AALP_AAs45999U001400               251   2e-80   Arabis alpina [alpine rockcress]
ref|NP_178582.1|  photosystem II light harvesting complex protein...    251   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395408.1|  hypothetical protein EUTSA_v10004777mg             251   2e-80   Eutrema salsugineum [saltwater cress]
ref|XP_010497405.1|  PREDICTED: chlorophyll a-b binding protein 1...    247   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_002885789.1|  Lhcb2 protein                                      251   2e-80   Arabidopsis lyrata subsp. lyrata
gb|AAD28771.1|AF134124_1  Lhcb2 protein                                 251   2e-80   Arabidopsis thaliana [mouse-ear cress]
gb|AFK45982.1|  unknown                                                 251   2e-80   Lotus japonicus
ref|XP_009136161.1|  PREDICTED: chlorophyll a-b binding protein 1...    251   2e-80   Brassica rapa
sp|P15192.1|CB22_PINSY  RecName: Full=Chlorophyll a-b binding pro...    246   2e-80   Pinus sylvestris [Scotch pine]
gb|AAD28769.1|AF134122_1  Lhcb2 protein                                 251   2e-80   Arabidopsis thaliana [mouse-ear cress]
gb|AAW31512.1|  light-harvesting chlorophyll-a/b binding protein ...    251   3e-80   Pisum sativum [garden pea]
gb|ABO20852.1|  chlorophyll a/b binding protein of LHCII type I         251   3e-80   Lilium longiflorum [Easter lily]
sp|P27520.1|CB215_PEA  RecName: Full=Chlorophyll a-b binding prot...    251   3e-80   Pisum sativum [garden pea]
ref|XP_004491575.1|  PREDICTED: chlorophyll a-b binding protein 2...    250   4e-80   Cicer arietinum [garbanzo]
gb|AEZ49172.1|  chlorophyll a/b binding protein of LHCII type I         249   6e-80   Wolffia australiana
ref|XP_010412501.1|  PREDICTED: chlorophyll a-b binding protein 1...    249   8e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006296728.1|  hypothetical protein CARUB_v10014404mg             249   1e-79   Capsella rubella
ref|XP_010467054.1|  PREDICTED: chlorophyll a-b binding protein 1...    249   1e-79   Camelina sativa [gold-of-pleasure]
ref|XP_011039369.1|  PREDICTED: chlorophyll a-b binding protein 1...    244   1e-79   Populus euphratica
ref|XP_010514479.1|  PREDICTED: chlorophyll a-b binding protein 5...    249   1e-79   Camelina sativa [gold-of-pleasure]
ref|NP_178585.1|  photosystem II light harvesting complex protein...    249   1e-79   Arabidopsis thaliana [mouse-ear cress]
emb|CDX83726.1|  BnaC07g24660D                                          249   1e-79   
gb|KFK33682.1|  hypothetical protein AALP_AA5G045900                    248   2e-79   Arabis alpina [alpine rockcress]
ref|XP_011461952.1|  PREDICTED: chlorophyll a-b binding protein 1...    246   3e-79   Fragaria vesca subsp. vesca
ref|XP_003562323.1|  PREDICTED: chlorophyll a-b binding protein, ...    247   5e-79   Brachypodium distachyon [annual false brome]
sp|P10049.1|CB21_PINTH  RecName: Full=Chlorophyll a-b binding pro...    245   4e-78   Pinus thunbergii [green pine]
dbj|BAJ87356.1|  predicted protein                                      243   5e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT32028.1|  Chlorophyll a-b binding protein, chloroplastic          243   7e-78   
gb|EMS46868.1|  Chlorophyll a-b binding protein, chloroplastic          244   9e-78   Triticum urartu
ref|XP_002285646.1|  PREDICTED: chlorophyll a-b binding protein o...    243   2e-77   Vitis vinifera
gb|ACA30285.1|  putative chlorophyll A-B binding protein type I         238   4e-77   Cupressus sempervirens
ref|XP_010247431.1|  PREDICTED: chlorophyll a-b binding protein 1...    241   5e-77   Nelumbo nucifera [Indian lotus]
dbj|BAA24493.1|  chlorophyll a/b-binding protein                        242   6e-77   Fagus crenata
ref|XP_004155624.1|  PREDICTED: chlorophyll a-b binding protein o...    238   6e-77   
gb|ADL57411.1|  chloroplast LHCII type I chlorophyll a-b binding ...    239   7e-77   Ipomoea nil [qian niu]
gb|KCW75953.1|  hypothetical protein EUGRSUZ_D00321                     243   7e-77   Eucalyptus grandis [rose gum]
ref|XP_008358195.1|  PREDICTED: chlorophyll a-b binding protein o...    242   8e-77   Malus domestica [apple tree]
gb|AAF89207.1|AF279250_1  LHCII type I chlorophyll a/b-binding pr...    241   9e-77   Vigna radiata [mung bean]
ref|XP_008444193.1|  PREDICTED: chlorophyll a-b binding protein o...    241   1e-76   Cucumis melo [Oriental melon]
gb|KCW75952.1|  hypothetical protein EUGRSUZ_D00320                     241   1e-76   Eucalyptus grandis [rose gum]
gb|AEO51757.1|  chloroplast chlorophyll A/B binding protein             241   1e-76   Dimocarpus longan [longan]
ref|XP_009363087.1|  PREDICTED: chlorophyll a-b binding protein o...    241   1e-76   
ref|XP_007151997.1|  hypothetical protein PHAVU_004G093100g             238   1e-76   Phaseolus vulgaris [French bean]
ref|XP_010097597.1|  Chlorophyll a-b binding protein 40                 241   1e-76   Morus notabilis
ref|XP_011011531.1|  PREDICTED: chlorophyll a-b binding protein o...    241   1e-76   Populus euphratica
ref|XP_011045092.1|  PREDICTED: chlorophyll a-b binding protein o...    241   1e-76   Populus euphratica
ref|XP_007221496.1|  hypothetical protein PRUPE_ppa010066mg             241   2e-76   Prunus persica
ref|XP_004303877.1|  PREDICTED: chlorophyll a-b binding protein o...    241   2e-76   Fragaria vesca subsp. vesca
ref|XP_010097596.1|  Chlorophyll a-b binding protein 40                 241   2e-76   Morus notabilis
ref|XP_002986911.1|  light-harvesting complex                           241   2e-76   Selaginella moellendorffii
gb|ABR26169.1|  chlorophyll a-b binding protein                         236   2e-76   Oryza sativa Indica Group [Indian rice]
ref|XP_008447450.1|  PREDICTED: chlorophyll a-b binding protein o...    241   2e-76   Cucumis melo [Oriental melon]
ref|XP_011045093.1|  PREDICTED: chlorophyll a-b binding protein o...    241   2e-76   Populus euphratica
ref|NP_001240146.1|  chlorophyll a-b binding protein 21, chloropl...    241   2e-76   Glycine max [soybeans]
ref|XP_003548104.1|  PREDICTED: chlorophyll a-b binding protein 2...    241   2e-76   
ref|XP_002524616.1|  chlorophyll A/B binding protein, putative          241   2e-76   Ricinus communis
ref|XP_003548106.1|  PREDICTED: chlorophyll a/b-binding protein p...    240   2e-76   
ref|XP_002283566.1|  PREDICTED: chlorophyll a-b binding protein o...    241   2e-76   Vitis vinifera
ref|XP_004147416.1|  PREDICTED: chlorophyll a-b binding protein 4...    240   3e-76   Cucumis sativus [cucumbers]
ref|XP_004148579.1|  PREDICTED: chlorophyll a-b binding protein 3...    240   3e-76   Cucumis sativus [cucumbers]
ref|XP_004303878.1|  PREDICTED: chlorophyll a-b binding protein o...    240   3e-76   Fragaria vesca subsp. vesca
gb|KDP37945.1|  hypothetical protein JCGZ_04588                         240   3e-76   Jatropha curcas
ref|XP_008356022.1|  PREDICTED: chlorophyll a-b binding protein o...    240   3e-76   
ref|XP_002306927.1|  Chlorophyll a-b binding protein 2                  240   3e-76   Populus trichocarpa [western balsam poplar]
gb|ABF17940.1|  putative chloroplast chlorophyll a/b-binding protein    240   3e-76   Carya cathayensis
ref|XP_010052093.1|  PREDICTED: chlorophyll a-b binding protein o...    240   3e-76   Eucalyptus grandis [rose gum]
ref|XP_008364187.1|  PREDICTED: chlorophyll a-b binding protein o...    240   3e-76   
gb|ACF84273.1|  unknown                                                 240   3e-76   Zea mays [maize]
emb|CAA57409.1|  light harvesting chlorophyll a /b-binding protei...    240   4e-76   Picea abies
ref|XP_006383741.1|  hypothetical protein POPTR_0005s26070g             238   4e-76   
ref|XP_008343203.1|  PREDICTED: chlorophyll a-b binding protein o...    242   4e-76   
ref|XP_007151990.1|  hypothetical protein PHAVU_004G092600g             240   4e-76   Phaseolus vulgaris [French bean]
ref|XP_002515206.1|  chlorophyll A/B binding protein, putative          240   4e-76   Ricinus communis
ref|XP_008356026.1|  PREDICTED: chlorophyll a-b binding protein o...    240   4e-76   Malus domestica [apple tree]
emb|CAA57408.1|  light harvesting chlorophyll a /b-binding protei...    240   4e-76   Picea abies
ref|XP_007151979.1|  hypothetical protein PHAVU_004G091600g             240   4e-76   Phaseolus vulgaris [French bean]
gb|KHN25879.1|  Chlorophyll a-b binding protein 3, chloroplastic        239   4e-76   Glycine soja [wild soybean]
ref|XP_007151996.1|  hypothetical protein PHAVU_004G093000g             240   4e-76   Phaseolus vulgaris [French bean]
ref|XP_008371581.1|  PREDICTED: chlorophyll a-b binding protein o...    240   5e-76   
gb|AAC25775.1|  chlorophyll a/b binding protein                         240   5e-76   Medicago sativa [alfalfa]
gb|AFA36511.1|  light harvesting chlorophyll a/b-binding protein ...    236   5e-76   Lolium perenne [perennial ryegrass]
ref|XP_001757271.1|  predicted protein                                  240   5e-76   
ref|XP_008229430.1|  PREDICTED: chlorophyll a-b binding protein o...    240   5e-76   Prunus mume [ume]
ref|XP_008364191.1|  PREDICTED: chlorophyll a-b binding protein o...    239   5e-76   
ref|XP_008366007.1|  PREDICTED: chlorophyll a-b binding protein o...    239   5e-76   
gb|AFK40061.1|  unknown                                                 239   5e-76   Medicago truncatula
gb|KHN41291.1|  Chlorophyll a-b binding protein of LHCII type I, ...    238   5e-76   Glycine soja [wild soybean]
ref|XP_002519724.1|  chlorophyll A/B binding protein, putative          239   5e-76   Ricinus communis
ref|XP_007215816.1|  hypothetical protein PRUPE_ppa010034mg             239   6e-76   Prunus persica
gb|ABQ81856.1|  chloroplast chlorophyll a/b binding protein             239   6e-76   Phyllostachys edulis [kikko-chiku]
ref|XP_007158464.1|  hypothetical protein PHAVU_002G154500g             239   6e-76   Phaseolus vulgaris [French bean]
ref|XP_010243713.1|  PREDICTED: chlorophyll a-b binding protein o...    239   6e-76   Nelumbo nucifera [Indian lotus]
gb|AHM26643.1|  a-b binding protein                                     239   6e-76   Pyrus x bretschneideri [bai li]
ref|XP_004961193.1|  PREDICTED: chlorophyll a-b binding protein M...    239   6e-76   Setaria italica
ref|XP_006646072.1|  PREDICTED: chlorophyll a-b binding protein 2...    238   6e-76   
ref|XP_002302798.2|  hypothetical protein POPTR_0002s19010g             239   6e-76   Populus trichocarpa [western balsam poplar]
ref|XP_004170962.1|  PREDICTED: chlorophyll a-b binding protein o...    239   6e-76   
ref|XP_010926397.1|  PREDICTED: chlorophyll a-b binding protein o...    239   6e-76   Elaeis guineensis
gb|AIR93785.1|  chloroplast light harvesting chlorophyll A/B bind...    239   6e-76   Kalanchoe fedtschenkoi [lavender-scallops]
ref|NP_001062939.1|  Os09g0346500                                       239   6e-76   
dbj|BAA03104.1|  light-harvesting chlorophyll a/b-binding protein...    239   7e-76   Lactuca sativa [cultivated lettuce]
ref|XP_010924306.1|  PREDICTED: chlorophyll a-b binding protein o...    239   7e-76   Elaeis guineensis
ref|XP_004134603.1|  PREDICTED: chlorophyll a-b binding protein o...    239   7e-76   
ref|XP_006856963.1|  hypothetical protein AMTR_s00189p00032350          239   7e-76   Amborella trichopoda
gb|KDP37944.1|  hypothetical protein JCGZ_04587                         239   7e-76   Jatropha curcas
ref|XP_006356079.1|  PREDICTED: chlorophyll a-b binding protein 3...    236   7e-76   
ref|XP_009772885.1|  PREDICTED: chlorophyll a-b binding protein 5...    239   7e-76   Nicotiana sylvestris
gb|AAZ79657.1|  putative chlorophyll a/b-binding protein                239   7e-76   Fagus sylvatica
emb|CAC38830.1|  chlorophyll a/b binding protein                        239   7e-76   Pinus contorta
ref|NP_001148439.1|  chlorophyll a-b binding protein 2                  239   7e-76   Zea mays [maize]
sp|P08222.1|CB22_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    237   7e-76   Cucumis sativus [cucumbers]
ref|XP_010056879.1|  PREDICTED: chlorophyll a-b binding protein o...    239   7e-76   Eucalyptus grandis [rose gum]
ref|XP_009782921.1|  PREDICTED: chlorophyll a-b binding protein 5...    239   7e-76   Nicotiana sylvestris
gb|EMT32863.1|  Chlorophyll a-b binding protein, chloroplastic          238   8e-76   
ref|XP_004134608.1|  PREDICTED: chlorophyll a-b binding protein o...    239   8e-76   
ref|XP_008371583.1|  PREDICTED: chlorophyll a-b binding protein o...    240   8e-76   
ref|XP_011085268.1|  PREDICTED: chlorophyll a-b binding protein 2...    239   8e-76   Sesamum indicum [beniseed]
gb|ACF85694.1|  unknown                                                 239   8e-76   Zea mays [maize]
ref|XP_002316737.1|  Chlorophyll a-b binding protein 2                  239   8e-76   Populus trichocarpa [western balsam poplar]
ref|XP_010275593.1|  PREDICTED: chlorophyll a-b binding protein o...    239   8e-76   Nelumbo nucifera [Indian lotus]
emb|CAA47950.1|  chlorophyll a/b binding protein                        239   8e-76   Pinus contorta
ref|XP_006449644.1|  hypothetical protein CICLE_v10016074mg             240   8e-76   
gb|AFI60242.1|  light harvesting chlorophyll a/b binding protein        239   8e-76   Panicum virgatum
ref|XP_001762089.1|  predicted protein                                  239   9e-76   
ref|XP_004294267.1|  PREDICTED: chlorophyll a-b binding protein o...    239   9e-76   Fragaria vesca subsp. vesca
tpg|DAA58853.1|  TPA: hypothetical protein ZEAMMB73_924562              239   9e-76   
ref|XP_006660556.1|  PREDICTED: chlorophyll a-b binding protein 2...    239   9e-76   Oryza brachyantha
emb|CAA48410.1|  light harvesting chlorophyll a /b binding protein      236   9e-76   Hedera helix [English ivy]
ref|XP_002440263.1|  hypothetical protein SORBIDRAFT_09g028720          239   9e-76   Sorghum bicolor [broomcorn]
ref|NP_001142284.1|  uncharacterized protein LOC100274453               239   9e-76   Zea mays [maize]
ref|XP_004969083.1|  PREDICTED: chlorophyll a-b binding protein 2...    239   9e-76   Setaria italica
ref|XP_008456347.1|  PREDICTED: chlorophyll a-b binding protein o...    239   1e-75   Cucumis melo [Oriental melon]
ref|XP_006449643.1|  hypothetical protein CICLE_v10016287mg             239   1e-75   Citrus clementina [clementine]
ref|XP_009593856.1|  PREDICTED: chlorophyll a-b binding protein 4...    239   1e-75   Nicotiana tomentosiformis
ref|XP_004145734.1|  PREDICTED: chlorophyll a-b binding protein, ...    239   1e-75   Cucumis sativus [cucumbers]
ref|NP_001266111.1|  chlorophyll a-b binding protein AB80, chloro...    239   1e-75   Cicer arietinum [garbanzo]
ref|NP_001241277.1|  uncharacterized protein LOC100805310               239   1e-75   Glycine max [soybeans]
gb|AAA80593.1|  chlorophyll a/b binding protein                         239   1e-75   Solanum tuberosum [potatoes]
ref|XP_008229429.1|  PREDICTED: chlorophyll a-b binding protein o...    239   1e-75   Prunus mume [ume]
ref|XP_006467509.1|  PREDICTED: chlorophyll a-b binding protein 3...    239   1e-75   Citrus sinensis [apfelsine]
sp|P04781.1|CB23_PETSP  RecName: Full=Chlorophyll a-b binding pro...    239   1e-75   Petunia sp.
ref|XP_010904844.1|  PREDICTED: chlorophyll a-b binding protein o...    239   1e-75   Elaeis guineensis
ref|XP_002455902.1|  hypothetical protein SORBIDRAFT_03g027040          239   1e-75   Sorghum bicolor [broomcorn]
gb|ACD64978.1|  chloroplast chlorophyll a/b-binding protein             239   1e-75   Ophiopogon japonicus
gb|ACU23974.1|  unknown                                                 239   1e-75   Glycine max [soybeans]
ref|XP_008784387.1|  PREDICTED: chlorophyll a-b binding protein o...    239   1e-75   Phoenix dactylifera
ref|XP_006449645.1|  hypothetical protein CICLE_v10016286mg             239   1e-75   
gb|AHB24929.1|  chloroplast light-harvesting complex II chlorophy...    239   1e-75   Sedum alfredii
gb|ABF70112.1|  chlorophyll A-B binding protein (CAB), putative         239   1e-75   Musa balbisiana [starchy banana]
ref|XP_011096521.1|  PREDICTED: chlorophyll a-b binding protein 2...    239   1e-75   Sesamum indicum [beniseed]
gb|AAF89206.1|AF279249_1  LHCII type I chlorophyll a/b-binding pr...    239   1e-75   Vigna radiata [mung bean]
ref|XP_009790937.1|  PREDICTED: chlorophyll a-b binding protein 4...    236   1e-75   Nicotiana sylvestris
gb|ABF74606.1|  chloroplast chlorophyll a/b-binding protein             236   1e-75   Agave tequilana
gb|AFW81158.1|  light harvesting chlorophyll a/b binding protein3       240   1e-75   
ref|XP_009775533.1|  PREDICTED: chlorophyll a-b binding protein 7...    239   1e-75   Nicotiana sylvestris
ref|XP_009421488.1|  PREDICTED: chlorophyll a-b binding protein o...    239   1e-75   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK20976.1|  unknown                                                 239   1e-75   
ref|XP_007217260.1|  hypothetical protein PRUPE_ppa010015mg             239   1e-75   
gb|ACN40194.1|  unknown                                                 239   1e-75   
gb|ACR08639.1|  chloroplast chlorophyll A/B binding protein             239   1e-75   
ref|XP_009759685.1|  PREDICTED: chlorophyll a-b binding protein 4...    239   1e-75   
ref|XP_002307725.1|  Chlorophyll a-b binding protein 2                  239   1e-75   
ref|XP_010052095.1|  PREDICTED: chlorophyll a-b binding protein o...    239   1e-75   
pdb|2BHW|A  Chain A, Pea Light-Harvesting Complex Ii At 2.5 Angst...    238   1e-75   
gb|ABW70800.1|  chloroplast light harvesting chlorophyll a/b bind...    238   1e-75   
ref|XP_002460628.1|  hypothetical protein SORBIDRAFT_02g032090          235   1e-75   
ref|XP_004489391.1|  PREDICTED: chlorophyll a-b binding protein 3...    239   1e-75   
gb|AAB34067.1|  light-harvesting complex b type 2, Lhcb2                234   1e-75   
ref|XP_008800689.1|  PREDICTED: chlorophyll a-b binding protein o...    238   1e-75   
sp|P08221.1|CB21_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    238   1e-75   
ref|XP_008439658.1|  PREDICTED: chlorophyll a-b binding protein o...    238   1e-75   
gb|AFC91647.1|  chloroplast chlorophyll A/B binding protein             238   1e-75   
gb|AFW90512.1|  chlorophyll a/b-binding protein                         238   1e-75   
ref|XP_007158961.1|  hypothetical protein PHAVU_002G196400g             238   1e-75   
gb|ABQ81857.1|  chloroplast chlorophyll a/b binding protein             238   2e-75   
gb|AAC78690.1|  chlorophyll a/b-binding protein                         239   2e-75   
pdb|1VCR|A  Chain A, An Icosahedral Assembly Of Light-Harvesting ...    237   2e-75   
gb|ACU23816.1|  unknown                                                 238   2e-75   
ref|XP_009782924.1|  PREDICTED: chlorophyll a-b binding protein 5...    238   2e-75   
emb|CAA32109.1|  chlorophyll a/b-binding preprotein (AA -28 to 235)     238   2e-75   
gb|EMS50796.1|  Chlorophyll a-b binding protein, chloroplastic          238   2e-75   
ref|XP_008675448.1|  PREDICTED: chlorophyll a-b binding protein o...    238   2e-75   
gb|KHN28981.1|  Chlorophyll a-b binding protein 3, chloroplastic        238   2e-75   
ref|XP_009597417.1|  PREDICTED: chlorophyll a-b binding protein 5...    238   2e-75   
dbj|BAN18393.1|  chlorophyll a/b-binding protein                        235   2e-75   
ref|XP_009360962.1|  PREDICTED: chlorophyll a-b binding protein o...    239   2e-75   
ref|XP_002455901.1|  hypothetical protein SORBIDRAFT_03g027030          238   2e-75   
ref|XP_010231410.1|  PREDICTED: chlorophyll a-b binding protein o...    238   2e-75   
ref|XP_007211864.1|  hypothetical protein PRUPE_ppa010081mg             238   2e-75   
ref|XP_007211869.1|  hypothetical protein PRUPE_ppa010099mg             238   2e-75   
ref|XP_002273106.2|  PREDICTED: chlorophyll a-b binding protein o...    238   2e-75   
sp|P04783.1|CB25_PETSP  RecName: Full=Chlorophyll a-b binding pro...    238   2e-75   
ref|XP_009416547.1|  PREDICTED: chlorophyll a-b binding protein o...    238   2e-75   
dbj|BAK02173.1|  predicted protein                                      238   2e-75   
ref|XP_009782905.1|  PREDICTED: chlorophyll a-b binding protein 7...    238   2e-75   
ref|XP_010916097.1|  PREDICTED: chlorophyll a-b binding protein o...    238   2e-75   
sp|P27490.1|CB28_PEA  RecName: Full=Chlorophyll a-b binding prote...    238   2e-75   
ref|XP_011096520.1|  PREDICTED: chlorophyll a-b binding protein 2...    238   2e-75   
ref|NP_001105427.1|  light harvesting chlorophyll a /b binding pr...    238   2e-75   
ref|XP_004293579.1|  PREDICTED: chlorophyll a-b binding protein o...    238   2e-75   
ref|XP_008439659.1|  PREDICTED: chlorophyll a-b binding protein o...    241   2e-75   
ref|XP_009396492.1|  PREDICTED: chlorophyll a-b binding protein o...    238   2e-75   
ref|NP_001235283.1|  chlorophyll a/b-binding protein                    238   2e-75   
ref|XP_003633024.1|  PREDICTED: chlorophyll a-b binding protein o...    238   2e-75   
gb|AFK41648.1|  unknown                                                 234   2e-75   
ref|XP_009628755.1|  PREDICTED: chlorophyll a-b binding protein 4...    238   2e-75   
sp|P15194.1|CB2B_PINSY  RecName: Full=Chlorophyll a-b binding pro...    238   2e-75   
ref|XP_009795316.1|  PREDICTED: chlorophyll a-b binding protein 4...    238   2e-75   
gb|ABN49454.2|  chloroplast chlorophyll a/b binding protein             238   2e-75   
sp|P07371.1|CB22_PEA  RecName: Full=Chlorophyll a-b binding prote...    238   2e-75   
sp|P04782.1|CB24_PETSP  RecName: Full=Chlorophyll a-b binding pro...    238   2e-75   
gb|ABQ32304.1|  chloroplast light-harvesting chlorophyll a/b-bind...    238   3e-75   
ref|XP_009395692.1|  PREDICTED: chlorophyll a-b binding protein o...    238   3e-75   
ref|XP_009606800.1|  PREDICTED: chlorophyll a-b binding protein 5...    238   3e-75   
ref|XP_010247422.1|  PREDICTED: chlorophyll a-b binding protein o...    238   3e-75   
ref|XP_009790934.1|  PREDICTED: chlorophyll a-b binding protein 4...    238   3e-75   
gb|AAR10886.1|  chlorophyll a/b binding protein                         238   3e-75   
gb|AFV34722.1|  light harvesting chlorophyll a/b-binding protein 1-1    238   3e-75   
ref|XP_007025143.1|  Chlorophyll a-b binding protein, chloroplastic     238   3e-75   
gb|AEQ67395.1|  chloroplast chlorophyll A/B binding protein             238   3e-75   
ref|XP_009389379.1|  PREDICTED: chlorophyll a-b binding protein o...    238   3e-75   
ref|XP_002275075.1|  PREDICTED: chlorophyll a-b binding protein o...    238   3e-75   
gb|AAB82142.1|  chlorophyll a-b binding protein                         238   3e-75   
ref|NP_001147639.1|  chlorophyll a-b binding protein 1, chloropla...    238   3e-75   
ref|NP_001043493.1|  Os01g0600900                                       238   3e-75   
sp|P12329.1|CB21_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    238   3e-75   
gb|EMS50797.1|  Chlorophyll a-b binding protein, chloroplastic          238   3e-75   
dbj|BAJ85110.1|  predicted protein                                      238   3e-75   
ref|XP_009795315.1|  PREDICTED: chlorophyll a-b binding protein 4...    238   3e-75   
ref|XP_007025148.1|  Chlorophyll a-b binding protein, chloroplastic     238   3e-75   
ref|XP_009782923.1|  PREDICTED: chlorophyll a-b binding protein 5...    238   3e-75   
ref|XP_009618329.1|  PREDICTED: chlorophyll a-b binding protein 4...    238   3e-75   
dbj|BAN18384.1|  chlorophyll a/b-binding protein                        234   3e-75   
gb|KJB57287.1|  hypothetical protein B456_009G156900                    238   3e-75   
ref|XP_009618330.1|  PREDICTED: chlorophyll a-b binding protein 4...    238   4e-75   
gb|ACO51067.1|  chloroplast chlorophyll A-B binding protein             238   4e-75   
dbj|BAJ08392.1|  light harvesting chlorophyll a/b-binding protein...    238   4e-75   
gb|KJB66916.1|  hypothetical protein B456_010G165100                    238   4e-75   
gb|KJB69716.1|  hypothetical protein B456_011G041600                    238   4e-75   
ref|XP_009790936.1|  PREDICTED: chlorophyll a-b binding protein 4...    238   4e-75   
ref|XP_006364025.1|  PREDICTED: chlorophyll a-b binding protein 5...    238   4e-75   
ref|XP_004302854.1|  PREDICTED: chlorophyll a-b binding protein o...    238   4e-75   
emb|CAN78667.1|  hypothetical protein VITISV_031287                     238   4e-75   
ref|XP_006356077.1|  PREDICTED: chlorophyll a-b binding protein 3...    238   4e-75   
gb|AAA33396.1|  light-harvesting chlorophyll a/b protein precursor      238   4e-75   
gb|AGV54498.1|  LHCII type I chlorophyll a/b-binding protein            237   4e-75   
sp|P07369.1|CB2G_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    238   4e-75   
ref|XP_009795314.1|  PREDICTED: chlorophyll a-b binding protein 1...    237   4e-75   
gb|ACN31249.1|  unknown                                                 236   4e-75   
ref|XP_009782821.1|  PREDICTED: chlorophyll a-b binding protein 7...    237   4e-75   
sp|P27491.1|CB27_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    237   4e-75   
emb|CAA78379.1|  chlorophyll a/b-binding protein PS II-Type I           237   4e-75   
ref|XP_006844081.1|  hypothetical protein AMTR_s00006p00251360          237   4e-75   
dbj|BAA00536.1|  type I light-harvesting chlorophyll a/b-binding ...    237   5e-75   
ref|XP_006356073.1|  PREDICTED: chlorophyll a-b binding protein 3...    237   5e-75   
ref|XP_009775645.1|  PREDICTED: chlorophyll a-b binding protein 2...    237   5e-75   
ref|XP_009786355.1|  PREDICTED: chlorophyll a-b binding protein 2...    237   5e-75   
ref|XP_004957570.1|  PREDICTED: chlorophyll a-b binding protein 1...    237   5e-75   
ref|XP_009628757.1|  PREDICTED: chlorophyll a-b binding protein 1...    237   5e-75   
ref|XP_010231015.1|  PREDICTED: chlorophyll a-b binding protein o...    237   5e-75   
ref|XP_011460161.1|  PREDICTED: chlorophyll a-b binding protein o...    237   5e-75   
ref|XP_010374558.1|  PREDICTED: chlorophyll a-b binding protein o...    236   5e-75   
ref|XP_006356078.1|  PREDICTED: chlorophyll a-b binding protein 3...    237   5e-75   
gb|EMT29002.1|  Chlorophyll a-b binding protein, chloroplastic          237   5e-75   
ref|XP_006361530.1|  PREDICTED: chlorophyll a-b binding protein 3...    237   5e-75   
ref|XP_006365572.1|  PREDICTED: chlorophyll a-b binding protein 1...    237   6e-75   
ref|XP_006365560.1|  PREDICTED: chlorophyll a-b binding protein 1...    237   6e-75   
ref|XP_006356074.1|  PREDICTED: chlorophyll a-b binding protein 3...    237   6e-75   
gb|AGV54521.1|  LHCII type I chlorophyll a/b-binding protein            237   6e-75   
ref|XP_006368026.1|  PREDICTED: chlorophyll a-b binding protein 1...    237   6e-75   
gb|AAT08685.1|  chloroplast chlorophyll a/b-binding protein             233   6e-75   
gb|AAD21625.1|  putative chlorophyll a/b-binding protein                237   6e-75   
ref|XP_009782922.1|  PREDICTED: chlorophyll a-b binding protein 5...    237   6e-75   
gb|EMT04379.1|  Chlorophyll a-b binding protein, chloroplastic          237   6e-75   
ref|XP_006840305.1|  hypothetical protein AMTR_s00045p00070890          236   7e-75   
dbj|BAA32346.1|  light-harvesting chlorophyll a/b-binding protein...    237   7e-75   
ref|XP_009598577.1|  PREDICTED: chlorophyll a-b binding protein 2...    237   7e-75   
ref|XP_009606802.1|  PREDICTED: chlorophyll a-b binding protein 1...    237   7e-75   
gb|EPS64140.1|  chlorophyll a-b binding protein 21, chloroplastic       237   7e-75   
dbj|BAA25389.1|  light harvesting chlorophyll a/b-binding protein       237   7e-75   
gb|EMS67016.1|  Chlorophyll a-b binding protein, chloroplastic          237   7e-75   
ref|XP_009630190.1|  PREDICTED: chlorophyll a-b binding protein 2...    237   7e-75   
sp|P27492.1|CB21_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    237   7e-75   
gb|AAB18209.1|  chlorophyll a/b-binding protein WCAB precursor          237   7e-75   
gb|KEH25007.1|  light-harvesting complex I chlorophyll A/B-bindin...    237   7e-75   
ref|XP_009628754.1|  PREDICTED: chlorophyll a-b binding protein 1...    237   8e-75   
dbj|BAJ90772.1|  predicted protein                                      237   8e-75   
ref|XP_006840304.1|  hypothetical protein AMTR_s00045p00069900          236   8e-75   
gb|EMS53958.1|  Chlorophyll a-b binding protein 3C, chloroplastic       236   8e-75   
gb|AEV59645.1|  chloroplast photosystem II light harvesting compl...    236   8e-75   
gb|KCW75954.1|  hypothetical protein EUGRSUZ_D00322                     239   8e-75   
gb|AEV59639.1|  chloroplast photosystem II light harvesting compl...    236   8e-75   
ref|XP_006368025.1|  PREDICTED: chlorophyll a-b binding protein 1...    236   8e-75   
ref|NP_001044090.1|  Os01g0720500                                       236   8e-75   
gb|AEV59640.1|  chloroplast photosystem II light harvesting compl...    236   9e-75   
ref|XP_001761868.1|  predicted protein                                  236   9e-75   
gb|EMS51039.1|  Chlorophyll a-b binding protein 3C, chloroplastic       236   9e-75   
sp|P15195.1|CB23_POLMU  RecName: Full=Chlorophyll a-b binding pro...    236   9e-75   
ref|XP_010317413.1|  PREDICTED: chlorophyll a-b binding protein 3...    236   9e-75   
ref|XP_009377344.1|  PREDICTED: chlorophyll a-b binding protein o...    236   9e-75   
gb|ACL50948.1|  putative chloroplast chlorophyll a/b binding protein    236   9e-75   
gb|AAD27879.2|AF139467_1  LHCII type I chlorophyll a/b binding pr...    236   1e-74   
ref|XP_001765456.1|  predicted protein                                  236   1e-74   
ref|XP_001751602.1|  predicted protein                                  236   1e-74   
ref|XP_001754307.1|  predicted protein                                  236   1e-74   
gb|AAW31511.1|  light-harvesting chlorophyll-a/b binding protein ...    236   1e-74   
ref|XP_002460622.1|  hypothetical protein SORBIDRAFT_02g032040          236   1e-74   
ref|XP_010685893.1|  PREDICTED: chlorophyll a-b binding protein, ...    236   1e-74   
ref|XP_009400578.1|  PREDICTED: chlorophyll a-b binding protein o...    236   1e-74   
gb|EMT02753.1|  Chlorophyll a-b binding protein 3C, chloroplastic       236   1e-74   
gb|AAA80594.1|  chlorophyll a/b binding protein                         236   1e-74   
ref|XP_009775649.1|  PREDICTED: chlorophyll a-b binding protein 2...    236   1e-74   
ref|XP_001774812.1|  predicted protein                                  236   1e-74   
gb|AAA18529.1|  chlorophyll A/B binding protein                         236   1e-74   
ref|XP_001751426.1|  predicted protein                                  236   1e-74   
ref|XP_010666512.1|  PREDICTED: chlorophyll a-b binding protein, ...    236   1e-74   
gb|EMT02412.1|  Chlorophyll a-b binding protein, chloroplastic          236   1e-74   
gb|AAH53854.1|  Unknown (protein for IMAGE:5194336)                     237   1e-74   
ref|XP_009775650.1|  PREDICTED: chlorophyll a-b binding protein 2...    236   1e-74   
ref|NP_001105545.1|  chlorophyll a-b binding protein M9, chloropl...    236   1e-74   
gb|AHA84168.1|  chlorophyll a/b-binding protein                         236   1e-74   
gb|EMS51257.1|  Chlorophyll a-b binding protein 1, chloroplastic        237   1e-74   
dbj|BAN18371.1|  chlorophyll a/b-binding protein                        233   1e-74   
gb|ABK22510.1|  unknown                                                 236   1e-74   
dbj|BAJ87045.1|  predicted protein                                      236   1e-74   
ref|XP_010052094.1|  PREDICTED: chlorophyll a-b binding protein o...    240   1e-74   
ref|XP_003578592.1|  PREDICTED: chlorophyll a-b binding protein o...    236   1e-74   
ref|XP_001755762.1|  predicted protein                                  236   1e-74   
ref|XP_001779318.1|  predicted protein                                  236   1e-74   
dbj|BAN18373.1|  chlorophyll a/b-binding protein                        233   1e-74   
gb|AFW90565.1|  chlorophyll a-b binding protein 3C-like mRNA            235   1e-74   
gb|ADL41158.1|  chloroplast light-harvesting chlorophyll a/b bind...    236   1e-74   
gb|EMS45686.1|  Chlorophyll a-b binding protein, chloroplastic          236   1e-74   
ref|XP_001774452.1|  predicted protein                                  236   1e-74   
ref|XP_006841507.1|  hypothetical protein AMTR_s00003p00136650          235   1e-74   
ref|XP_010091411.1|  Chlorophyll a-b binding protein 16                 236   1e-74   
ref|XP_009598574.1|  PREDICTED: chlorophyll a-b binding protein 2...    236   1e-74   
gb|ABB55370.1|  chlorophyll a-b binding protein 3C-like                 236   1e-74   
ref|XP_001751359.1|  predicted protein                                  236   2e-74   
gb|AES74698.2|  light-harvesting complex I chlorophyll A/B-bindin...    236   2e-74   
gb|AHA84197.1|  chlorophyll a/b-binding protein                         236   2e-74   
ref|XP_001775090.1|  predicted protein                                  236   2e-74   
gb|AAB61236.1|  chlorophyll a/b-binding protein                         236   2e-74   
ref|XP_010237260.1|  PREDICTED: chlorophyll a-b binding protein o...    236   2e-74   
sp|P09756.1|CB23_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    236   2e-74   
dbj|BAJ93064.1|  predicted protein                                      236   2e-74   
ref|XP_009598575.1|  PREDICTED: chlorophyll a-b binding protein 2...    236   2e-74   
ref|XP_010316911.1|  PREDICTED: chlorophyll a-b binding protein 1...    236   2e-74   
emb|CDP06330.1|  unnamed protein product                                236   2e-74   
dbj|BAJ90643.1|  predicted protein                                      236   2e-74   
emb|CAA32108.1|  chlorophyll a/b-binding preprotein (AA -31 to 235)     236   2e-74   
ref|XP_002967230.1|  light-harvesting complex                           236   2e-74   
prf||1615137B  chlorophyll a/b binding protein P27                      234   2e-74
dbj|BAK03973.1|  predicted protein                                      236   2e-74   
emb|CAA52749.1|  Chloropyll a/b binding protein                         233   2e-74   
ref|XP_008779641.1|  PREDICTED: chlorophyll a-b binding protein o...    236   2e-74   
gb|EYU19613.1|  hypothetical protein MIMGU_mgv1a011885mg                235   2e-74   
emb|CDP06329.1|  unnamed protein product                                235   2e-74   
dbj|BAJ87240.1|  predicted protein                                      235   2e-74   
gb|KJB66915.1|  hypothetical protein B456_010G165000                    233   2e-74   
ref|XP_004233096.1|  PREDICTED: chlorophyll a-b binding protein 1...    235   2e-74   
gb|AAA80591.1|  chlorophyll a/b binding protein                         235   3e-74   
ref|XP_004233101.1|  PREDICTED: chlorophyll a-b binding protein 1...    235   3e-74   
ref|XP_006365573.1|  PREDICTED: chlorophyll a-b binding protein 1...    235   3e-74   
dbj|BAN18387.1|  chlorophyll a/b-binding protein                        232   3e-74   
ref|XP_009611577.1|  PREDICTED: chlorophyll a-b binding protein 4...    235   3e-74   
ref|XP_009377335.1|  PREDICTED: chlorophyll a-b binding protein o...    235   3e-74   
gb|EYU43289.1|  hypothetical protein MIMGU_mgv11b019945mg               235   3e-74   
gb|EMT29003.1|  Chlorophyll a-b binding protein, chloroplastic          235   3e-74   
emb|CAX64458.1|  major chlorophyll a/b binding protein LHCb1.4 pr...    235   3e-74   
gb|AAA60965.1|  light-harvesting chlorophyll a/b binding protein ...    235   3e-74   
gb|EMT02225.1|  Chlorophyll a-b binding protein, chloroplastic          235   3e-74   
ref|XP_006365561.1|  PREDICTED: chlorophyll a-b binding protein 1...    235   3e-74   
gb|ABM66819.1|  chloroplast light-harvesting chlorophyll a/b bind...    235   3e-74   
gb|ABD38707.1|  chloroplast chlorophyll a/b binding protein             235   3e-74   
ref|XP_002960494.1|  light-harvesting complex                           235   3e-74   
gb|EYU43278.1|  hypothetical protein MIMGU_mgv1a011933mg                235   3e-74   



>ref|XP_011100602.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Sesamum 
indicum]
Length=266

 Score =   262 bits (670),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/132 (97%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDK+YPGGA
Sbjct  135  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKIYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  195  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>gb|AHI85722.1| stress-induced protein 17, partial [Capsicum annuum]
Length=137

 Score =   257 bits (656),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDK+YPGGA
Sbjct  6    GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKIYPGGA  65

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ DPVANN
Sbjct  66   FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHINDPVANN  125

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  126  AWAYATNFVPGK  137



>dbj|BAE46383.1| chlorophyll a/b binding protein [Panax ginseng]
Length=265

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDK+YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_009626274.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Nicotiana tomentosiformis]
Length=265

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_006352013.1| PREDICTED: chlorophyll a-b binding protein 37, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   261 bits (666),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHIADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>sp|P27494.1|CB23_TOBAC RecName: Full=Chlorophyll a-b binding protein 36, chloroplastic; 
AltName: Full=LHCII type I CAB-36; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA41188.1| chlorophyll a/b binding protein [Nicotiana tabacum]
Length=265

 Score =   260 bits (665),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILA+WASQVVLMG +EGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAVWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>emb|CAA84525.1| chlorophyll a,b binding protein type I [Solanum tuberosum]
Length=265

 Score =   260 bits (665),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHIADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_004251540.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Solanum 
lycopersicum]
Length=265

 Score =   260 bits (664),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHIADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_009630805.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   260 bits (664),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAF ELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  194  FDPLGLADDPEAFTELKVKEMKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|AEK26372.1| chloroplast photosystem II chlorophyll a/b binding protein [Sedum 
alfredii]
 gb|AHB24930.1| chloroplast photosystem II light harvesting complex protein 2.1 
[Sedum alfredii]
Length=265

 Score =   260 bits (664),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMG +EGYRVGGGPLGEGLDK+YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENLFDH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_002531690.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF30681.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   260 bits (664),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>sp|P12062.1|CB26_PETSP RecName: Full=Chlorophyll a-b binding protein 37, chloroplastic; 
AltName: Full=LHCII type I CAB-37; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA28639.1| chlorophyll a/b binding protein [Petunia x hybrida]
Length=265

 Score =   260 bits (664),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWAAQVVLMGFVEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL+DHVADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  254  AWAFATNFVPGK  265



>gb|AEW70716.1| light harvesting chlorophyll a-b binding protein 2-1 [Phyllostachys 
edulis]
Length=263

 Score =   259 bits (663),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  132  GAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPV NN
Sbjct  192  FDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVNNN  251

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  252  AWAYATNFVPGK  263



>sp|P14279.1|CB25_SOLLC RecName: Full=Chlorophyll a-b binding protein 5, chloroplastic; 
AltName: Full=LHCII type I CAB-5; Short=LHCP; Flags: Precursor, 
partial [Solanum lycopersicum]
 gb|AAA34142.1| chlorophyll a/b-binding protein precursor, partial [Solanum lycopersicum]
Length=237

 Score =   258 bits (660),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDK+YPGGA
Sbjct  106  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKIYPGGA  165

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPVANN
Sbjct  166  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHIADPVANN  225

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  226  AWAYATNFVPGK  237



>ref|NP_001050586.1| Os03g0592500 [Oryza sativa Japonica Group]
 sp|Q10HD0.1|CB23_ORYSJ RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Oryza sativa Japonica Group]
 sp|A2XJ35.1|CB23_ORYSI RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Oryza sativa Indica Group]
 gb|AAT81763.1| chlorophyll a/b binding protein [Oryza sativa Japonica Group]
 gb|ABF97413.1| Chlorophyll a-b binding protein, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF12500.1| Os03g0592500 [Oryza sativa Japonica Group]
 gb|EAY90845.1| hypothetical protein OsI_12453 [Oryza sativa Indica Group]
 gb|EAZ27662.1| hypothetical protein OsJ_11611 [Oryza sativa Japonica Group]
 gb|AFI71846.1| chlorophyll a/b binbing protein [Oryza sativa]
Length=263

 Score =   259 bits (663),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  132  GAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  192  FDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  251

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  252  AWAYATNFVPGK  263



>gb|ABF97414.1| Chlorophyll a-b binding protein, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
Length=219

 Score =   258 bits (658),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  88   GAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  147

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  148  FDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  207

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  208  AWAYATNFVPGK  219



>ref|XP_009802594.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Nicotiana sylvestris]
Length=265

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHIADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  254  AWAFATNFVPGK  265



>gb|AFV34723.1| light harvesting chlorophyll a/b-binding protein 2-1 [Dendrocalamus 
latiflorus]
Length=263

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYR+GGGPLGEGLDKVYPGGA
Sbjct  132  GAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRIGGGPLGEGLDKVYPGGA  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPV NN
Sbjct  192  FDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVNNN  251

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  252  AWAYATNFVPGK  263



>ref|XP_010270182.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Nelumbo nucifera]
Length=264

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDK+YPGGA
Sbjct  133  GAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKIYPGGA  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP ANN
Sbjct  193  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPAANN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>gb|ABR25974.1| chloroplast chlorophyll a-b binding protein precursor [Oryza 
sativa Indica Group]
Length=253

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  122  GAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  181

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  182  FDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  241

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  242  AWAYATNFVPGK  253



>gb|AHC95482.1| chlorophyll A/B binding protein [Ziziphus jujuba]
Length=264

 Score =   259 bits (661),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  133  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL+DHVADPVANN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHVADPVANN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_008462084.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Cucumis melo]
Length=265

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|ABO10493.1| light-harvesting chlorophyll a/b binding protein [Bambusa oldhamii]
Length=263

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYR+GGGPLGEGLDKVYPGGA
Sbjct  132  GAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRIGGGPLGEGLDKVYPGGA  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPV NN
Sbjct  192  FDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVNNN  251

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  252  AWAYATNFVPGK  263



>gb|AEY78525.1| chlorophyll a/b-binding protein [Tagetes erecta]
Length=265

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPLGEGLDK+YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH++DPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLSDPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_004144543.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164056.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Cucumis sativus]
 gb|KGN43422.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=265

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_006836754.1| hypothetical protein AMTR_s00088p00153020 [Amborella trichopoda]
 gb|ERM99607.1| hypothetical protein AMTR_s00088p00153020 [Amborella trichopoda]
Length=264

 Score =   258 bits (659),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  133  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDAIYPGGA  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  193  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>gb|EYU42755.1| hypothetical protein MIMGU_mgv1a011961mg [Erythranthe guttata]
Length=265

 Score =   258 bits (658),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNL+HAQSILAIWA+QVVLMGFVEGYRVGGGPLGEGLDKVYPGG+
Sbjct  134  GSQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGFVEGYRVGGGPLGEGLDKVYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  254  AWAFATNFVPGK  265



>ref|XP_006664981.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Oryza brachyantha]
Length=263

 Score =   258 bits (658),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  132  GAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADP ANN
Sbjct  192  FDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPAANN  251

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  252  AWAYATNFVPGK  263



>gb|AAC15992.1| chlorophyll a/b binding protein [Oryza sativa Japonica Group]
Length=263

 Score =   258 bits (658),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDKVYP GA
Sbjct  132  GAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPSGA  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  192  FDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  251

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  252  AWAYATNFVPGK  263



>ref|XP_004982492.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Setaria italica]
Length=261

 Score =   258 bits (658),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  130  GAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  189

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+  AELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  190  FDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  249

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  250  AWAYATNFVPGK  261



>gb|AFO67217.1| putative chlorophyll a/b binding protein [Aralia elata]
Length=265

 Score =   258 bits (658),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGGPLG GLDK+YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGGPLGWGLDKIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|ABR17446.1| unknown [Picea sitchensis]
Length=160

 Score =   254 bits (648),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  29   GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  88

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP ANN
Sbjct  89   FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPTANN  148

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  149  AWAYATNFVPGK  160



>dbj|BAA00537.1| type II light-harvesting chlorophyll a/b-binding protein [Oryza 
sativa Japonica Group]
Length=263

 Score =   257 bits (657),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  132  GAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHV DPVANN
Sbjct  192  FDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVTDPVANN  251

Query  148  AWAYATNFVPGK  113
            AW+YATNFVPGK
Sbjct  252  AWSYATNFVPGK  263



>gb|ABK22798.1| unknown [Picea sitchensis]
Length=253

 Score =   257 bits (656),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  122  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  181

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP ANN
Sbjct  182  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPTANN  241

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  242  AWAYATNFVPGK  253



>gb|ABQ02463.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=263

 Score =   257 bits (656),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  132  GAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNG LAMFSMFGF VQAIVTGKGPIENLFDHVADPV NN
Sbjct  192  FDPLGLADDPDTFAELKVKELKNGSLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVNNN  251

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  252  AWAYATNFVPGK  263



>ref|XP_009397219.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Musa acuminata subsp. malaccensis]
 gb|ABF70157.1| chlorophyll A-B binding protein (CAB), putative [Musa acuminata]
Length=264

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  133  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDAIYPGGA  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  193  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_002321186.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
 gb|EEE99501.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
Length=265

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAI+TGKGPIENL DH+ADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIITGKGPIENLLDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_010908796.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Elaeis 
guineensis]
Length=265

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLG+GLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGQGLDAIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP ANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPAANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|ABK21429.1| unknown [Picea sitchensis]
 gb|ABK22448.1| unknown [Picea sitchensis]
 gb|ABK23914.1| unknown [Picea sitchensis]
 gb|ABK24064.1| unknown [Picea sitchensis]
 gb|ABK26103.1| unknown [Picea sitchensis]
 gb|ABK26818.1| unknown [Picea sitchensis]
 gb|ABR17641.1| unknown [Picea sitchensis]
 gb|ACN39896.1| unknown [Picea sitchensis]
 gb|ACN39974.1| unknown [Picea sitchensis]
 gb|ACN40033.1| unknown [Picea sitchensis]
 gb|ACN40585.1| unknown [Picea sitchensis]
 gb|ACN40649.1| unknown [Picea sitchensis]
Length=266

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  135  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP ANN
Sbjct  195  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPTANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>gb|AHB24928.1| chloroplast chlorophyll a-b binding protein 2/3 [Sedum alfredii]
Length=267

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMG +EGYRVGGGPLGEGLDK+YPGG+
Sbjct  136  GAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGS  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENLFDH+ADPVANN
Sbjct  196  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENLFDHLADPVANN  255

Query  148  AWAYATNFVPGK  113
            AWAYATNFV GK
Sbjct  256  AWAYATNFVLGK  267



>sp|P27518.2|CB21_GOSHI RecName: Full=Chlorophyll a-b binding protein 151, chloroplastic; 
AltName: Full=LHCII type II CAB-151; Short=LHCP; Flags: 
Precursor [Gossypium hirsutum]
 emb|CAA38025.1| chlorophyll ab binding protein [Gossypium hirsutum]
 gb|KHG21776.1| Chlorophyll a-b binding protein, chloroplastic [Gossypium arboreum]
Length=265

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_002301582.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
 gb|ABK95270.1| unknown [Populus trichocarpa]
 gb|ABK95825.1| unknown [Populus trichocarpa]
 gb|EEE80855.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
Length=265

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENLLDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|KJB10748.1| hypothetical protein B456_001G220900 [Gossypium raimondii]
Length=265

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_008810536.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Phoenix 
dactylifera]
Length=265

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDAIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP  NN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPATNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|ABK21323.1| unknown [Picea sitchensis]
Length=266

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  135  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP ANN
Sbjct  195  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPTANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>gb|ABK21859.1| unknown [Picea sitchensis]
 gb|ABK21874.1| unknown [Picea sitchensis]
 gb|ABK24058.1| unknown [Picea sitchensis]
 gb|ABK24837.1| unknown [Picea sitchensis]
 gb|ABK26095.1| unknown [Picea sitchensis]
 gb|ACN39796.1| unknown [Picea sitchensis]
 gb|ACN40179.1| unknown [Picea sitchensis]
Length=266

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  135  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP ANN
Sbjct  195  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPTANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>ref|XP_011039316.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Populus 
euphratica]
Length=265

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLLDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|KJB06801.1| hypothetical protein B456_001G192300 [Gossypium raimondii]
Length=265

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|AAC28490.1| photosystem II type II chlorophyll a/b binding protein [Sorghum 
bicolor]
Length=191

 Score =   253 bits (647),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  60   GAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  119

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+  AELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  120  FDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  179

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPG 
Sbjct  180  AWAYATNFVPGN  191



>prf||1707316B chlorophyll a/b binding protein 2
Length=263

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  132  GAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF VQAIV GKGPIENLFDHV DPVANN
Sbjct  192  FDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVRGKGPIENLFDHVTDPVANN  251

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  252  AWAYATNFVPGK  263



>gb|AFJ25031.1| chlorophyll a/b binding protein [Lonicera japonica]
Length=265

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMG +EGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGLIEGYRIGGGPLGEGLDSLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL+DH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENLYDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_006363015.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL DH+ DPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHINDPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|NP_001234739.1| chlorophyll a-b binding protein 4, chloroplastic [Solanum lycopersicum]
 sp|P14278.1|CB24_SOLLC RecName: Full=Chlorophyll a-b binding protein 4, chloroplastic; 
AltName: Full=LHCII type I CAB-4; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34141.1| chlorophyll a/b-binding protein precursor [Solanum lycopersicum]
Length=265

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL DH+ DPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHINDPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_009618965.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   255 bits (652),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ DPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHINDPVANN  253

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  254  AWAFATNFVPGK  265



>gb|ACG30954.1| chlorophyll a-b binding protein [Zea mays]
Length=260

 Score =   255 bits (652),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  129  GAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  188

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+  AELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  189  FDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  248

Query  148  AWAYATNFVPG  116
            AWAYATNFVPG
Sbjct  249  AWAYATNFVPG  259



>ref|NP_001148271.1| chlorophyll a-b binding protein [Zea mays]
 ref|XP_008665042.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Zea 
mays]
 gb|ACG30372.1| chlorophyll a-b binding protein [Zea mays]
 gb|ACR34075.1| unknown [Zea mays]
 tpg|DAA50197.1| TPA: type II light-harvesting chlorophyll a /b-binding protein 
isoform 1 [Zea mays]
 tpg|DAA50198.1| TPA: type II light-harvesting chlorophyll a /b-binding protein 
isoform 2 [Zea mays]
 tpg|DAA50201.1| TPA: light harvesting chlorophyll binding protein9 isoform 1 
[Zea mays]
 tpg|DAA50202.1| TPA: light harvesting chlorophyll binding protein9 isoform 2 
[Zea mays]
Length=260

 Score =   255 bits (651),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  129  GAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  188

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+  AELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  189  FDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  248

Query  148  AWAYATNFVPG  116
            AWAYATNFVPG
Sbjct  249  AWAYATNFVPG  259



>gb|AAV74408.1| chloroplast chlorophyll A/B binding protein [Manihot esculenta]
Length=243

 Score =   254 bits (650),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  112  GAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  171

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  172  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  231

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  232  AWAYATNFVPGK  243



>dbj|BAH57170.1| AT3G27690 [Arabidopsis thaliana]
Length=160

 Score =   251 bits (642),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  29   GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  88

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  89   FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHIADPVANN  148

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  149  AWAYATNFVPGK  160



>ref|XP_006447758.1| hypothetical protein CICLE_v10016280mg [Citrus clementina]
 ref|XP_006469510.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Citrus sinensis]
 gb|ESR60998.1| hypothetical protein CICLE_v10016280mg [Citrus clementina]
Length=265

 Score =   255 bits (652),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  194  FDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|KDO58421.1| hypothetical protein CISIN_1g024579mg [Citrus sinensis]
Length=265

 Score =   255 bits (651),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  194  FDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|ABQ02464.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=263

 Score =   255 bits (651),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  132  GAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKN RLAMFSMFGF VQAIVTGKGPIENL DHVADPV NN
Sbjct  192  FDPLGLADDPDTFAELKVKELKNSRLAMFSMFGFFVQAIVTGKGPIENLADHVADPVNNN  251

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  252  AWAYATNFVPGK  263



>ref|XP_002466863.1| hypothetical protein SORBIDRAFT_01g015400 [Sorghum bicolor]
 gb|EER93861.1| hypothetical protein SORBIDRAFT_01g015400 [Sorghum bicolor]
Length=262

 Score =   255 bits (651),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDKVYPGGA
Sbjct  131  GAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  190

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+  AELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  191  FDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  250

Query  148  AWAYATNFVPG  116
            AWAYATNFVPG
Sbjct  251  AWAYATNFVPG  261



>ref|XP_003617948.1| Chlorophyll a/b binding protein [Medicago truncatula]
 gb|AET00907.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=265

 Score =   255 bits (651),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP++NL+DHVADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVQNLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPG+
Sbjct  254  AWAYATNFVPGQ  265



>emb|CAA82853.1| light-harvesting chlorophyll a/b binding protein [Trifolium repens]
Length=167

 Score =   251 bits (642),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYR+GGGPLGEGLD +YPGGA
Sbjct  36   GAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRIGGGPLGEGLDPLYPGGA  95

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP++NL+DH+ADPVANN
Sbjct  96   FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVQNLYDHLADPVANN  155

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPG+
Sbjct  156  AWAYATNFVPGQ  167



>emb|CAA43907.1| chlorophyll a/b-binding protein [Pinus thunbergii]
Length=266

 Score =   255 bits (651),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  135  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  195  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>ref|XP_010112785.1| Chlorophyll a-b binding protein 151 [Morus notabilis]
 gb|EXC34900.1| Chlorophyll a-b binding protein 151 [Morus notabilis]
Length=265

 Score =   254 bits (650),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRIGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLVDHLADPVTNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|NP_001241179.1| uncharacterized protein LOC100815789 [Glycine max]
 gb|ACU19775.1| unknown [Glycine max]
 gb|KHN46928.1| Chlorophyll a-b binding protein 215, chloroplastic [Glycine soja]
Length=265

 Score =   254 bits (650),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPI+NL+DHVADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQNLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPG+
Sbjct  254  AWAYATNFVPGQ  265



>gb|KDO58422.1| hypothetical protein CISIN_1g024579mg [Citrus sinensis]
Length=229

 Score =   253 bits (647),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+GGGPLGEGLD +YPGGA
Sbjct  98   GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIGGGPLGEGLDPLYPGGA  157

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  158  FDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANN  217

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  218  AWAYATNFVPGK  229



>ref|XP_009792415.1| PREDICTED: chlorophyll a-b binding protein 37, chloroplastic-like 
[Nicotiana sylvestris]
Length=265

 Score =   254 bits (650),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ DPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHINDPVANN  253

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  254  AWAFATNFVPGK  265



>ref|XP_009365212.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Pyrus x bretschneideri]
Length=287

 Score =   255 bits (652),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYRVGGGPLGEGLD +YPGGA
Sbjct  156  GSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGGPLGEGLDPLYPGGA  215

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAM SMFGF VQAIVTGKGP+ENLFDH+ADPVANN
Sbjct  216  FDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVENLFDHIADPVANN  275

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  276  AWAYATNFVPGK  287



>gb|KJB06589.1| hypothetical protein B456_001G192000 [Gossypium raimondii]
 gb|KJB06590.1| hypothetical protein B456_001G192000 [Gossypium raimondii]
Length=265

 Score =   254 bits (649),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLLDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|ABK96530.1| unknown [Populus trichocarpa x Populus deltoides]
Length=265

 Score =   254 bits (649),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLA FSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLATFSMFGFFVQAIVTGKGPVENLLDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|AAD48017.1|AF165529_1 chlorophyll a/b binding protein [Rumex palustris]
Length=264

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGE LDK+YPGGA
Sbjct  133  GSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEDLDKLYPGGA  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENLVDHIADPVANN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_002271687.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Vitis vinifera]
 emb|CAN71610.1| hypothetical protein VITISV_000630 [Vitis vinifera]
Length=265

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDAIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLVDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|AAB19040.1| type 2 light-harvesting chlorophyll a/b-binding polypeptide, 
partial [Pinus palustris]
Length=246

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  115  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  174

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  175  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN  234

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  235  AWAYATNFVPGK  246



>prf||1615137A chlorophyll a/b binding protein P25
Length=226

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  95   GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  154

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  155  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN  214

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  215  AWAYATNFVPGK  226



>ref|XP_010557706.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Tarenaya 
hassleriana]
Length=266

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL+DHVADPVANN
Sbjct  195  FDPLNLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHVADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>gb|AAL29886.1|M97171_1 chlorophyll a/b binding protein type II [Glycine max]
Length=265

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPI+NL+DHVADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQNLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPG+
Sbjct  254  AWAYATNFVPGQ  265



>gb|ABD92879.1| chloroplast chlorophyll a/b binding protein [Pachysandra terminalis]
Length=264

 Score =   254 bits (648),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYRVGGGPLGEGLD +YPGGA
Sbjct  133  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRVGGGPLGEGLDSIYPGGA  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+AD  ANN
Sbjct  193  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADLAANN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_008379987.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Malus domestica]
Length=265

 Score =   254 bits (648),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAM SMFGF VQAIVTGKGP+ENLFDH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVENLFDHIADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|NP_001240183.1| uncharacterized protein LOC100793702 [Glycine max]
 gb|ACU18219.1| unknown [Glycine max]
 gb|KHN43946.1| Chlorophyll a-b binding protein 151, chloroplastic [Glycine soja]
Length=265

 Score =   254 bits (648),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPI+NL+DHVADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQNLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPG+
Sbjct  254  AWAYATNFVPGQ  265



>emb|CAC84495.1| putative chlorophyll A-B binding protein type I [Pinus pinaster]
Length=195

 Score =   251 bits (642),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  64   GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  123

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADP ANN
Sbjct  124  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPTANN  183

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  184  AWAYATNFVPGK  195



>ref|XP_007142492.1| hypothetical protein PHAVU_008G285100g [Phaseolus vulgaris]
 gb|AGV54257.1| LHCII type II chlorophyll a/b-binding protein [Phaseolus vulgaris]
 gb|ESW14486.1| hypothetical protein PHAVU_008G285100g [Phaseolus vulgaris]
Length=265

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD VYPGG+
Sbjct  134  GAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDPVYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPI+NL+DHVADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQNLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPG+
Sbjct  254  AWAYATNFVPGQ  265



>emb|CAA89823.1| light-harvesting chlorophyll a/b binding protein of photosystem 
II [Pseudotsuga menziesii]
Length=234

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  103  GAQIFSEGGLDYLGNPNLIHAQSILAIWAFQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  162

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP ANN
Sbjct  163  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPTANN  222

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  223  AWAYATNFVPGK  234



>gb|KDP29912.1| hypothetical protein JCGZ_18481 [Jatropha curcas]
Length=265

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_009111582.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Brassica rapa]
 emb|CDY20039.1| BnaA09g02120D [Brassica napus]
Length=265

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  194  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>emb|CDP19007.1| unnamed protein product [Coffea canephora]
Length=265

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPI+NL DH+ADPV NN
Sbjct  194  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQNLIDHLADPVTNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|ABK22497.1| unknown [Picea sitchensis]
 gb|ABK24164.1| unknown [Picea sitchensis]
 gb|ABK26145.1| unknown [Picea sitchensis]
 gb|ABR17447.1| unknown [Picea sitchensis]
 gb|ABR17727.1| unknown [Picea sitchensis]
 gb|ACN39972.1| unknown [Picea sitchensis]
 gb|ACN40388.1| unknown [Picea sitchensis]
Length=266

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  135  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPE+FAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADP ANN
Sbjct  195  FDPLGLADDPESFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPTANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>ref|NP_189406.1| photosystem II light harvesting complex protein 2.3 [Arabidopsis 
thaliana]
 gb|AAD28772.1|AF134125_1 Lhcb2 protein [Arabidopsis thaliana]
 gb|AAK48984.1|AF370557_1 light harvesting chlorophyll a/b-binding protein [Arabidopsis 
thaliana]
 dbj|BAB02693.1| light harvesting chlorophyll a/b-binding protein [Arabidopsis 
thaliana]
 gb|AAP13406.1| At3g27700 [Arabidopsis thaliana]
 gb|AEE77352.1| photosystem II light harvesting complex protein 2.3 [Arabidopsis 
thaliana]
Length=266

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHIADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>gb|ABR17665.1| unknown [Picea sitchensis]
Length=266

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWASQV LMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  135  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVGLMGLIEGYRVGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP ANN
Sbjct  195  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPTANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>gb|ACJ84374.1| unknown [Medicago truncatula]
Length=265

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA++VVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWATRVVLMGFVEGYRVGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP++NL+DHVADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVQNLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPG+
Sbjct  254  AWAYATNFVPGQ  265



>ref|XP_007215825.1| hypothetical protein PRUPE_ppa010078mg [Prunus persica]
 gb|EMJ17024.1| hypothetical protein PRUPE_ppa010078mg [Prunus persica]
Length=265

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAM SMFGF VQAIVTGKGP+ENL+DHVADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVENLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_009151928.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic-like 
[Brassica rapa]
 emb|CDY49770.1| BnaA02g29010D [Brassica napus]
Length=266

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>emb|CDY00149.1| BnaC09g01520D [Brassica napus]
Length=266

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>gb|AII25433.1| light-harvesting chlorophyll a/b binding protein [Sedum alfredii]
Length=265

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMG +EGYRVGGGPLGEGLDK+YP G+
Sbjct  134  GAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDKIYPXGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQ IVTGKGP+E LFDH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQXIVTGKGPVEXLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_007049308.1| Photosystem II light harvesting complex gene 2.1 [Theobroma cacao]
 gb|EOX93465.1| Photosystem II light harvesting complex gene 2.1 [Theobroma cacao]
Length=265

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP  NN
Sbjct  194  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPATNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_010252708.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Nelumbo nucifera]
Length=264

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDK+YPGGA
Sbjct  133  GAQIFSEGGLDYLGNPNLVHAQSILAIWAFQVVLMGFVEGYRVGGGPLGEGLDKIYPGGA  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP +NN
Sbjct  193  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPASNN  252

Query  148  AWAYATNFVPG  116
            AWAYATNFVPG
Sbjct  253  AWAYATNFVPG  263



>gb|AAC34983.1| light harvesting chlorophyll A/B binding protein [Prunus persica]
Length=265

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAM SMFGF VQAIVTGKGP+ENL+DHVADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVENLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>emb|CDY13732.1| BnaA06g31910D [Brassica napus]
Length=266

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>emb|CDY03989.1| BnaC02g37040D [Brassica napus]
Length=266

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>ref|XP_010665939.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 emb|CAA74179.1| chlorophyll a/b-binding protein [Beta vulgaris subsp. vulgaris]
Length=264

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIF EGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGGPLGEGLDK+YPGGA
Sbjct  133  GSQIFQEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGGPLGEGLDKLYPGGA  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPVANN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHLADPVANN  252

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  253  AWAFATNFVPGK  264



>gb|KFK33680.1| hypothetical protein AALP_AA5G045800 [Arabis alpina]
Length=160

 Score =   249 bits (636),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGGPLGEGLD +YPGGA
Sbjct  29   GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGGPLGEGLDPLYPGGA  88

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  89   FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN  148

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  149  AWAYATNFVPGK  160



>emb|CDY15050.1| BnaC03g44110D [Brassica napus]
Length=265

 Score =   253 bits (645),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLNLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW+YATNFVPGK
Sbjct  254  AWSYATNFVPGK  265



>gb|AFW90566.1| chlorophyll a/b-binding protein [Solanum tuberosum]
Length=271

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL DH+ DPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHINDPVANN  253

Query  148  AWAYATNFVP  119
            AWAYATNFVP
Sbjct  254  AWAYATNFVP  263



>gb|AAO62942.1| chlorophyll a/b binding protein [Nicotiana tabacum]
Length=265

 Score =   253 bits (645),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYRVGGGPLGEGLDK+YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDKIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFD + DPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDQINDPVANN  253

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  254  AWAFATNFVPGK  265



>emb|CAA52750.1| chlorophyll a/b binding protein [Amaranthus hypochondriacus]
Length=264

 Score =   253 bits (645),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIF EGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPLGEGLDK+YPGGA
Sbjct  133  GSQIFQEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDKIYPGGA  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPVANN
Sbjct  193  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHLADPVANN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_010045878.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Eucalyptus grandis]
 gb|KCW88692.1| hypothetical protein EUGRSUZ_A01047 [Eucalyptus grandis]
Length=265

 Score =   253 bits (645),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP ANN
Sbjct  194  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPAANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_008229895.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Prunus mume]
Length=265

 Score =   253 bits (645),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAM SMFGF VQAIVTGKGP+ENL+DHVADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVENLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|AAF89205.1|AF279248_1 LHCII type II chlorophyll a/b-binding protein [Vigna radiata]
Length=265

 Score =   253 bits (645),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDPIYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFS+FGF VQAIVTGKGPI+NL+DHVADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSVFGFFVQAIVTGKGPIQNLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPG+
Sbjct  254  AWAYATNFVPGQ  265



>ref|XP_004293460.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=265

 Score =   253 bits (645),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAM SMFGF VQAIVTGKGPIENL+DHVADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMTSMFGFFVQAIVTGKGPIENLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|AFK45300.1| unknown [Medicago truncatula]
Length=265

 Score =   253 bits (645),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVT KGP++NL+DHVADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTDKGPVQNLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPG+
Sbjct  254  AWAYATNFVPGQ  265



>ref|XP_008342193.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Malus domestica]
Length=265

 Score =   252 bits (644),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAM SMFGF VQAIVTGKGP+ENLFDH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVENLFDHIADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  254  AWAFATNFVPGK  265



>gb|ABK21446.1| unknown [Picea sitchensis]
Length=266

 Score =   252 bits (644),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  135  GAQIFSEGGLDYLGNPNLIHAQSILAIWAFQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP  NN
Sbjct  195  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPANNN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>ref|XP_006291684.1| hypothetical protein CARUB_v10017845mg [Capsella rubella]
 gb|EOA24582.1| hypothetical protein CARUB_v10017845mg [Capsella rubella]
Length=266

 Score =   252 bits (644),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHIADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  255  AWAFATNFVPGK  266



>ref|XP_006291597.1| hypothetical protein CARUB_v10017751mg [Capsella rubella]
 gb|EOA24495.1| hypothetical protein CARUB_v10017751mg [Capsella rubella]
Length=293

 Score =   253 bits (646),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  162  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  221

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  222  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHIADPVANN  281

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  282  AWAFATNFVPGK  293



>gb|ABK22382.1| unknown [Picea sitchensis]
 gb|ABK23122.1| unknown [Picea sitchensis]
 gb|ABK26462.1| unknown [Picea sitchensis]
 gb|ABR16136.1| unknown [Picea sitchensis]
 gb|ACN40237.1| unknown [Picea sitchensis]
Length=266

 Score =   252 bits (643),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  135  GAQIFSEGGLDYLGNPNLIHAQSILAIWAFQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADP  NN
Sbjct  195  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPANNN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>sp|P12328.1|CB21_LEMGI RecName: Full=Chlorophyll a-b binding protein of LHCII type I, 
chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor [Lemna 
gibba]
 gb|AAA33392.1| chlorophyll a/b apoprotein [Lemna gibba]
Length=264

 Score =   252 bits (643),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA+QVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  133  GAQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPVANN
Sbjct  193  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHIADPVANN  252

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  253  AWAFATNFVPGK  264



>ref|XP_010502775.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic-like 
[Camelina sativa]
Length=266

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHIADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  255  AWAFATNFVPGK  266



>ref|XP_002875398.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51657.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
Length=266

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLG+PNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGSPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHIADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>ref|XP_009343482.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Pyrus x bretschneideri]
Length=265

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYRVGGGPLGEGLD +YPGG 
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGGPLGEGLDPLYPGGV  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAM SMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPIENLFDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  254  AWAFATNFVPGK  265



>gb|KFK33683.1| hypothetical protein AALP_AA5G046000 [Arabis alpina]
Length=266

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>gb|KFK33681.1| hypothetical protein AALP_AA5G045800 [Arabis alpina]
Length=266

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>ref|XP_002875397.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51656.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
Length=266

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMF MFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFPMFGFFVQAIVTGKGPIENLFDHIADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>gb|KFK23428.1| hypothetical protein AALP_AAs45999U001400 [Arabis alpina]
Length=265

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPE F+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLNLAEDPETFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW+YATNFVPGK
Sbjct  254  AWSYATNFVPGK  265



>ref|NP_178582.1| photosystem II light harvesting complex protein 2.2 [Arabidopsis 
thaliana]
 gb|AAD28770.1|AF134123_1 Lhcb2 protein [Arabidopsis thaliana]
 gb|AAD25595.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAL06878.1| At2g05070/F1O13.20 [Arabidopsis thaliana]
 gb|AAL32641.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAL47403.1| At2g05070/F1O13.20 [Arabidopsis thaliana]
 gb|AAM13371.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AEC05893.1| photosystem II light harvesting complex protein 2.2 [Arabidopsis 
thaliana]
Length=265

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW+YATNFVPGK
Sbjct  254  AWSYATNFVPGK  265



>ref|XP_006395408.1| hypothetical protein EUTSA_v10004777mg [Eutrema salsugineum]
 dbj|BAJ33772.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ32694.1| hypothetical protein EUTSA_v10004777mg [Eutrema salsugineum]
Length=266

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  254

Query  148  AWAYATNFVPGK  113
            AW+YATNFVPGK
Sbjct  255  AWSYATNFVPGK  266



>ref|XP_010497405.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Camelina sativa]
Length=160

 Score =   247 bits (631),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  29   GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  88

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  89   FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  148

Query  148  AWAYATNFVPGK  113
            AW+YATNF PG+
Sbjct  149  AWSYATNFAPGQ  160



>ref|XP_002885789.1| Lhcb2 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62048.1| Lhcb2 protein [Arabidopsis lyrata subsp. lyrata]
Length=265

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW+YATNFVPGK
Sbjct  254  AWSYATNFVPGK  265



>gb|AAD28771.1|AF134124_1 Lhcb2 protein [Arabidopsis thaliana]
Length=265

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW+YATNFVPGK
Sbjct  254  AWSYATNFVPGK  265



>gb|AFK45982.1| unknown [Lotus japonicus]
Length=265

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPI+NL+DHVADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQNLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPG+
Sbjct  254  AWAFATNFVPGQ  265



>ref|XP_009136161.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Brassica rapa]
 emb|CDX93077.1| BnaA03g37990D [Brassica napus]
Length=265

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLNLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW+YATNFVPGK
Sbjct  254  AWSYATNFVPGK  265



>sp|P15192.1|CB22_PINSY RecName: Full=Chlorophyll a-b binding protein type 2 member 2; 
AltName: Full=Chlorophyll a-b binding protein type II 2; Short=CAB; 
AltName: Full=LHCP, partial [Pinus sylvestris]
 gb|AAA33776.1| chlorophyll a/b-binding protein [Pinus sylvestris]
Length=150

 Score =   246 bits (629),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPLGEGLD +YPG A
Sbjct  19   GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDPLYPGDA  78

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEA AELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  79   FDPLGLADDPEAKAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN  138

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  139  AWAYATNFVPGK  150



>gb|AAD28769.1|AF134122_1 Lhcb2 protein [Arabidopsis thaliana]
Length=265

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW+YATNFVPGK
Sbjct  254  AWSYATNFVPGK  265



>gb|AAW31512.1| light-harvesting chlorophyll-a/b binding protein Lhcb2 [Pisum 
sativum]
Length=265

 Score =   251 bits (640),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIF+EGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP++FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPI+NL+DHVADPVANN
Sbjct  194  FDPLGLADDPDSFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQNLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPG+
Sbjct  254  AWAFATNFVPGQ  265



>gb|ABO20852.1| chlorophyll a/b binding protein of LHCII type I [Lilium longiflorum]
Length=264

 Score =   251 bits (640),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  133  GAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL+DH+ADP  NN
Sbjct  193  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENLYDHLADPATNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>sp|P27520.1|CB215_PEA RecName: Full=Chlorophyll a-b binding protein 215, chloroplastic; 
AltName: Full=LHCII type II CAB-215; Short=LHCP; Flags: 
Precursor [Pisum sativum]
 emb|CAA40365.1| chlorophyll a/b-binding protein [Pisum sativum]
Length=265

 Score =   251 bits (640),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIF+EGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP++FAELKVKELKNGRLAMFSMFGF VQAIVTGKGPI+NL+DHVADPVANN
Sbjct  194  FDPLGLADDPDSFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQNLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPG+
Sbjct  254  AWAFATNFVPGQ  265



>ref|XP_004491575.1| PREDICTED: chlorophyll a-b binding protein 215, chloroplastic-like 
[Cicer arietinum]
Length=265

 Score =   250 bits (639),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAM SMFGF VQAIVTGKGPI+NL+DHVADPVANN
Sbjct  194  FDPLGLADDPDAFAELKVKEIKNGRLAMTSMFGFFVQAIVTGKGPIQNLYDHVADPVANN  253

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPG+
Sbjct  254  AWAFATNFVPGQ  265



>gb|AEZ49172.1| chlorophyll a/b binding protein of LHCII type I [Wolffia australiana]
Length=264

 Score =   249 bits (637),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGF+EGYRVGGGPLGEGLD +YPGGA
Sbjct  133  GSQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFIEGYRVGGGPLGEGLDPLYPGGA  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  193  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLSDHLADPVANN  252

Query  148  AWAYATNFVPG  116
            AW+YATNFVPG
Sbjct  253  AWSYATNFVPG  263



>ref|XP_010412501.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Camelina sativa]
Length=265

 Score =   249 bits (636),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW+YATNF PG+
Sbjct  254  AWSYATNFAPGQ  265



>ref|XP_006296728.1| hypothetical protein CARUB_v10014404mg [Capsella rubella]
 gb|EOA29626.1| hypothetical protein CARUB_v10014404mg [Capsella rubella]
Length=265

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW+YATNF PG+
Sbjct  254  AWSYATNFAPGQ  265



>ref|XP_010467054.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Camelina sativa]
 ref|XP_010488741.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Camelina sativa]
Length=265

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW+YATNF PG+
Sbjct  254  AWSYATNFAPGQ  265



>ref|XP_011039369.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Populus euphratica]
Length=137

 Score =   244 bits (624),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  490  EGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGL  311
            EGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLD +YPGGAFDPLGL
Sbjct  12   EGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGL  71

Query  310  ADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANNAWAYAT  131
            ADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPVANNAWAYAT
Sbjct  72   ADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLLDHLADPVANNAWAYAT  131

Query  130  NFVPGK  113
            NFVPGK
Sbjct  132  NFVPGK  137



>ref|XP_010514479.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Camelina 
sativa]
Length=266

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHIADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  255  AWAFATNFVPGK  266



>ref|NP_178585.1| photosystem II light harvesting complex protein 2.1 [Arabidopsis 
thaliana]
 gb|AAD31358.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAK96468.1| At2g05100/F15L11.2 [Arabidopsis thaliana]
 gb|AAK96540.1| At2g05100/F15L11.2 [Arabidopsis thaliana]
 gb|AAN71932.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AEC05894.1| photosystem II light harvesting complex protein 2.1 [Arabidopsis 
thaliana]
Length=265

 Score =   249 bits (635),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDH+ADPVANN
Sbjct  194  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN  253

Query  148  AWAYATNFVPG  116
            AW+YATNFVPG
Sbjct  254  AWSYATNFVPG  264



>emb|CDX83726.1| BnaC07g24660D [Brassica napus]
Length=266

 Score =   249 bits (635),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGGPLGEGLD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGGPLGEGLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENLFDHVADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNF P K
Sbjct  255  AWAYATNFAPVK  266



>gb|KFK33682.1| hypothetical protein AALP_AA5G045900 [Arabis alpina]
Length=266

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGGPLGE LD +YPGGA
Sbjct  135  GSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGGPLGEVLDPLYPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPL LA+DPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  195  FDPLNLAEDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>ref|XP_011461952.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like, 
partial [Fragaria vesca subsp. vesca]
Length=218

 Score =   246 bits (629),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+E YRVGGGPLGEGLD +YPGGA
Sbjct  87   GSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIERYRVGGGPLGEGLDPLYPGGA  146

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAM SMFGF VQAIVTGKGPIENL+DHVADPVANN
Sbjct  147  FDPLGLADDPEAFAELKVKEIKNGRLAMTSMFGFFVQAIVTGKGPIENLYDHVADPVANN  206

Query  148  AWAYATNFVPGK  113
            AWAYATNFVP K
Sbjct  207  AWAYATNFVPAK  218



>ref|XP_003562323.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Brachypodium 
distachyon]
Length=263

 Score =   247 bits (631),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGGPLGEGLDK+YPGGA
Sbjct  132  GSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFIEGYRVGGGPLGEGLDKIYPGGA  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+  AELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENLFDHVADPV NN
Sbjct  192  FDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENLFDHVADPVNNN  251

Query  148  AWAYATNFVPGK  113
            AWA+ATNF PG 
Sbjct  252  AWAFATNFAPGS  263



>sp|P10049.1|CB21_PINTH RecName: Full=Chlorophyll a-b binding protein type I, chloroplastic; 
Short=CAB; Short=LHCP; Flags: Precursor [Pinus thunbergii]
 emb|CAA31773.1| chlorophylla/b-binding preprotein (AA -37 to 229) [Pinus thunbergii]
Length=266

 Score =   245 bits (625),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDY GNPNLIHAQSILAIWA QVVLMG +EGYRVGGG LGEGLD + PGGA
Sbjct  135  GAQIFSEGGLDYAGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGTLGEGLDPLLPGGA  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEA AELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL+DH+ADPVANN
Sbjct  195  FDPLGLADDPEACAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>dbj|BAJ87356.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=219

 Score =   243 bits (620),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGGPLGEGLD +YPGGA
Sbjct  88   GAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFIEGYRVGGGPLGEGLDIIYPGGA  147

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+  AELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENLFDH+ADPV NN
Sbjct  148  FDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENLFDHIADPVNNN  207

Query  148  AWAYATNFVPGK  113
            AWA+ATNF PG 
Sbjct  208  AWAFATNFAPGS  219



>gb|EMT32028.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=229

 Score =   243 bits (620),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGGPLGEGLD +YPGGA
Sbjct  98   GAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVGGGPLGEGLDIIYPGGA  157

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+  AELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENLFDHVADPV NN
Sbjct  158  FDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENLFDHVADPVNNN  217

Query  148  AWAYATNFVPGK  113
            AWA+ATNF PG 
Sbjct  218  AWAFATNFAPGS  229



>gb|EMS46868.1| Chlorophyll a-b binding protein, chloroplastic [Triticum urartu]
Length=263

 Score =   244 bits (623),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGGPLGEGLD +YPGGA
Sbjct  132  GAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVGGGPLGEGLDIIYPGGA  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+  AELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENLFDHVADPV NN
Sbjct  192  FDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVENLFDHVADPVNNN  251

Query  148  AWAYATNFVPGK  113
            AWA+ATNF PG 
Sbjct  252  AWAFATNFAPGS  263



>ref|XP_002285646.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN73057.1| hypothetical protein VITISV_007597 [Vitis vinifera]
Length=267

 Score =   243 bits (621),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWASQV+LMG VEGYR+GGGPLGE +D +YPGG+
Sbjct  136  GAQIFSEGGLDYLGNPNLVHAQSILAIWASQVILMGAVEGYRIGGGPLGEVVDPLYPGGS  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  196  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  255

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  256  AWAYATNFVPGK  267



>gb|ACA30285.1| putative chlorophyll A-B binding protein type I [Cupressus sempervirens]
Length=134

 Score =   238 bits (607),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGGPLGEGLD +YPGGA
Sbjct  7    GSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDPLYPGGA  66

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAM SMFGF VQAIVTGKGPIENL+DH+ADP  NN
Sbjct  67   FDPLGLADDPEAFAELKVKEIKNGRLAMSSMFGFFVQAIVTGKGPIENLYDHLADPSTNN  126

Query  148  AWAYATNF  125
            AWAYATNF
Sbjct  127  AWAYATNF  134



>ref|XP_010247431.1| PREDICTED: chlorophyll a-b binding protein 1D-like [Nelumbo nucifera]
Length=222

 Score =   241 bits (614),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA+QV+LMG VEGYRV GGPLGE  D +YPGG+
Sbjct  91   GAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRVAGGPLGEVTDPLYPGGS  150

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  151  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  210

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  211  AWAYATNFVPGK  222



>dbj|BAA24493.1| chlorophyll a/b-binding protein [Fagus crenata]
Length=264

 Score =   242 bits (618),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVTNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_004155624.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
Length=153

 Score =   238 bits (607),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  22   GSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGS  81

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  82   FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  141

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  142  AWAYATNFVPGK  153



>gb|ADL57411.1| chloroplast LHCII type I chlorophyll a-b binding precursor protein 
[Ipomoea nil]
Length=179

 Score =   239 bits (609),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  48   GAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGS  107

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  108  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  167

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  168  AWAYATNFVPGK  179



>gb|KCW75953.1| hypothetical protein EUGRSUZ_D00321 [Eucalyptus grandis]
Length=300

 Score =   243 bits (620),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  169  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGS  228

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV+NN
Sbjct  229  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVSNN  288

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  289  AWAYATNFVPGK  300



>ref|XP_008358195.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   242 bits (617),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVTNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|AAF89207.1|AF279250_1 LHCII type I chlorophyll a/b-binding protein [Vigna radiata]
Length=264

 Score =   241 bits (616),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWASQV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GSQIFSEGGLDYLGNPSLIHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_008444193.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWASQVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLMGAVEGYRIAGGPLGEVTDPIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|KCW75952.1| hypothetical protein EUGRSUZ_D00320 [Eucalyptus grandis]
Length=265

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV+NN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVSNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|AEO51757.1| chloroplast chlorophyll A/B binding protein [Dimocarpus longan]
Length=265

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYR+GGGPLGEGLD +YPGGA
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRIGGGPLGEGLDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIV GKGPIENL D +A PVANN
Sbjct  194  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVPGKGPIENLSDPLAAPVANN  253

Query  148  AWAYATNFVPGK  113
            AWAYA NFVPGK
Sbjct  254  AWAYAPNFVPGK  265



>ref|XP_009363087.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=265

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVTNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_007151997.1| hypothetical protein PHAVU_004G093100g [Phaseolus vulgaris]
 gb|ESW23991.1| hypothetical protein PHAVU_004G093100g [Phaseolus vulgaris]
Length=160

 Score =   238 bits (606),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  29   GSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  88

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  89   FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  148

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  149  AWAYATNFVPGK  160



>ref|XP_010097597.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
 gb|EXB69298.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
Length=265

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWASQV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPSLIHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_011011531.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
 ref|XP_011016419.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=264

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPIYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_011045092.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Populus 
euphratica]
Length=263

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  132  GAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGS  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  192  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  251

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  252  AWAYATNFVPGK  263



>ref|XP_007221496.1| hypothetical protein PRUPE_ppa010066mg [Prunus persica]
 ref|XP_008227797.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
 gb|EMJ22695.1| hypothetical protein PRUPE_ppa010066mg [Prunus persica]
Length=265

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_004303877.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  136  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGS  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  196  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN  255

Query  148  AWAYATNFVPGK  113
            AW+YATNFVPGK
Sbjct  256  AWSYATNFVPGK  267



>ref|XP_010097596.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
 gb|EXB69297.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
Length=265

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWASQV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPSLIHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_002986911.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ11993.1| light-harvesting complex [Selaginella moellendorffii]
Length=267

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIF EGGLDYLGNPNL+HAQSILAIWASQV+LMG VEGYRVGGGPLGEGLDK+YPGGA
Sbjct  136  GSQIFKEGGLDYLGNPNLVHAQSILAIWASQVILMGAVEGYRVGGGPLGEGLDKIYPGGA  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGF  QAIVTGKGPIENL DH+ +P  NN
Sbjct  196  FDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFTQAIVTGKGPIENLLDHLDNPTVNN  255

Query  148  AWAYATNFVPGK  113
            AWAYATNF PG 
Sbjct  256  AWAYATNFTPGS  267



>gb|ABR26169.1| chlorophyll a-b binding protein [Oryza sativa Indica Group]
Length=144

 Score =   236 bits (603),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGGA
Sbjct  13   GSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGA  72

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  73   FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  132

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  133  AWAYATNFVPGK  144



>ref|XP_008447450.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWASQVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLMGAVEGYRIAGGPLGEITDPIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_011045093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=263

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  132  GAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGS  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  192  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  251

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  252  AWAYATNFVPGK  263



>ref|NP_001240146.1| chlorophyll a-b binding protein 21, chloroplastic-like [Glycine 
max]
 gb|AAA50172.1| photosystem II type I chlorophyll a/b-binding protein [Glycine 
max]
 gb|ACU18421.1| unknown [Glycine max]
 gb|KHN41285.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_003548104.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Glycine max]
Length=264

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_002524616.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF37824.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWASQVVLMG VEGYRV GGPLGE  D +YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLMGAVEGYRVAGGPLGEVTDPIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_003548106.1| PREDICTED: chlorophyll a/b-binding protein precursor isoform 
1 [Glycine max]
 gb|KHN41288.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_002283566.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN74831.1| hypothetical protein VITISV_023674 [Vitis vinifera]
Length=270

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNL+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  139  GAQIFSEGGLDYLGNPNLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYPGGS  198

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  199  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  258

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  259  AWAYATNFVPGK  270



>ref|XP_004147416.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65549.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=265

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWASQVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLMGAVEGYRIAGGPLGEVTDPIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ DPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLTDPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_004148579.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004166094.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Cucumis sativus]
 gb|KGN58532.1| hypothetical protein Csa_3G664560 [Cucumis sativus]
Length=265

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWASQVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLMGAVEGYRIAGGPLGEITDPIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAF+ELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_004303878.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  136  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGS  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  196  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN  255

Query  148  AWAYATNFVPGK  113
            AW+YATNFVPGK
Sbjct  256  AWSYATNFVPGK  267



>gb|KDP37945.1| hypothetical protein JCGZ_04588 [Jatropha curcas]
Length=265

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYRV GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_008356022.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW YATNFVPGK
Sbjct  254  AWXYATNFVPGK  265



>ref|XP_002306927.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK95787.1| unknown [Populus trichocarpa]
 gb|ABK96559.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96723.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96730.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93923.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH++DPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>gb|ABF17940.1| putative chloroplast chlorophyll a/b-binding protein [Carya cathayensis]
Length=267

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  136  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  196  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  255

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  256  AWAYATNFVPGK  267



>ref|XP_010052093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
 gb|KCW75951.1| hypothetical protein EUGRSUZ_D00319 [Eucalyptus grandis]
Length=265

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNPNLIHAQSILAIWA QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_008364187.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW YATNFVPGK
Sbjct  254  AWXYATNFVPGK  265



>gb|ACF84273.1| unknown [Zea mays]
 gb|ACG31360.1| chlorophyll a-b binding protein 2 [Zea mays]
Length=266

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  135  GSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGS  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  195  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>emb|CAA57409.1| light harvesting chlorophyll a /b-binding protein Lhcb1*2-2 [Picea 
abies]
Length=275

 Score =   240 bits (613),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  144  GAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEITDPIYPGGS  203

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  204  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVTNN  263

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  264  AWAYATNFVPGK  275



>ref|XP_006383741.1| hypothetical protein POPTR_0005s26070g [Populus trichocarpa]
 gb|ERP61538.1| hypothetical protein POPTR_0005s26070g [Populus trichocarpa]
Length=206

 Score =   238 bits (607),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  75   GAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGS  134

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH++DPV NN
Sbjct  135  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNN  194

Query  148  AWAYATNFVPGK  113
            AWAYATNF PGK
Sbjct  195  AWAYATNFAPGK  206



>ref|XP_008343203.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008362557.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=332

 Score =   242 bits (618),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  201  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPLYPGGS  260

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  261  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVTNN  320

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  321  AWAYATNFVPGK  332



>ref|XP_007151990.1| hypothetical protein PHAVU_004G092600g [Phaseolus vulgaris]
 ref|XP_007151998.1| hypothetical protein PHAVU_004G093200g [Phaseolus vulgaris]
 gb|ESW23984.1| hypothetical protein PHAVU_004G092600g [Phaseolus vulgaris]
 gb|ESW23992.1| hypothetical protein PHAVU_004G093200g [Phaseolus vulgaris]
Length=264

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_002515206.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47190.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=267

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  136  GAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  196  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  255

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  256  AWAYATNFVPGK  267



>ref|XP_008356026.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
 ref|XP_008364190.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW YATNFVPGK
Sbjct  254  AWNYATNFVPGK  265



>emb|CAA57408.1| light harvesting chlorophyll a /b-binding protein Lhcb1*2-1 [Picea 
abies]
Length=274

 Score =   240 bits (613),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  143  GAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEITDPIYPGGS  202

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  203  FDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVTNN  262

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  263  AWAYATNFVPGK  274



>ref|XP_007151979.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
 gb|ESW23973.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
Length=264

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>gb|KHN25879.1| Chlorophyll a-b binding protein 3, chloroplastic [Glycine soja]
Length=244

 Score =   239 bits (610),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  113  GSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  172

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  173  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  232

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  233  AWAYATNFVPGK  244



>ref|XP_007151996.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
 gb|ESW23990.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
Length=264

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_008371581.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   240 bits (612),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW YATNFVPGK
Sbjct  254  AWNYATNFVPGK  265



>gb|AAC25775.1| chlorophyll a/b binding protein [Medicago sativa]
Length=266

 Score =   240 bits (612),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  135  GSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGS  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  195  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>gb|AFA36511.1| light harvesting chlorophyll a/b-binding protein Lhcb1, partial 
[Lolium perenne]
Length=155

 Score =   236 bits (601),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GGPLGE +D +YPGG+
Sbjct  24   GSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGS  83

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  84   FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  143

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  144  AWAFATNFVPGK  155



>ref|XP_001757271.1| predicted protein [Physcomitrella patens]
 gb|EDQ77756.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   240 bits (612),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWASQVVLMG VEGYRV GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPSLVHAQSILAIWASQVVLMGAVEGYRVAGGPLGEITDPIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  194  FDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLNDHLADPVANN  253

Query  148  AWAYATNFVPG  116
            AWAYATNFVPG
Sbjct  254  AWAYATNFVPG  264



>ref|XP_008229430.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   240 bits (612),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  136  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  196  FDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN  255

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  256  AWAYATNFVPGK  267



>ref|XP_008364191.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_009360860.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Pyrus 
x bretschneideri]
Length=264

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANN  252

Query  148  AWAYATNFVPGK  113
            AW YATNFVPGK
Sbjct  253  AWNYATNFVPGK  264



>ref|XP_008366007.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANN  253

Query  148  AWAYATNFVPGK  113
            AW YATNFVPGK
Sbjct  254  AWNYATNFVPGK  265



>gb|AFK40061.1| unknown [Medicago truncatula]
 gb|KEH31368.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=266

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  135  GSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGS  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  195  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>gb|KHN41291.1| Chlorophyll a-b binding protein of LHCII type I, chloroplastic 
[Glycine soja]
Length=231

 Score =   238 bits (608),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  100  GSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  159

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  160  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  219

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  220  AWAYATNFVPGK  231



>ref|XP_002519724.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF42697.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   239 bits (611),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYRV GGPLGE  D +YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_007215816.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
 gb|EMJ17015.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
Length=267

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  136  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYPGGS  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  196  FDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN  255

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  256  AWAYATNFVPGK  267



>gb|ABQ81856.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=265

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_007158464.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 ref|XP_007158466.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
 gb|ESW30458.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 gb|ESW30460.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
Length=264

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GSQIFSEGGLDYLGNPSLVHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVTDPIYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_010243713.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=267

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA+QV+LMG VEGYRV GGPLGE  D +YPGG+
Sbjct  136  GAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRVAGGPLGEVTDPLYPGGS  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  196  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  255

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  256  AWAYATNFVPGK  267



>gb|AHM26643.1| a-b binding protein [Pyrus x bretschneideri]
Length=264

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANN  252

Query  148  AWAYATNFVPGK  113
            AW YATNFVPGK
Sbjct  253  AWNYATNFVPGK  264



>ref|XP_004961193.1| PREDICTED: chlorophyll a-b binding protein M9, chloroplastic-like 
[Setaria italica]
Length=264

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  133  GSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_006646072.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic-like 
[Oryza brachyantha]
Length=237

 Score =   238 bits (608),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  106  GSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGS  165

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  166  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  225

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  226  AWAYATNFVPGK  237



>ref|XP_002302798.2| hypothetical protein POPTR_0002s19010g [Populus trichocarpa]
 gb|EEE82071.2| hypothetical protein POPTR_0002s19010g [Populus trichocarpa]
Length=266

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  135  GAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  195  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  254

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  255  AWAYATNFVPGK  266



>ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
 gb|KGN49375.1| hypothetical protein Csa_6G522690 [Cucumis sativus]
Length=265

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_010926397.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=264

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGYRV GGPLGE  D +YPGG+
Sbjct  133  GAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>gb|AIR93785.1| chloroplast light harvesting chlorophyll A/B binding protein 
[Kalanchoe fedtschenkoi]
Length=267

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYRV GGPLGE +D +YPGG+
Sbjct  136  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEVVDPLYPGGS  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  196  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  255

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  256  AWAYATNFVPGK  267



>ref|NP_001062939.1| Os09g0346500 [Oryza sativa Japonica Group]
 sp|P12330.2|CB21_ORYSJ RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; 
AltName: Full=LHCII type I CAB-1; Short=LHCP; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD28469.1| putative chlorophyll a-b binding protein, chloroplast precursor 
(LHCII type I CAB) (LHCP) [Oryza sativa Japonica Group]
 dbj|BAD29115.1| putative chlorophyll a-b binding protein, chloroplast precursor 
(LHCII type I CAB) (LHCP) [Oryza sativa Japonica Group]
 dbj|BAF24853.1| Os09g0346500 [Oryza sativa Japonica Group]
 dbj|BAG96567.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96573.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96613.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87574.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84405.1| hypothetical protein OsI_30987 [Oryza sativa Indica Group]
Length=265

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGGA
Sbjct  134  GSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGA  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>dbj|BAA03104.1| light-harvesting chlorophyll a/b-binding protein (LHCP) precursor 
[Lactuca sativa]
Length=266

 Score =   239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  135  GSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGS  194

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  195  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANN  254

Query  148  AWAYATNFVPGK  113
            AW+YATNFVPGK
Sbjct  255  AWSYATNFVPGK  266



>ref|XP_010924306.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Elaeis 
guineensis]
Length=264

 Score =   239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYRV GGPLGE  D +YPGG+
Sbjct  133  GAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPLYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>ref|XP_004134603.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 1 [Cucumis sativus]
 ref|XP_004134604.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 2 [Cucumis sativus]
 ref|XP_004134605.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 3 [Cucumis sativus]
 gb|KGN49374.1| hypothetical protein Csa_6G522680 [Cucumis sativus]
Length=265

 Score =   239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_006856963.1| hypothetical protein AMTR_s00189p00032350 [Amborella trichopoda]
 gb|ERN18430.1| hypothetical protein AMTR_s00189p00032350 [Amborella trichopoda]
Length=268

 Score =   239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  137  GAQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDPLYPGGS  196

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  197  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  256

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  257  AWAYATNFVPGK  268



>gb|KDP37944.1| hypothetical protein JCGZ_04587 [Jatropha curcas]
Length=260

 Score =   239 bits (610),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYRV GGPLGE  D +YPGG+
Sbjct  129  GAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYPGGS  188

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  189  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  248

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  249  AWAYATNFVPGK  260



>ref|XP_006356079.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=160

 Score =   236 bits (601),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  29   GSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGS  88

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  89   FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLVDHLADPVNNN  148

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  149  AWAFATNFVPGK  160



>ref|XP_009772885.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GGPLGE +D +YPGG+
Sbjct  136  GSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGS  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  196  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  255

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  256  AWAYATNFVPGK  267



>gb|AAZ79657.1| putative chlorophyll a/b-binding protein [Fagus sylvatica]
Length=260

 Score =   239 bits (610),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  130  GAQIFSEGGLDYLGNPSLIHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVTDPLYPGGS  189

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  190  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVTNN  249

Query  148  AWAYATNFVPG  116
            AWAYATNFVPG
Sbjct  250  AWAYATNFVPG  260



>emb|CAC38830.1| chlorophyll a/b binding protein [Pinus contorta]
Length=274

 Score =   239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  143  GAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  202

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV+NN
Sbjct  203  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVSNN  262

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  263  AWAYATNFVPGK  274



>ref|NP_001148439.1| chlorophyll a-b binding protein 2 [Zea mays]
 ref|XP_008675450.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Zea mays]
 ref|XP_008675451.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Zea mays]
 gb|ACG31472.1| chlorophyll a-b binding protein 2 [Zea mays]
 tpg|DAA58854.1| TPA: chlorophyll a-b binding protein 2 [Zea mays]
Length=264

 Score =   239 bits (610),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GGPLGE +D +YPGG+
Sbjct  133  GSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  253  AWAYATNFVPGK  264



>sp|P08222.1|CB22_CUCSA RecName: Full=Chlorophyll a-b binding protein of LHCII type 1; 
AltName: Full=Chlorophyll a-b binding protein of LHCII type 
I; Short=CAB; Short=LHCP, partial [Cucumis sativus]
 gb|AAA33125.1| chlorophyll a/b-binding protein, partial [Cucumis sativus]
Length=206

 Score =   237 bits (605),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  75   GSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGS  134

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  135  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  194

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  195  AWAYATNFVPGK  206



>ref|XP_010056879.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
Length=265

 Score =   239 bits (610),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGYRV GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_009782921.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   239 bits (610),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GGPLGE +D +YPGG+
Sbjct  136  GSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGS  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  196  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  255

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  256  AWAYATNFVPGK  267



>gb|EMT32863.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=240

 Score =   238 bits (608),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  109  GSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGS  168

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  169  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNN  228

Query  148  AWAYATNFVPGK  113
            AWA+ATNFVPGK
Sbjct  229  AWAFATNFVPGK  240



>ref|XP_004134608.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
Length=265

 Score =   239 bits (610),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_008371583.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008356023.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008364186.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=291

 Score =   240 bits (612),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  160  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  219

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  220  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANN  279

Query  148  AWAYATNFVPGK  113
            AW YATNFVPGK
Sbjct  280  AWNYATNFVPGK  291



>ref|XP_011085268.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=265

 Score =   239 bits (610),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  134  GAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>gb|ACF85694.1| unknown [Zea mays]
 gb|ACG30115.1| chlorophyll a-b binding protein 1 [Zea mays]
 gb|ACG33564.1| chlorophyll a-b binding protein 1 [Zea mays]
 gb|AFW81156.1| light harvesting chlorophyll a/b binding protein3 isoform 1 [Zea 
mays]
 gb|AFW81157.1| light harvesting chlorophyll a/b binding protein3 isoform 2 [Zea 
mays]
Length=265

 Score =   239 bits (610),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG +EGYRV GGPLGE +D +YPGG+
Sbjct  134  GSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVVDPLYPGGS  193

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  194  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  253

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  254  AWAYATNFVPGK  265



>ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   239 bits (610),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA+QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  133  GAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPIYPGGS  192

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  193  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  148  AWAYATNFVPGK  113
            AWAYATNF PGK
Sbjct  253  AWAYATNFAPGK  264



>ref|XP_010275593.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Nelumbo 
nucifera]
Length=269

 Score =   239 bits (610),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA+QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  138  GAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYPGGS  197

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  198  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  257

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  258  AWAYATNFVPGK  269



>emb|CAA47950.1| chlorophyll a/b binding protein [Pinus contorta]
Length=274

 Score =   239 bits (611),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  143  GAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPIYPGGS  202

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV+NN
Sbjct  203  FDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVSNN  262

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  263  AWAYATNFVPGK  274



>ref|XP_006449644.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
 gb|ESR62884.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
Length=303

 Score =   240 bits (613),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE  D +YPGG+
Sbjct  172  GAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS  231

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  232  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  291

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  292  AWAYATNFVPGK  303



>gb|AFI60242.1| light harvesting chlorophyll a/b binding protein, partial [Panicum 
virgatum]
Length=260

 Score =   239 bits (609),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  129  GSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGS  188

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  189  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  248

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  249  AWAYATNFVPGK  260



>ref|XP_001762089.1| predicted protein [Physcomitrella patens]
 gb|EDQ73193.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   239 bits (610),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYRV GGPLGE  D +YPGG+
Sbjct  132  GSQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRVAGGPLGEVTDPIYPGGS  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPVANN
Sbjct  192  FDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLSDHLADPVANN  251

Query  148  AWAYATNFVPG  116
            AWAYATNFVPG
Sbjct  252  AWAYATNFVPG  262



>ref|XP_004294267.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   239 bits (610),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            GAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  136  GAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGS  195

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGF VQAIVTGKGPIENL DH+ADPV NN
Sbjct  196  FDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN  255

Query  148  AWAYATNFVPGK  113
            AW+YATNFVPGK
Sbjct  256  AWSYATNFVPGK  267



>tpg|DAA58853.1| TPA: hypothetical protein ZEAMMB73_924562 [Zea mays]
Length=259

 Score =   239 bits (609),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GGPLGE +D +YPGG+
Sbjct  128  GSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGS  187

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  188  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNN  247

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  248  AWAYATNFVPGK  259



>ref|XP_006660556.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic-like 
[Oryza brachyantha]
Length=263

 Score =   239 bits (610),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  508  GAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKVYPGGA  329
            G+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GGPLGE +D +YPGG+
Sbjct  132  GSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGS  191

Query  328  FDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFLVQAIVTGKGPIENLFDHVADPVANN  149
            FDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGF VQAIVTGKGP+ENL DH+ADPV NN
Sbjct  192  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  251

Query  148  AWAYATNFVPGK  113
            AWAYATNFVPGK
Sbjct  252  AWAYATNFVPGK  263



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510