BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF046D11

Length=462
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|Q9M5Z9.1|RS23_EUPES  RecName: Full=40S ribosomal protein S23         192   3e-59   Euphorbia esula [wolf's milk]
gb|KHN48325.1|  40S ribosomal protein S23                               192   4e-59   Glycine soja [wild soybean]
gb|AFK43476.1|  unknown                                                 192   4e-59   Lotus japonicus
ref|XP_008795918.1|  PREDICTED: 40S ribosomal protein S23-like          191   4e-59   Phoenix dactylifera
ref|XP_008369476.1|  PREDICTED: 40S ribosomal protein S23               191   4e-59   Malus domestica [apple tree]
ref|XP_003537257.1|  PREDICTED: 40S ribosomal protein S23-like is...    191   5e-59   Glycine max [soybeans]
ref|XP_004497466.1|  PREDICTED: 40S ribosomal protein S23-like          191   5e-59   Cicer arietinum [garbanzo]
gb|ADH84008.1|  putative ribosomal S23 protein                          191   5e-59   Wolffia arrhiza
ref|XP_008782475.1|  PREDICTED: 40S ribosomal protein S23               191   5e-59   Phoenix dactylifera
ref|XP_002523902.1|  40S ribosomal protein S23, putative                191   5e-59   Ricinus communis
ref|XP_006428872.1|  hypothetical protein CICLE_v10013057mg             191   5e-59   Citrus clementina [clementine]
ref|XP_008354088.1|  PREDICTED: 40S ribosomal protein S23               191   5e-59   
gb|KEH42280.1|  40S ribosomal protein S23-1                             191   5e-59   Medicago truncatula
ref|XP_008783675.1|  PREDICTED: 40S ribosomal protein S23               191   5e-59   Phoenix dactylifera
ref|XP_006843238.1|  hypothetical protein AMTR_s00080p00080700          192   5e-59   
ref|XP_009130734.1|  PREDICTED: 40S ribosomal protein S23-2-like        191   6e-59   Brassica rapa
ref|XP_006845010.1|  hypothetical protein AMTR_s00058p00204160          191   6e-59   
ref|XP_007206114.1|  hypothetical protein PRUPE_ppa013051mg             191   6e-59   Prunus persica
gb|EPS59569.1|  hypothetical protein M569_15236                         191   6e-59   Genlisea aurea
ref|XP_004493945.1|  PREDICTED: 40S ribosomal protein S23-like          191   6e-59   Cicer arietinum [garbanzo]
ref|XP_004294678.1|  PREDICTED: 40S ribosomal protein S23               191   6e-59   Fragaria vesca subsp. vesca
ref|NP_001274976.1|  uncharacterized protein LOC102577739               191   6e-59   Solanum tuberosum [potatoes]
ref|XP_010553016.1|  PREDICTED: 40S ribosomal protein S23 isoform X2    191   6e-59   Tarenaya hassleriana [spider flower]
emb|CBI31516.3|  unnamed protein product                                193   6e-59   Vitis vinifera
ref|XP_006424659.1|  hypothetical protein CICLE_v10029532mg             191   6e-59   
gb|KJB16838.1|  hypothetical protein B456_002G250200                    191   7e-59   Gossypium raimondii
ref|XP_002284863.1|  PREDICTED: 40S ribosomal protein S23-like          191   7e-59   Vitis vinifera
ref|XP_002311115.1|  putative 40S ribosomal protein s12                 191   7e-59   Populus trichocarpa [western balsam poplar]
gb|KGN58936.1|  hypothetical protein Csa_3G736840                       191   7e-59   Cucumis sativus [cucumbers]
ref|XP_010534302.1|  PREDICTED: 40S ribosomal protein S23               191   7e-59   Tarenaya hassleriana [spider flower]
ref|XP_002279025.1|  PREDICTED: 40S ribosomal protein S23               191   7e-59   Vitis vinifera
ref|XP_004137806.1|  PREDICTED: 40S ribosomal protein S23-like          191   7e-59   Cucumis sativus [cucumbers]
emb|CAN75084.1|  hypothetical protein VITISV_024242                     191   7e-59   Vitis vinifera
gb|KJB36648.1|  hypothetical protein B456_006G168700                    192   7e-59   Gossypium raimondii
ref|XP_007009733.1|  Ribosomal protein S12/S23 family protein iso...    191   7e-59   Theobroma cacao [chocolate]
gb|KHG05778.1|  40S ribosomal S23                                       191   7e-59   Gossypium arboreum [tree cotton]
ref|XP_003625582.1|  40S ribosomal protein S23                          191   7e-59   Medicago truncatula
ref|XP_007218498.1|  hypothetical protein PRUPE_ppa012246mg             192   8e-59   
emb|CDY10413.1|  BnaCnng03140D                                          192   8e-59   Brassica napus [oilseed rape]
ref|XP_001763475.1|  predicted protein                                  191   8e-59   
gb|KJB11230.1|  hypothetical protein B456_001G248300                    191   8e-59   Gossypium raimondii
ref|XP_009123272.1|  PREDICTED: 40S ribosomal protein S23-2             191   8e-59   Brassica rapa
ref|NP_001235601.1|  uncharacterized protein LOC100500013               191   8e-59   
gb|ACG32843.1|  40S ribosomal protein S23                               191   9e-59   Zea mays [maize]
gb|ABR16208.1|  unknown                                                 191   9e-59   Picea sitchensis
ref|XP_010104143.1|  40S ribosomal protein S23                          194   9e-59   
ref|XP_006288875.1|  hypothetical protein CARUB_v10002234mg             191   9e-59   
ref|XP_008644390.1|  PREDICTED: 40S ribosomal protein S23-like          192   9e-59   
ref|NP_566351.1|  40S ribosomal protein S23-1                           191   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195916.1|  40S ribosomal protein S23-2                           191   1e-58   Arabidopsis thaliana [mouse-ear cress]
gb|AAF23298.1|AC016661_23  putative 40S ribosomal protein S23           190   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001131287.1|  40S ribosomal protein S23                          191   1e-58   Zea mays [maize]
ref|XP_002968022.1|  hypothetical protein SELMODRAFT_145246             191   1e-58   Selaginella moellendorffii
ref|XP_006299411.1|  hypothetical protein CARUB_v10015571mg             191   1e-58   
gb|ACF83276.1|  unknown                                                 190   1e-58   Zea mays [maize]
ref|XP_003623100.1|  40S ribosomal protein S23                          189   1e-58   
ref|XP_010107592.1|  40S ribosomal protein S23                          191   1e-58   
gb|KEH22874.1|  40S ribosomal protein S23-1                             194   1e-58   Medicago truncatula
ref|XP_010669684.1|  PREDICTED: 40S ribosomal protein S23               190   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002884746.1|  40S ribosomal protein S23                          190   2e-58   Arabidopsis lyrata subsp. lyrata
emb|CBI32689.3|  unnamed protein product                                191   2e-58   Vitis vinifera
emb|CDP06706.1|  unnamed protein product                                191   2e-58   Coffea canephora [robusta coffee]
emb|CBI16256.3|  unnamed protein product                                191   2e-58   Vitis vinifera
ref|XP_007144531.1|  hypothetical protein PHAVU_007G163700g             191   2e-58   Phaseolus vulgaris [French bean]
gb|ACG36826.1|  40S ribosomal protein S23                               190   2e-58   Zea mays [maize]
ref|XP_010924264.1|  PREDICTED: 40S ribosomal protein S23-like          189   2e-58   Elaeis guineensis
ref|XP_008800730.1|  PREDICTED: 40S ribosomal protein S23-like          189   3e-58   Phoenix dactylifera
ref|NP_001242498.1|  uncharacterized protein LOC100776345               189   3e-58   Glycine max [soybeans]
ref|NP_001236975.1|  uncharacterized protein LOC100306064               189   3e-58   
ref|XP_009390177.1|  PREDICTED: 40S ribosomal protein S23               189   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010251237.1|  PREDICTED: 40S ribosomal protein S23-like          189   3e-58   Nelumbo nucifera [Indian lotus]
gb|KDP46156.1|  hypothetical protein JCGZ_06667                         189   4e-58   Jatropha curcas
emb|CDP08934.1|  unnamed protein product                                191   5e-58   Coffea canephora [robusta coffee]
ref|NP_001044720.1|  Os01g0834500                                       189   6e-58   
gb|EEE60183.1|  hypothetical protein OsJ_13124                          188   6e-58   Oryza sativa Japonica Group [Japonica rice]
emb|CDM85021.1|  unnamed protein product                                189   7e-58   Triticum aestivum [Canadian hard winter wheat]
gb|EMS58293.1|  40S ribosomal protein S23                               191   8e-58   Triticum urartu
ref|XP_010475489.1|  PREDICTED: 40S ribosomal protein S23-2-like        188   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010486539.1|  PREDICTED: 40S ribosomal protein S23-2-like        187   1e-57   Camelina sativa [gold-of-pleasure]
emb|CDY41304.1|  BnaA01g32150D                                          191   1e-57   Brassica napus [oilseed rape]
gb|EMS46402.1|  40S ribosomal protein S23                               189   2e-57   Triticum urartu
gb|ACJ83931.1|  unknown                                                 187   2e-57   Medicago truncatula
ref|XP_010464620.1|  PREDICTED: 40S ribosomal protein S23-1-like        187   3e-57   Camelina sativa [gold-of-pleasure]
gb|KJB36649.1|  hypothetical protein B456_006G168700                    187   1e-56   Gossypium raimondii
ref|XP_006391002.1|  hypothetical protein EUTSA_v10019491mg             185   2e-56   
gb|ADJ67168.1|  ribosomal protein S23                                   185   2e-56   Jatropha curcas
ref|XP_009797396.1|  PREDICTED: 40S ribosomal protein S23-like          184   2e-56   Nicotiana sylvestris
ref|XP_005848558.1|  hypothetical protein CHLNCDRAFT_59661              184   6e-56   Chlorella variabilis
ref|XP_008620553.1|  40S ribosomal protein S23                          183   1e-55   Saprolegnia diclina VS20
emb|CCA18798.1|  Ribosomal protein S23 putative                         183   1e-55   Albugo laibachii Nc14
gb|EAZ14059.1|  hypothetical protein OsJ_03983                          188   2e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001690993.1|  ribosomal protein S23, component of cytosoli...    182   2e-55   Chlamydomonas reinhardtii
gb|KIY98576.1|  40S ribosomal protein S23                               182   2e-55   Monoraphidium neglectum
ref|XP_009390966.1|  PREDICTED: uncharacterized protein LOC103977...    190   2e-55   
ref|XP_005651536.1|  ribosomal protein S23 component of cytosolic...    181   4e-55   Coccomyxa subellipsoidea C-169
ref|XP_010911313.1|  PREDICTED: 40S ribosomal protein S23-like          181   8e-55   Elaeis guineensis
ref|XP_009824591.1|  40S ribosomal protein S23                          181   8e-55   Aphanomyces astaci
ref|XP_003740234.1|  PREDICTED: 40S ribosomal protein S23-like          181   9e-55   
ref|XP_011399420.1|  40S ribosomal protein S23-2                        181   1e-54   Auxenochlorella protothecoides
ref|XP_001631263.1|  predicted protein                                  180   1e-54   Nematostella vectensis
ref|XP_008863841.1|  40S ribosomal protein S23                          180   1e-54   Aphanomyces invadans
ref|XP_002177540.1|  predicted protein                                  180   2e-54   Phaeodactylum tricornutum CCAP 1055/1
gb|KFH62659.1|  40S ribosomal protein S23                               180   2e-54   Mortierella verticillata NRRL 6337
emb|CDH61389.1|  40s ribosomal protein s23                              180   2e-54   Lichtheimia corymbifera JMRC:FSU:9682
gb|ESA17945.1|  hypothetical protein GLOINDRAFT_344852                  179   3e-54   
ref|XP_002290100.1|  RS23, ribosomal protein 23 40S small ribosom...    179   3e-54   Thalassiosira pseudonana CCMP1335
gb|ACY66586.1|  putative ribosomal protein S23e                         179   3e-54   Scylla paramamosain
ref|XP_009038594.1|  hypothetical protein AURANDRAFT_28783              179   4e-54   Aureococcus anophagefferens
emb|CDJ41145.1|  Apicoplast 30S ribosomal protein S12                   179   5e-54   Eimeria tenella
emb|CEI98769.1|  Putative 40S ribosomal protein S23                     179   5e-54   Rhizopus microsporus
emb|CEI99360.1|  Putative 40S ribosomal protein S23                     179   6e-54   Rhizopus microsporus
ref|XP_001656190.1|  AAEL012686-PA                                      178   6e-54   Aedes aegypti
sp|Q86FP7.1|RS23_DERVA  RecName: Full=40S ribosomal protein S23         178   6e-54   Dermacentor variabilis
gb|ABD98760.1|  putative ribosomal protein S23e                         178   7e-54   Graphocephala atropunctata
gb|EPB89248.1|  40S ribosomal protein S23                               178   7e-54   Mucor circinelloides f. circinelloides 1006PhL
emb|CEG70261.1|  Putative 40S ribosomal protein S23                     178   7e-54   Rhizopus microsporus
gb|AHY30855.1|  ribosomal protein S23                                   178   7e-54   Periplaneta americana
gb|ABW23151.1|  ribosomal protein rps23                                 178   8e-54   Arenicola marina [rock worm]
ref|XP_008468562.1|  PREDICTED: 40S ribosomal protein S23               178   8e-54   Diaphorina citri
ref|NP_001156067.1|  40S ribosomal protein S23-like                     178   8e-54   Acyrthosiphon pisum
gb|ABY62742.1|  ribosomal protein S23e                                  178   8e-54   Artemia franciscana
ref|XP_002433088.1|  40S ribosomal protein S23, putative                178   8e-54   Pediculus humanus corporis [human body lice]
ref|XP_005759731.1|  hypothetical protein EMIHUDRAFT_433073             178   9e-54   Emiliania huxleyi CCMP1516
gb|ABM55585.1|  putative ribosomal protein S23e                         178   9e-54   Maconellicoccus hirsutus [pink hibiscus mealybug]
emb|CCQ18581.1|  40S ribosomal protein S23                              178   9e-54   Sycon ciliatum
gb|ACD65149.1|  putative 40S ribosomal protein RPS23                    178   9e-54   Phoronis muelleri
emb|CEG68669.1|  Putative 40S ribosomal protein S23                     179   1e-53   Rhizopus microsporus
ref|XP_003540751.1|  PREDICTED: 40S ribosomal protein S23-like          179   1e-53   
emb|CDJ56296.1|  ribosomal protein S23, putative                        177   1e-53   Eimeria maxima
gb|AGH70206.1|  40S ribosomal protein S23                               177   1e-53   Placozoa sp. H4
ref|XP_002108915.1|  40S ribosomal protein S23                          177   1e-53   Trichoplax adhaerens
gb|EIE78312.1|  40S ribosomal protein S23                               178   1e-53   Rhizopus delemar RA 99-880
ref|XP_008915203.1|  40S ribosomal protein S23                          177   1e-53   Phytophthora parasitica INRA-310
ref|XP_002606537.1|  hypothetical protein BRAFLDRAFT_130085             177   1e-53   Branchiostoma floridae
emb|CDJ50577.1|  ribosomal protein S23, putative                        177   1e-53   Eimeria brunetti
gb|KHN05713.1|  40S ribosomal protein S23                               177   1e-53   Glycine soja [wild soybean]
gb|EWM20921.1|  40s ribosomal protein s23                               177   1e-53   Nannochloropsis gaditana
ref|XP_007888735.1|  PREDICTED: 40S ribosomal protein S23               177   1e-53   Callorhinchus milii [Australian ghost shark]
gb|EIE84601.1|  40S ribosomal protein S23                               177   1e-53   Rhizopus delemar RA 99-880
ref|XP_008319279.1|  PREDICTED: 40S ribosomal protein S23               177   1e-53   Cynoglossus semilaevis [half-smooth tongue sole]
gb|KFH64309.1|  small subunit ribosomal protein S23e                    182   1e-53   Mortierella verticillata NRRL 6337
ref|XP_002734646.1|  PREDICTED: 40S ribosomal protein S23-like          177   2e-53   Saccoglossus kowalevskii
ref|XP_004493946.1|  PREDICTED: 40S ribosomal protein S23-like          176   2e-53   Cicer arietinum [garbanzo]
gb|ADW95790.1|  40S ribosomal S23-like protein                          177   2e-53   Pectinaria gouldii
gb|ELU03157.1|  hypothetical protein CAPTEDRAFT_155210                  177   2e-53   Capitella teleta
emb|CBY09292.1|  unnamed protein product                                177   2e-53   Oikopleura dioica
gb|EFX84739.1|  hypothetical protein DAPPUDRAFT_230600                  177   2e-53   Daphnia pulex
ref|XP_007825599.2|  Ribosomal protein S12/S23                          177   2e-53   Metarhizium robertsii ARSEF 23
ref|NP_001292243.1|  40S ribosomal protein S23                          177   2e-53   Crassostrea gigas
emb|CAD98683.1|  ribosomal protein S23                                  177   3e-53   Cryptosporidium parvum
gb|ABW90428.1|  putative ribosomal protein S23                          177   3e-53   Barentsia elongata
ref|XP_001388310.1|  ribosomal protein S23                              177   3e-53   Cryptosporidium parvum Iowa II
ref|WP_028830520.1|  30S ribosomal protein S12                          176   4e-53   
gb|ACY71268.1|  ribosomal protein S23                                   176   4e-53   Chrysomela tremula
ref|XP_006973124.1|  PREDICTED: 40S ribosomal protein S23-like          176   4e-53   
emb|CAH04343.1|  S23e ribosomal protein                                 176   4e-53   Biphyllus lunatus
ref|XP_005835765.1|  small subunit ribosomal protein S23e, cytopl...    176   4e-53   Guillardia theta CCMP2712
emb|CAJ01861.1|  ribosomal protein S23e                                 176   4e-53   Meladema coriacea
ref|XP_973351.1|  PREDICTED: 40S ribosomal protein S23                  176   4e-53   Tribolium castaneum [rust-red flour beetle]
gb|ABI52808.1|  40S ribosomal protein S23                               176   4e-53   Argas monolakensis
ref|XP_005103665.1|  PREDICTED: 40S ribosomal protein S23-like          176   4e-53   Aplysia californica
ref|XP_003062147.1|  predicted protein                                  176   4e-53   Micromonas pusilla CCMP1545
dbj|GAN09498.1|  40S ribosomal protein S23                              179   4e-53   Mucor ambiguus
dbj|BAN20179.1|  ribosomal protein S23                                  176   4e-53   Riptortus pedestris
emb|CAJ01860.1|  ribosomal protein S23e                                 176   5e-53   Hister sp. APV-2005
ref|XP_010211874.1|  PREDICTED: 40S ribosomal protein S23               176   5e-53   Tinamus guttatus
ref|XP_002768542.1|  ribosomal protein S23, putative                    176   5e-53   Perkinsus marinus ATCC 50983
gb|ADG29194.1|  40S ribosomal protein S23                               176   5e-53   Epinephelus coioides [estuary cod]
ref|XP_010408179.1|  PREDICTED: 40S ribosomal protein S23               176   5e-53   
ref|XP_009639412.1|  PREDICTED: 40S ribosomal protein S23               176   5e-53   Egretta garzetta
ref|XP_004636816.1|  PREDICTED: 40S ribosomal protein S23-like          176   5e-53   
tpe|CAL69112.1|  TPA: putative 40S ribosomal protein S23                176   5e-53   Spadella cephaloptera
ref|XP_001418209.1|  Ribosomal protein S23, component of cytosoli...    176   5e-53   Ostreococcus lucimarinus CCE9901
emb|CDQ84030.1|  unnamed protein product                                177   5e-53   Oncorhynchus mykiss
ref|XP_005496177.1|  PREDICTED: 40S ribosomal protein S23               176   5e-53   
gb|KFO06325.1|  40S ribosomal protein S23                               176   5e-53   Balearica regulorum gibbericeps
sp|Q6EV23.1|RS23_PAPDA  RecName: Full=40S ribosomal protein S23         176   5e-53   Papilio dardanus [flying handkerchief]
gb|AEL28841.1|  ribosomal protein S23                                   176   5e-53   Heliconius melpomene cythera
ref|XP_004880193.1|  PREDICTED: 40S ribosomal protein S23               176   5e-53   
ref|XP_009511287.1|  PREDICTED: 40S ribosomal protein S23               174   5e-53   Phalacrocorax carbo [common cormorant]
ref|XP_011376000.1|  PREDICTED: 40S ribosomal protein S23               176   6e-53   Pteropus vampyrus
ref|XP_009557726.1|  PREDICTED: 40S ribosomal protein S23               176   6e-53   Cuculus canorus
gb|AAV91403.1|  ribosomal protein 5                                     176   6e-53   Lonomia obliqua
ref|XP_010308642.1|  PREDICTED: 40S ribosomal protein S23               176   6e-53   Balearica regulorum gibbericeps
tpg|DAA24622.1|  TPA: ribosomal protein S23-like                        176   6e-53   Bos taurus [bovine]
ref|NP_001037273.1|  ribosomal protein S23                              176   7e-53   Bombyx mori [silk moth]
emb|CEP10565.1|  hypothetical protein                                   176   7e-53   Parasitella parasitica
gb|EHJ73701.1|  40S ribosomal protein S23                               175   7e-53   
ref|XP_003646303.1|  hypothetical protein Ecym_4440                     176   7e-53   Eremothecium cymbalariae DBVPG#7215
ref|XP_007066505.1|  PREDICTED: 40S ribosomal protein S23-like          177   7e-53   
ref|XP_005010799.1|  PREDICTED: 40S ribosomal protein S23               174   7e-53   
ref|XP_010175359.1|  PREDICTED: 40S ribosomal protein S23               176   7e-53   Antrostomus carolinensis
tpg|DAA12825.1|  TPA: ribosomal protein S23-like                        176   7e-53   Bos taurus [bovine]
gb|EAX05328.1|  hCG1990955, isoform CRA_b                               174   7e-53   Homo sapiens [man]
gb|ELW63939.1|  40S ribosomal protein S23                               176   7e-53   Tupaia chinensis
ref|NP_001016.1|  40S ribosomal protein S23                             176   8e-53   Homo sapiens [man]
ref|XP_007432677.1|  PREDICTED: 40S ribosomal protein S23-like          176   8e-53   Python bivittatus
ref|XP_006035617.1|  PREDICTED: 40S ribosomal protein S23-like          176   8e-53   Alligator sinensis
ref|XP_010075782.1|  PREDICTED: 40S ribosomal protein S23               176   8e-53   Pterocles gutturalis
gb|EDL00975.1|  mCG113987                                               176   8e-53   Mus musculus [mouse]
ref|NP_998929.1|  40S ribosomal protein S23                             176   8e-53   Sus scrofa [pigs]
gb|ABV22458.1|  ribosomal protein S23e                                  176   8e-53   Oxyrrhis marina
dbj|BAB27102.1|  unnamed protein product                                176   8e-53   Mus musculus [mouse]
gb|AAR10268.1|  similar to Drosophila melanogaster CG8415               176   8e-53   Drosophila yakuba
emb|CBN80657.1|  40S ribosomal protein S23                              176   9e-53   Dicentrarchus labrax [European sea bass]
sp|Q9GRJ3.1|RS23_LUMRU  RecName: Full=40S ribosomal protein S23         176   9e-53   Lumbricus rubellus
ref|XP_004586359.1|  PREDICTED: 40S ribosomal protein S23               177   9e-53   Ochotona princeps [southern American pika]
emb|CEP13265.1|  hypothetical protein                                   176   9e-53   Parasitella parasitica
gb|KFO57084.1|  40S ribosomal protein S23                               176   9e-53   Corvus brachyrhynchos
ref|XP_008940828.1|  PREDICTED: 40S ribosomal protein S23               176   9e-53   Merops nubicus
pdb|4D5L|X  Chain X, Cryo-em Structures Of Ribosomal 80s Complexe...    175   9e-53   Oryctolagus cuniculus [domestic rabbit]
ref|NP_001133209.1|  ribosomal protein S23-1                            176   9e-53   Salmo salar
ref|NP_001187084.1|  40S ribosomal protein S23                          176   1e-52   Ictalurus punctatus
ref|XP_795223.2|  PREDICTED: 40S ribosomal protein S23-like             176   1e-52   
ref|XP_007251538.1|  PREDICTED: 40S ribosomal protein S23-like          175   1e-52   Astyanax mexicanus [blind cave fish]
ref|NP_001103591.1|  40S ribosomal protein S23                          175   1e-52   Danio rerio [leopard danio]
ref|XP_002499765.1|  predicted protein                                  175   1e-52   Micromonas commoda
gb|ERE81671.1|  40S ribosomal protein S23-like protein                  176   1e-52   Cricetulus griseus [Chinese hamsters]
ref|XP_007079849.1|  PREDICTED: 40S ribosomal protein S23               178   1e-52   Panthera tigris altaica
gb|ELR50552.1|  40S ribosomal protein S23                               175   1e-52   Bos mutus
gb|ABV22462.1|  ribosomal protein S23e                                  175   1e-52   Oxyrrhis marina
emb|CAG10754.1|  unnamed protein product                                175   1e-52   Tetraodon nigroviridis
ref|XP_006124430.1|  PREDICTED: 40S ribosomal protein S23-like          175   1e-52   
gb|KDN41434.1|  putative 40S ribosomal protein S23                      175   1e-52   Tilletiaria anomala UBC 951
ref|XP_003981174.2|  PREDICTED: 40S ribosomal protein S23               177   1e-52   Felis catus [cat]
ref|XP_011275840.1|  30S ribosomal protein S12P                         175   1e-52   Wickerhamomyces ciferrii
ref|NP_610939.2|  ribosomal protein S23, isoform A                      175   1e-52   Drosophila melanogaster
gb|AAR09841.1|  similar to Drosophila melanogaster CG8415               175   1e-52   Drosophila yakuba
ref|XP_010017251.1|  PREDICTED: 40S ribosomal protein S23               176   1e-52   Nestor notabilis
ref|XP_004206145.1|  PREDICTED: 40S ribosomal protein S23-like is...    175   1e-52   Hydra vulgaris
gb|EFB25891.1|  hypothetical protein PANDA_004337                       176   1e-52   Ailuropoda melanoleuca
emb|CCK68433.1|  hypothetical protein KNAG_0A07810                      175   1e-52   Kazachstania naganishii CBS 8797
ref|XP_008921333.1|  PREDICTED: 40S ribosomal protein S23               176   1e-52   
emb|CBJ31696.1|  Ribosomal protein S23, component of cytosolic 80...    177   1e-52   Ectocarpus siliculosus
gb|KFW80273.1|  40S ribosomal protein S23                               175   1e-52   Manacus vitellinus
emb|CDQ67278.1|  unnamed protein product                                176   1e-52   Oncorhynchus mykiss
ref|XP_010279816.1|  PREDICTED: 40S ribosomal protein S23-like          175   1e-52   Phaethon lepturus
ref|XP_006990559.1|  PREDICTED: 40S ribosomal protein S23-like          175   1e-52   
ref|XP_002140715.1|  40S ribosomal protein S23                          175   1e-52   Cryptosporidium muris RN66
gb|ETE65751.1|  40S ribosomal protein S23                               175   1e-52   Ophiophagus hannah
ref|XP_005236257.1|  PREDICTED: 40S ribosomal protein S23               177   2e-52   Falco peregrinus [peregrine]
ref|XP_005513905.1|  PREDICTED: 40S ribosomal protein S23               176   2e-52   
gb|EPY79012.1|  ribosomal protein S28ue-like protein                    176   2e-52   Camelus ferus
ref|XP_008629242.1|  PREDICTED: 40S ribosomal protein S23               176   2e-52   
gb|KID82622.1|  Ribosomal protein S12/S23                               175   2e-52   Metarhizium guizhouense ARSEF 977
ref|XP_009909001.1|  PREDICTED: 40S ribosomal protein S23               175   2e-52   Picoides pubescens
gb|ACN10021.1|  40S ribosomal protein S23                               176   2e-52   Salmo salar
gb|ABJ98616.1|  40S ribosomal protein S23                               174   2e-52   Scophthalmus maximus
ref|XP_006124396.1|  PREDICTED: 40S ribosomal protein S23-like          176   2e-52   
ref|XP_011336175.1|  PREDICTED: 40S ribosomal protein S23-like          174   2e-52   Ooceraea biroi
gb|EJK47606.1|  hypothetical protein THAOC_33660                        174   2e-52   Thalassiosira oceanica
gb|AAX62402.1|  ribosomal protein S23                                   174   2e-52   Lysiphlebus testaceipes
ref|XP_010641429.1|  PREDICTED: 40S ribosomal protein S23               177   2e-52   
ref|XP_006143548.1|  PREDICTED: 40S ribosomal protein S23               177   2e-52   
emb|CDQ83206.1|  unnamed protein product                                176   2e-52   Oncorhynchus mykiss
sp|P90707.1|RS23_BRUMA  RecName: Full=40S ribosomal protein S23         174   2e-52   Brugia malayi [agent of lymphatic filariasis]
ref|XP_001900836.1|  40S ribosomal protein S23                          174   2e-52   Brugia malayi [agent of lymphatic filariasis]
ref|XP_624651.2|  PREDICTED: 40S ribosomal protein S23-like             174   2e-52   Apis mellifera [bee]
gb|EPB91744.1|  hypothetical protein HMPREF1544_01456                   180   3e-52   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_003401361.1|  PREDICTED: 40S ribosomal protein S23-like          174   3e-52   Bombus terrestris [large earth bumblebee]
ref|XP_011054615.1|  PREDICTED: 40S ribosomal protein S23               174   3e-52   Acromyrmex echinatior
ref|XP_004179710.1|  hypothetical protein TBLA_0C03900                  174   3e-52   Tetrapisispora blattae CBS 6284
ref|XP_003382653.1|  PREDICTED: 40S ribosomal protein S23               174   3e-52   Amphimedon queenslandica
gb|EFZ12522.1|  hypothetical protein SINV_14421                         174   3e-52   
ref|XP_452029.1|  40S ribosomal protein S23                             174   3e-52   Kluyveromyces lactis
ref|XP_005077844.1|  PREDICTED: 40S ribosomal protein S23-like          174   3e-52   Mesocricetus auratus [Syrian golden hamster]
gb|AAI00604.1|  Ribosomal protein S23                                   174   3e-52   Mus musculus [mouse]
gb|AFP65302.1|  60S ribosomal protein S23                               174   3e-52   Chroomonas mesostigmatica CCMP1168
gb|EHK21767.1|  hypothetical protein TRIVIDRAFT_151803                  174   3e-52   Trichoderma virens Gv29-8
ref|XP_001217153.1|  40S ribosomal protein S23                          174   3e-52   Aspergillus terreus NIH2624
ref|XP_001255064.5|  PREDICTED: 40S ribosomal protein S23 isoform X1    175   3e-52   
gb|ADK47153.1|  ribosomal protein S23a                                  172   3e-52   Arachnula sp. CL22
ref|XP_004026549.1|  PREDICTED: 40S ribosomal protein S23-like is...    174   3e-52   
gb|EFN83081.1|  40S ribosomal protein S23                               173   3e-52   Harpegnathos saltator
emb|CDR36988.1|  CYFA0S01e06172g1_1                                     174   3e-52   Cyberlindnera fabianii
gb|ENH84304.1|  40s ribosomal protein s23                               174   3e-52   
gb|ABV22460.1|  ribosomal protein S23e                                  174   3e-52   Oxyrrhis marina
ref|XP_004179855.1|  hypothetical protein TBLA_0C05385                  174   3e-52   Tetrapisispora blattae CBS 6284
ref|XP_007815741.1|  ribosomal protein S28                              174   3e-52   Metarhizium acridum CQMa 102
ref|XP_001712429.1|  rps23                                              174   3e-52   
gb|KGK39136.1|  hypothetical protein JL09_g1729                         174   4e-52   
gb|EPZ31428.1|  40S ribosomal protein S23                               174   4e-52   
gb|KFB44290.1|  AGAP001544-PA-like protein                              180   4e-52   
ref|XP_009686890.1|  PREDICTED: 40S ribosomal protein S23               177   4e-52   
ref|XP_004374621.1|  PREDICTED: 40S ribosomal protein S23               175   4e-52   
ref|XP_008551312.1|  PREDICTED: 40S ribosomal protein S23               174   4e-52   
ref|XP_009639413.1|  PREDICTED: 40S ribosomal protein S23-like          176   4e-52   
ref|XP_006889952.1|  PREDICTED: 40S ribosomal protein S23               176   4e-52   
ref|XP_001600581.1|  PREDICTED: 40S ribosomal protein S23               174   4e-52   
ref|XP_010724388.1|  PREDICTED: 40S ribosomal protein S23               176   4e-52   
ref|XP_003685383.1|  40S ribosomal protein S23                          174   5e-52   
ref|NP_001011499.1|  ribosomal protein S23                              174   5e-52   
ref|NP_982649.1|  40S ribosomal protein S23                             174   5e-52   
gb|ETN58508.1|  hypothetical protein AND_009911                         179   5e-52   
ref|XP_006686182.1|  40S ribosomal protein S23                          174   5e-52   
gb|AGO10098.1|  AaceriAAR108Cp                                          174   5e-52   
ref|NP_001086902.1|  ribosomal protein S23                              174   5e-52   
gb|ABX44795.1|  putative 40S ribosomal protein RPS23                    174   5e-52   
ref|XP_004712116.1|  PREDICTED: 40S ribosomal protein S23-like          173   6e-52   
pdb|1S1H|L  Chain L, Structure Of The Ribosomal 80s-Eef2-Sordarin...    172   6e-52   
ref|XP_002554805.1|  40S ribosomal protein S23                          174   6e-52   
emb|CDK25067.1|  unnamed protein product                                173   6e-52   
ref|XP_005955750.1|  PREDICTED: 40S ribosomal protein S23-like          173   6e-52   
ref|XP_005357367.1|  PREDICTED: 40S ribosomal protein S23-like          173   7e-52   
ref|XP_002367901.1|  ribosomal protein S23, putative                    173   7e-52   
gb|EDL32837.1|  mCG14520                                                173   7e-52   
ref|XP_002616098.1|  40S ribosomal protein S23                          173   7e-52   
ref|XP_007376864.1|  hypothetical protein SPAPADRAFT_56791              173   7e-52   
gb|ERG86982.1|  40s ribosomal protein s23                               173   7e-52   
ref|XP_001382730.1|  40S ribosomal protein S23                          173   7e-52   
ref|XP_005536248.1|  40S ribosomal protein S23                          173   7e-52   
ref|XP_718756.1|  likely cytosolic ribosomal protein S23                173   8e-52   
pdb|4UJF|Y  Chain Y, Crystal Structure Of Narciclasine Bound To T...    173   8e-52   
ref|XP_009021996.1|  hypothetical protein HELRODRAFT_192684             173   9e-52   
ref|XP_005427049.1|  PREDICTED: putative uncharacterized protein ...    181   9e-52   
ref|NP_015457.1|  ribosomal 40S subunit protein S23B                    173   9e-52   
ref|XP_007873363.1|  30S ribosomal protein S23 (S12)                    173   9e-52   
emb|CCJ31155.1|  unnamed protein product                                173   9e-52   
gb|EEU08321.1|  Rps23ap                                                 173   1e-51   
ref|XP_459670.1|  40S ribosomal protein S23                             173   1e-51   
ref|XP_009054373.1|  hypothetical protein LOTGIDRAFT_202410             173   1e-51   
gb|EDL21920.1|  mCG127957                                               172   1e-51   
emb|CEP60337.1|  LALA0S01e08438g1_1                                     173   1e-51   
emb|CAY79875.1|  Rps23ap                                                173   1e-51   
emb|CEJ93878.1|  Putative Ribosomal protein S28                         172   1e-51   
emb|CEJ81289.1|  Putative 40S ribosomal protein S23                     172   1e-51   
ref|XP_009220344.1|  40S ribosomal protein S23                          172   1e-51   
ref|XP_009252701.1|  hypothetical protein FPSE_01306                    172   1e-51   
ref|XP_006677690.1|  40S ribosomal protein S23                          172   1e-51   
ref|XP_001528087.1|  40S ribosomal protein S23                          172   1e-51   
gb|ABE68883.1|  ribosomal protein S28                                   172   1e-51   
emb|CCA68637.1|  probable ribosomal protein S28                         172   1e-51   
gb|KIM30514.1|  hypothetical protein M408DRAFT_286825                   172   1e-51   
gb|AAX48899.1|  S23                                                     172   1e-51   
ref|XP_003121525.1|  PREDICTED: 40S ribosomal protein S23-like          172   1e-51   
ref|XP_003048047.1|  40S ribosomal protein S23                          172   1e-51   
ref|XP_006035623.1|  PREDICTED: 40S ribosomal protein S23-like          172   2e-51   
ref|XP_003006042.1|  40S ribosomal protein S23                          172   2e-51   
ref|NP_001027679.1|  40S ribosomal protein S23                          172   2e-51   
gb|KFM71174.1|  40S ribosomal protein S23                               172   2e-51   
ref|XP_006672679.1|  40S ribosomal protein S23                          172   2e-51   
emb|CDY62061.1|  BnaC06g43330D                                          172   2e-51   
ref|XP_001482471.1|  40S ribosomal protein S23                          172   2e-51   
gb|AJR78695.1|  Rps23ap                                                 172   2e-51   
gb|EQK99981.1|  Ribosomal protein S12/S23                               172   2e-51   
gb|EHH25415.1|  hypothetical protein EGK_21155                          172   2e-51   
ref|XP_006691045.1|  40S ribosomal protein s23-like protein             172   2e-51   
ref|XP_005959475.1|  PREDICTED: uncharacterized protein LOC102325901    178   2e-51   
ref|XP_003657647.1|  40S ribosomal protein S23                          172   2e-51   
gb|KIM75516.1|  hypothetical protein PILCRDRAFT_98922                   172   2e-51   
ref|XP_007339517.1|  ribosomal protein S12/S23                          172   2e-51   
ref|XP_007592122.1|  ribosomal protein S12                              172   2e-51   
gb|EHH54382.1|  40S ribosomal protein S23                               172   2e-51   
ref|XP_002412862.1|  40S ribosomal protein S23, putative                172   2e-51   
gb|KIJ23293.1|  hypothetical protein M422DRAFT_217601                   172   2e-51   
ref|XP_003350640.1|  40S ribosomal protein S23                          172   2e-51   
ref|XP_001225656.1|  40S ribosomal protein S23                          172   2e-51   
gb|EPE09284.1|  40s ribosomal protein s23                               172   2e-51   
ref|XP_003866440.1|  Rps23a ribosomal protein                           172   2e-51   
ref|XP_007284351.1|  40s ribosomal protein s23                          172   2e-51   
ref|XP_003717873.1|  40S ribosomal protein S23                          172   2e-51   
ref|XP_001909330.1|  hypothetical protein                               172   2e-51   
ref|XP_007914852.1|  putative 40s ribosomal protein s23 protein         172   2e-51   
ref|XP_007972118.1|  PREDICTED: 40S ribosomal protein S23-like          176   3e-51   
gb|EFW98796.1|  ribosomal protein s23                                   172   3e-51   
gb|EST08472.1|  40S ribosomal protein S23                               172   3e-51   
ref|XP_007835832.1|  40S ribosomal protein S23                          172   3e-51   
ref|XP_007381448.1|  ribosomal protein S12/S23                          172   3e-51   
gb|KFH44316.1|  40S ribosomal protein-like protein                      172   3e-51   
dbj|BAD26702.1|  ribosomal protein S23                                  172   3e-51   
gb|KJA19889.1|  hypothetical protein HYPSUDRAFT_43755                   172   3e-51   
gb|EMS24006.1|  40S ribosomal protein s23                               172   3e-51   
ref|XP_007397372.1|  hypothetical protein PHACADRAFT_258701             172   3e-51   
ref|XP_007878871.1|  hypothetical protein PFL1_03164                    172   3e-51   
ref|XP_007267033.1|  ribosomal protein S12/S23                          171   3e-51   
ref|XP_004340976.1|  ribosomal protein S23 (S12), putative              171   3e-51   
emb|CDJ02136.1|  ribosomal protein S23, putative                        172   3e-51   
ref|XP_001877378.1|  40S ribosomal protein S23                          172   3e-51   
gb|KDR75866.1|  hypothetical protein GALMADRAFT_248596                  172   3e-51   
ref|XP_001646183.1|  hypothetical protein Kpol_1039p74                  171   4e-51   
emb|CAX79169.1|  Ribosomal Protein, Small subunit                       171   4e-51   
dbj|BAJ94564.1|  predicted protein                                      171   4e-51   
ref|XP_008033639.1|  ribosomal protein S12/S23                          171   4e-51   
gb|AAW26778.1|  SJCHGC02768 protein                                     171   4e-51   
gb|KIY73069.1|  ribosomal protein S12/S23                               171   4e-51   
ref|XP_007766564.1|  ribosomal protein S12 S23                          171   4e-51   
ref|XP_007309958.1|  ribosomal protein S12/S23                          171   4e-51   
ref|XP_004197020.1|  Piso0_004255                                       171   4e-51   
gb|EUB56664.1|  40S ribosomal protein S23                               172   4e-51   
gb|KIW05201.1|  40S ribosomal protein S23                               171   4e-51   
emb|CDF90812.1|  ZYBA0S08-03664g1_1                                     171   4e-51   
gb|EKC41960.1|  40S ribosomal protein S23                               183   4e-51   
gb|ESX00821.1|  40S ribosomal protein S23                               171   4e-51   
ref|XP_002495151.1|  40S ribosomal protein S23                          171   4e-51   
gb|EYE92497.1|  ribosomal protein of the small subunit                  171   4e-51   
emb|CCD82696.1|  putative 30s ribosomal protein S12 family member       171   4e-51   
ref|XP_001392215.1|  40S ribosomal protein S23                          171   4e-51   
gb|KIL66227.1|  hypothetical protein M378DRAFT_161091                   171   4e-51   
gb|KDE07636.1|  40S ribosomal protein S23                               171   5e-51   
ref|NP_502365.1|  Protein RPS-23                                        171   5e-51   
ref|XP_005553979.1|  PREDICTED: 40S ribosomal protein S23-like          172   5e-51   
ref|XP_005694063.1|  PREDICTED: 40S ribosomal protein S23-like          171   5e-51   
ref|XP_005717245.1|  unnamed protein product                            171   6e-51   
ref|XP_009104986.1|  PREDICTED: 40S ribosomal protein S23-like          171   6e-51   
ref|XP_500301.1|  40S ribosomal protein S23                             171   6e-51   
ref|XP_010798308.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    171   6e-51   
gb|KDQ28131.1|  hypothetical protein PLEOSDRAFT_1112875                 171   6e-51   
ref|XP_003029367.1|  40S ribosomal protein S23                          171   6e-51   
ref|XP_001264821.1|  40S ribosomal protein S23                          171   6e-51   
ref|XP_003820240.1|  PREDICTED: 40S ribosomal protein S23-like          170   6e-51   
gb|KIK27682.1|  hypothetical protein PISMIDRAFT_165436                  171   6e-51   
ref|XP_002475553.1|  40S ribosomal protein S23                          171   6e-51   
gb|ACH44468.1|  putative ribosomal protein S23                          171   7e-51   
gb|KIJ07498.1|  hypothetical protein PAXINDRAFT_173457                  171   7e-51   
gb|KDB13780.1|  ribosomal protein S28                                   172   7e-51   
gb|ABV22461.1|  ribosomal protein S23e                                  171   7e-51   
gb|KEF61255.1|  40S ribosomal protein S23                               171   7e-51   
ref|XP_752311.1|  ribosomal protein S23 (S12)                           171   8e-51   
gb|KIK47115.1|  hypothetical protein CY34DRAFT_799658                   171   8e-51   
ref|XP_658949.1|  RS23_NEUCR 40S ribosomal protein S23                  171   8e-51   
gb|KIM69751.1|  hypothetical protein SCLCIDRAFT_1208266                 171   8e-51   
ref|XP_007121329.1|  PREDICTED: 40S ribosomal protein S23-like          171   8e-51   
gb|KFY09345.1|  hypothetical protein V491_08243                         171   8e-51   
gb|KIM40102.1|  hypothetical protein M413DRAFT_170515                   171   8e-51   
gb|ETN68349.1|  ribosomal protein S23                                   171   8e-51   
ref|XP_007000823.1|  hypothetical protein TREMEDRAFT_36465              171   8e-51   
emb|CAB56815.1|  ribosomal protein S28                                  171   9e-51   
ref|XP_007726456.1|  40S ribosomal protein S23                          171   9e-51   
gb|ACI69986.1|  40S ribosomal protein S23                               171   9e-51   
ref|XP_005716704.1|  ribosomal protein S23                              170   1e-50   
gb|EPT04602.1|  hypothetical protein FOMPIDRAFT_1021817                 170   1e-50   
ref|XP_002560633.1|  Pc16g02610                                         170   1e-50   
gb|EKV12653.1|  40S ribosomal protein S23                               170   1e-50   
ref|XP_001830591.1|  40S ribosomal protein S23                          170   1e-50   
ref|XP_003380006.1|  40S ribosomal protein S23                          171   1e-50   
ref|XP_007791889.1|  putative 40s ribosomal protein s23 protein         170   1e-50   
ref|XP_005958197.1|  PREDICTED: 40S ribosomal protein S23-like          170   1e-50   
gb|KDD76118.1|  ribosomal protein S12                                   170   1e-50   
gb|ADF28518.1|  putative ribosomal protein S23                          170   1e-50   
gb|KEZ40958.1|  40s ribosomal protein s23                               170   1e-50   
ref|XP_007755185.1|  40S ribosomal protein S23                          170   2e-50   
ref|XP_008717612.1|  40S ribosomal protein S23                          170   2e-50   
ref|XP_572112.1|  40s ribosomal protein s23                             170   2e-50   
gb|EUC64183.1|  40S ribosomal protein S23                               170   2e-50   
ref|XP_001588322.1|  40S ribosomal protein S23                          170   2e-50   
gb|KDB14539.1|  ribosomal protein S28                                   170   2e-50   
ref|XP_004606589.1|  PREDICTED: 40S ribosomal protein S23-like          170   2e-50   
dbj|GAC71314.1|  40S ribosomal protein S23                              174   2e-50   
ref|XP_007292974.1|  40S ribosomal protein S23                          170   2e-50   
ref|XP_001557680.1|  40S ribosomal protein S23                          170   2e-50   
gb|ELR07609.1|  40S ribosomal protein S23                               170   2e-50   
ref|XP_001611232.1|  40S ribosomal protein S12P                         170   2e-50   
gb|KDN45114.1|  40S ribosomal protein S23                               170   2e-50   
ref|XP_006461121.1|  hypothetical protein AGABI2DRAFT_192658            170   2e-50   
dbj|GAM82847.1|  hypothetical protein ANO11243_008330                   169   2e-50   
gb|KIN06638.1|  hypothetical protein OIDMADRAFT_17409                   169   2e-50   
gb|KHJ35671.1|  putative 40s ribosomal protein s23                      169   2e-50   
emb|CDS08133.1|  Putative 40S ribosomal protein S23                     170   2e-50   
emb|CAX79146.1|  Ribosomal Protein, Small subunit                       169   2e-50   
emb|CDW59706.1|  Ribosom S12 S23 domain containing protein              169   2e-50   
gb|EJT45571.1|  40s ribosomal protein s23                               169   2e-50   
ref|XP_008076367.1|  Nucleic acid-binding protein                       169   2e-50   
gb|KEQ59019.1|  ribosomal protein S12/S23                               169   2e-50   
gb|KFY70068.1|  hypothetical protein V499_09497                         172   2e-50   
gb|KFX92975.1|  hypothetical protein V490_05059                         172   2e-50   
emb|CCG85008.1|  protein of unknown function                            169   2e-50   
ref|XP_003787882.1|  PREDICTED: 40S ribosomal protein S23-like          170   2e-50   
gb|KFY16641.1|  hypothetical protein V492_01189                         172   2e-50   
dbj|GAK63147.1|  ribosomal protein S12/S23                              172   2e-50   
ref|XP_007924297.1|  hypothetical protein MYCFIDRAFT_53803              169   2e-50   
emb|CCF73477.1|  unnamed protein product                                169   2e-50   
emb|CBK19643.2|  unnamed protein product                                169   2e-50   
ref|XP_001795358.1|  hypothetical protein SNOG_04945                    169   2e-50   
gb|ETS61679.1|  hypothetical protein PaG_04178                          174   2e-50   
dbj|GAA97668.1|  hypothetical protein E5Q_04346                         169   2e-50   
ref|XP_007778109.1|  40S ribosomal protein S23                          169   2e-50   
ref|XP_011108789.1|  hypothetical protein H072_2802                     169   3e-50   
gb|EIF49333.1|  40s ribosomal protein s23                               169   3e-50   
ref|XP_007689758.1|  hypothetical protein COCMIDRAFT_27834              169   3e-50   
ref|XP_009172004.1|  hypothetical protein T265_08046                    169   3e-50   
ref|XP_004987729.1|  ribosomal protein S23e                             169   3e-50   
ref|XP_007799759.1|  40S ribosomal protein S23                          169   3e-50   
gb|KFY62117.1|  hypothetical protein V497_02570                         169   3e-50   
gb|KFX98897.1|  hypothetical protein O988_04151                         171   3e-50   
ref|XP_001105094.2|  PREDICTED: 40S ribosomal protein S23-like          172   3e-50   
gb|KFY38003.1|  hypothetical protein V494_04555                         169   3e-50   
gb|EJU04232.1|  ribosomal protein S12/S23                               169   4e-50   
gb|KIJ67817.1|  hypothetical protein HYDPIDRAFT_185821                  169   4e-50   
ref|XP_001713276.1|  40S ribosomal protein S23                          169   4e-50   
ref|XP_009390409.1|  PREDICTED: 40S ribosomal protein S23-like          169   5e-50   
ref|XP_007675789.1|  hypothetical protein BAUCODRAFT_147470             169   5e-50   
ref|XP_004832645.1|  40S ribosomal protein S23, putative                168   6e-50   
ref|XP_010576392.1|  PREDICTED: 40S ribosomal protein S23               176   6e-50   
emb|CDY70106.1|  BnaAnng32630D                                          168   6e-50   
gb|ADK47155.1|  ribosomal protein S23a                                  167   6e-50   
ref|XP_005065732.1|  PREDICTED: 40S ribosomal protein S23               168   6e-50   
ref|XP_002341358.1|  40S ribosomal protein S23                          168   7e-50   
ref|XP_002585086.1|  40S ribosomal protein S23                          168   7e-50   
gb|KGG51731.1|  40S ribosomal protein S23                               168   7e-50   
ref|XP_002144194.1|  40S ribosomal protein S23                          168   7e-50   



>sp|Q9M5Z9.1|RS23_EUPES RecName: Full=40S ribosomal protein S23 [Euphorbia esula]
 gb|AAF26742.1|AF220539_1 40s ribosomal protein S23 [Euphorbia esula]
Length=142

 Score =   192 bits (487),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>gb|KHN48325.1| 40S ribosomal protein S23 [Glycine soja]
Length=142

 Score =   192 bits (487),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>gb|AFK43476.1| unknown [Lotus japonicus]
Length=142

 Score =   192 bits (487),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_008795918.1| PREDICTED: 40S ribosomal protein S23-like [Phoenix dactylifera]
Length=142

 Score =   191 bits (486),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_008369476.1| PREDICTED: 40S ribosomal protein S23 [Malus domestica]
 ref|XP_008358229.1| PREDICTED: 40S ribosomal protein S23 [Malus domestica]
 ref|XP_008376296.1| PREDICTED: 40S ribosomal protein S23 [Malus domestica]
 ref|XP_008385263.1| PREDICTED: 40S ribosomal protein S23 [Malus domestica]
 ref|XP_008343511.1| PREDICTED: 40S ribosomal protein S23 [Malus domestica]
 ref|XP_009358254.1| PREDICTED: 40S ribosomal protein S23 [Pyrus x bretschneideri]
 ref|XP_009378127.1| PREDICTED: 40S ribosomal protein S23 [Pyrus x bretschneideri]
 ref|XP_009333743.1| PREDICTED: 40S ribosomal protein S23 [Pyrus x bretschneideri]
 ref|XP_009346578.1| PREDICTED: 40S ribosomal protein S23 [Pyrus x bretschneideri]
Length=142

 Score =   191 bits (486),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_003537257.1| PREDICTED: 40S ribosomal protein S23-like isoform 1 [Glycine 
max]
 gb|AFK48203.1| unknown [Medicago truncatula]
 gb|KEH42281.1| 40S ribosomal protein S23-1 [Medicago truncatula]
 gb|KHN02366.1| 40S ribosomal protein S23 [Glycine soja]
 gb|KHN39108.1| 40S ribosomal protein S23 [Glycine soja]
Length=142

 Score =   191 bits (486),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_004497466.1| PREDICTED: 40S ribosomal protein S23-like [Cicer arietinum]
 ref|XP_004505950.1| PREDICTED: 40S ribosomal protein S23-like [Cicer arietinum]
 ref|XP_007162723.1| hypothetical protein PHAVU_001G174900g [Phaseolus vulgaris]
 ref|XP_007162724.1| hypothetical protein PHAVU_001G175000g [Phaseolus vulgaris]
 gb|AFK48775.1| unknown [Lotus japonicus]
 gb|AGW07470.1| 40S ribosomal protein S23 [Arachis hypogaea]
 gb|ESW34717.1| hypothetical protein PHAVU_001G174900g [Phaseolus vulgaris]
 gb|ESW34718.1| hypothetical protein PHAVU_001G175000g [Phaseolus vulgaris]
Length=142

 Score =   191 bits (486),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>gb|ADH84008.1| putative ribosomal S23 protein [Wolffia arrhiza]
Length=142

 Score =   191 bits (486),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_008782475.1| PREDICTED: 40S ribosomal protein S23 [Phoenix dactylifera]
 ref|XP_010940063.1| PREDICTED: 40S ribosomal protein S23 [Elaeis guineensis]
Length=142

 Score =   191 bits (486),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_002523902.1| 40S ribosomal protein S23, putative [Ricinus communis]
 ref|XP_002525181.1| 40S ribosomal protein S23, putative [Ricinus communis]
 gb|EEF37147.1| 40S ribosomal protein S23, putative [Ricinus communis]
 gb|EEF38471.1| 40S ribosomal protein S23, putative [Ricinus communis]
 gb|KDP29075.1| hypothetical protein JCGZ_16464 [Jatropha curcas]
Length=142

 Score =   191 bits (486),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_006428872.1| hypothetical protein CICLE_v10013057mg [Citrus clementina]
 ref|XP_006480674.1| PREDICTED: 40S ribosomal protein S23-like [Citrus sinensis]
 gb|ESR42112.1| hypothetical protein CICLE_v10013057mg [Citrus clementina]
 gb|KDO55275.1| hypothetical protein CISIN_1g032383mg [Citrus sinensis]
Length=142

 Score =   191 bits (486),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_008354088.1| PREDICTED: 40S ribosomal protein S23 [Malus domestica]
Length=136

 Score =   191 bits (486),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  136



>gb|KEH42280.1| 40S ribosomal protein S23-1 [Medicago truncatula]
 gb|KHN09474.1| 40S ribosomal protein S23 [Glycine soja]
Length=136

 Score =   191 bits (485),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  136



>ref|XP_008783675.1| PREDICTED: 40S ribosomal protein S23 [Phoenix dactylifera]
Length=142

 Score =   191 bits (486),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_006843238.1| hypothetical protein AMTR_s00080p00080700 [Amborella trichopoda]
 gb|ERN04913.1| hypothetical protein AMTR_s00080p00080700 [Amborella trichopoda]
Length=159

 Score =   192 bits (487),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  64   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  123

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  124  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  159



>ref|XP_009130734.1| PREDICTED: 40S ribosomal protein S23-2-like [Brassica rapa]
Length=142

 Score =   191 bits (486),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_006845010.1| hypothetical protein AMTR_s00058p00204160 [Amborella trichopoda]
 gb|ERN06685.1| hypothetical protein AMTR_s00058p00204160 [Amborella trichopoda]
Length=136

 Score =   191 bits (485),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  136



>ref|XP_007206114.1| hypothetical protein PRUPE_ppa013051mg [Prunus persica]
 ref|XP_008224825.1| PREDICTED: 40S ribosomal protein S23 [Prunus mume]
 ref|XP_008233374.1| PREDICTED: 40S ribosomal protein S23 [Prunus mume]
 gb|EMJ07313.1| hypothetical protein PRUPE_ppa013051mg [Prunus persica]
Length=142

 Score =   191 bits (486),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>gb|EPS59569.1| hypothetical protein M569_15236, partial [Genlisea aurea]
 gb|EPS64798.1| hypothetical protein M569_09980, partial [Genlisea aurea]
 gb|EPS70952.1| hypothetical protein M569_03808, partial [Genlisea aurea]
Length=140

 Score =   191 bits (485),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  45   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  104

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  105  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  140



>ref|XP_004493945.1| PREDICTED: 40S ribosomal protein S23-like [Cicer arietinum]
 ref|XP_004493947.1| PREDICTED: 40S ribosomal protein S23-like [Cicer arietinum]
Length=142

 Score =   191 bits (486),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_004294678.1| PREDICTED: 40S ribosomal protein S23 [Fragaria vesca subsp. vesca]
 ref|XP_004299884.1| PREDICTED: 40S ribosomal protein S23 [Fragaria vesca subsp. vesca]
 sp|P46297.1|RS23_FRAAN RecName: Full=40S ribosomal protein S23; AltName: Full=S12 [Fragaria 
x ananassa]
 gb|AAA79921.1| putative 40S ribosomal protein s12 [Fragaria x ananassa]
Length=142

 Score =   191 bits (486),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|NP_001274976.1| uncharacterized protein LOC102577739 [Solanum tuberosum]
 ref|XP_004246693.1| PREDICTED: 40S ribosomal protein S23 [Solanum lycopersicum]
 ref|XP_004249503.1| PREDICTED: 40S ribosomal protein S23 [Solanum lycopersicum]
 ref|XP_004249676.1| PREDICTED: 40S ribosomal protein S23 [Solanum lycopersicum]
 ref|XP_006339059.1| PREDICTED: 40S ribosomal protein S23-like [Solanum tuberosum]
 ref|XP_006361778.1| PREDICTED: 40S ribosomal protein S23-like [Solanum tuberosum]
 ref|XP_006363678.1| PREDICTED: 40S ribosomal protein S23-like [Solanum tuberosum]
 ref|XP_006424658.1| hypothetical protein CICLE_v10029532mg [Citrus clementina]
 ref|XP_006488186.1| PREDICTED: 40S ribosomal protein S23-like [Citrus sinensis]
 ref|XP_009609409.1| PREDICTED: 40S ribosomal protein S23 [Nicotiana tomentosiformis]
 ref|XP_009622195.1| PREDICTED: 40S ribosomal protein S23 [Nicotiana tomentosiformis]
 ref|XP_009608287.1| PREDICTED: 40S ribosomal protein S23 [Nicotiana tomentosiformis]
 ref|XP_009590383.1| PREDICTED: 40S ribosomal protein S23 [Nicotiana tomentosiformis]
 ref|XP_009782068.1| PREDICTED: 40S ribosomal protein S23 [Nicotiana sylvestris]
 ref|XP_009797647.1| PREDICTED: 40S ribosomal protein S23 [Nicotiana sylvestris]
 ref|XP_009764738.1| PREDICTED: 40S ribosomal protein S23 [Nicotiana sylvestris]
 ref|XP_009772658.1| PREDICTED: 40S ribosomal protein S23 [Nicotiana sylvestris]
 ref|XP_010037913.1| PREDICTED: 40S ribosomal protein S23 [Eucalyptus grandis]
 ref|XP_010037934.1| PREDICTED: 40S ribosomal protein S23 [Eucalyptus grandis]
 gb|ABB16993.1| unknown [Solanum tuberosum]
 gb|ESR37898.1| hypothetical protein CICLE_v10029532mg [Citrus clementina]
 gb|EYU29808.1| hypothetical protein MIMGU_mgv1a015865mg [Erythranthe guttata]
 gb|EYU38513.1| hypothetical protein MIMGU_mgv1a015878mg [Erythranthe guttata]
 gb|EYU41645.1| hypothetical protein MIMGU_mgv1a015866mg [Erythranthe guttata]
 gb|KCW49694.1| hypothetical protein EUGRSUZ_K03200 [Eucalyptus grandis]
 gb|KCW49710.1| hypothetical protein EUGRSUZ_K03211 [Eucalyptus grandis]
Length=142

 Score =   191 bits (486),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_010553016.1| PREDICTED: 40S ribosomal protein S23 isoform X2 [Tarenaya hassleriana]
Length=136

 Score =   191 bits (485),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  136



>emb|CBI31516.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  103  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  162

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  163  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  198



>ref|XP_006424659.1| hypothetical protein CICLE_v10029532mg [Citrus clementina]
 gb|ESR37899.1| hypothetical protein CICLE_v10029532mg [Citrus clementina]
 gb|KDO73126.1| hypothetical protein CISIN_1g032641mg [Citrus sinensis]
Length=136

 Score =   191 bits (485),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  136



>gb|KJB16838.1| hypothetical protein B456_002G250200 [Gossypium raimondii]
Length=142

 Score =   191 bits (485),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_002284863.1| PREDICTED: 40S ribosomal protein S23-like [Vitis vinifera]
 ref|XP_002278466.1| PREDICTED: 40S ribosomal protein S23-like [Vitis vinifera]
Length=142

 Score =   191 bits (485),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_002311115.1| putative 40S ribosomal protein s12 [Populus trichocarpa]
 ref|XP_002316341.1| putative 40S ribosomal protein s12 [Populus trichocarpa]
 ref|XP_002323452.1| 40s ribosomal protein S23 [Populus trichocarpa]
 ref|XP_006381492.1| 40s ribosomal protein S23 [Populus trichocarpa]
 ref|XP_011024130.1| PREDICTED: 40S ribosomal protein S23 [Populus euphratica]
 ref|XP_011027009.1| PREDICTED: 40S ribosomal protein S23 [Populus euphratica]
 ref|XP_011004170.1| PREDICTED: 40S ribosomal protein S23 [Populus euphratica]
 ref|XP_011006940.1| PREDICTED: 40S ribosomal protein S23 [Populus euphratica]
 gb|ABK93759.1| unknown [Populus trichocarpa]
 gb|ABK93919.1| unknown [Populus trichocarpa]
 gb|ABK95615.1| unknown [Populus trichocarpa]
 gb|EEE88482.1| putative 40S ribosomal protein s12 [Populus trichocarpa]
 gb|EEF02512.1| putative 40S ribosomal protein s12 [Populus trichocarpa]
 gb|EEF05213.1| 40s ribosomal protein S23 [Populus trichocarpa]
 gb|ERP59289.1| 40s ribosomal protein S23 [Populus trichocarpa]
Length=142

 Score =   191 bits (485),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>gb|KGN58936.1| hypothetical protein Csa_3G736840 [Cucumis sativus]
Length=136

 Score =   191 bits (485),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  136



>ref|XP_010534302.1| PREDICTED: 40S ribosomal protein S23 [Tarenaya hassleriana]
 ref|XP_010543372.1| PREDICTED: 40S ribosomal protein S23 [Tarenaya hassleriana]
 ref|XP_010553015.1| PREDICTED: 40S ribosomal protein S23 isoform X1 [Tarenaya hassleriana]
 ref|XP_010558276.1| PREDICTED: 40S ribosomal protein S23 [Tarenaya hassleriana]
 ref|XP_010520131.1| PREDICTED: 40S ribosomal protein S23 [Tarenaya hassleriana]
Length=142

 Score =   191 bits (485),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_002279025.1| PREDICTED: 40S ribosomal protein S23 [Vitis vinifera]
Length=142

 Score =   191 bits (485),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_004137806.1| PREDICTED: 40S ribosomal protein S23-like [Cucumis sativus]
 ref|XP_004143809.1| PREDICTED: 40S ribosomal protein S23-like [Cucumis sativus]
 ref|XP_004149560.1| PREDICTED: 40S ribosomal protein S23-like [Cucumis sativus]
 ref|XP_004156564.1| PREDICTED: 40S ribosomal protein S23-like [Cucumis sativus]
 ref|XP_004163373.1| PREDICTED: 40S ribosomal protein S23-like [Cucumis sativus]
 ref|XP_004167902.1| PREDICTED: 40S ribosomal protein S23-like [Cucumis sativus]
 ref|XP_008442648.1| PREDICTED: 40S ribosomal protein S23 [Cucumis melo]
 ref|XP_008463567.1| PREDICTED: 40S ribosomal protein S23 [Cucumis melo]
 ref|XP_008463898.1| PREDICTED: 40S ribosomal protein S23 [Cucumis melo]
 ref|XP_010253521.1| PREDICTED: 40S ribosomal protein S23 [Nelumbo nucifera]
 ref|XP_010244979.1| PREDICTED: 40S ribosomal protein S23 [Nelumbo nucifera]
 ref|XP_011077380.1| PREDICTED: 40S ribosomal protein S23 [Sesamum indicum]
 ref|XP_011094704.1| PREDICTED: 40S ribosomal protein S23 [Sesamum indicum]
 ref|XP_011094750.1| PREDICTED: 40S ribosomal protein S23 [Sesamum indicum]
 gb|KGN47293.1| hypothetical protein Csa_6G289760 [Cucumis sativus]
 gb|KGN51234.1| hypothetical protein Csa_5G496500 [Cucumis sativus]
Length=142

 Score =   191 bits (485),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>emb|CAN75084.1| hypothetical protein VITISV_024242 [Vitis vinifera]
Length=143

 Score =   191 bits (485),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  48   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  108  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  143



>gb|KJB36648.1| hypothetical protein B456_006G168700 [Gossypium raimondii]
Length=178

 Score =   192 bits (488),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  83   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  142

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  143  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  178



>ref|XP_007009733.1| Ribosomal protein S12/S23 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007027252.1| Ribosomal protein S12/S23 family protein [Theobroma cacao]
 gb|EOY07754.1| Ribosomal protein S12/S23 family protein [Theobroma cacao]
 gb|EOY18543.1| Ribosomal protein S12/S23 family protein isoform 1 [Theobroma 
cacao]
 gb|KHG05557.1| 40S ribosomal S23 [Gossypium arboreum]
 gb|KJB11229.1| hypothetical protein B456_001G248300 [Gossypium raimondii]
 gb|KJB60609.1| hypothetical protein B456_009G315000 [Gossypium raimondii]
Length=142

 Score =   191 bits (485),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>gb|KHG05778.1| 40S ribosomal S23 [Gossypium arboreum]
 gb|KHG07190.1| 40S ribosomal S23 [Gossypium arboreum]
 gb|KHG16236.1| 40S ribosomal S23 [Gossypium arboreum]
 gb|KJB16837.1| hypothetical protein B456_002G250200 [Gossypium raimondii]
Length=142

 Score =   191 bits (485),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_003625582.1| 40S ribosomal protein S23 [Medicago truncatula]
 gb|ACJ84161.1| unknown [Medicago truncatula]
 gb|AES81800.1| 40S ribosomal protein S23-1 [Medicago truncatula]
 gb|AFK47563.1| unknown [Medicago truncatula]
Length=142

 Score =   191 bits (485),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_007218498.1| hypothetical protein PRUPE_ppa012246mg [Prunus persica]
 gb|EMJ19697.1| hypothetical protein PRUPE_ppa012246mg [Prunus persica]
Length=178

 Score =   192 bits (488),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  83   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  142

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  143  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  178



>emb|CDY10413.1| BnaCnng03140D [Brassica napus]
Length=182

 Score =   192 bits (488),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  87   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  146

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  147  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  182



>ref|XP_001763475.1| predicted protein [Physcomitrella patens]
 ref|XP_001771250.1| predicted protein [Physcomitrella patens]
 ref|XP_001779772.1| predicted protein [Physcomitrella patens]
 ref|XP_001780799.1| predicted protein [Physcomitrella patens]
 ref|XP_001783629.1| predicted protein [Physcomitrella patens]
 gb|EDQ51524.1| predicted protein [Physcomitrella patens]
 gb|EDQ54356.1| predicted protein [Physcomitrella patens]
 gb|EDQ55456.1| predicted protein [Physcomitrella patens]
 gb|EDQ63961.1| predicted protein [Physcomitrella patens]
 gb|EDQ71664.1| predicted protein [Physcomitrella patens]
Length=142

 Score =   191 bits (485),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>gb|KJB11230.1| hypothetical protein B456_001G248300 [Gossypium raimondii]
Length=136

 Score =   191 bits (484),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  136



>ref|XP_009123272.1| PREDICTED: 40S ribosomal protein S23-2 [Brassica rapa]
 ref|XP_009125470.1| PREDICTED: 40S ribosomal protein S23-2 [Brassica rapa]
 ref|XP_009135045.1| PREDICTED: 40S ribosomal protein S23-2 [Brassica rapa]
 ref|XP_009122743.1| PREDICTED: 40S ribosomal protein S23-2 [Brassica rapa]
 ref|XP_010423791.1| PREDICTED: 40S ribosomal protein S23-2 [Camelina sativa]
 ref|XP_010452161.1| PREDICTED: 40S ribosomal protein S23-2 [Camelina sativa]
 ref|XP_010490765.1| PREDICTED: 40S ribosomal protein S23-2 [Camelina sativa]
Length=142

 Score =   191 bits (485),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|NP_001235601.1| uncharacterized protein LOC100500013 [Glycine max]
 gb|ACU14595.1| unknown [Glycine max]
Length=142

 Score =   191 bits (485),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLI+NGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIRNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>gb|ACG32843.1| 40S ribosomal protein S23 [Zea mays]
Length=142

 Score =   191 bits (484),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQL+KNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>gb|ABR16208.1| unknown [Picea sitchensis]
 gb|ABR16445.1| unknown [Picea sitchensis]
 gb|ABR17464.1| unknown [Picea sitchensis]
 gb|ACN40136.1| unknown [Picea sitchensis]
Length=142

 Score =   191 bits (484),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_010104143.1| 40S ribosomal protein S23 [Morus notabilis]
 gb|EXB98584.1| 40S ribosomal protein S23 [Morus notabilis]
Length=259

 Score =   194 bits (494),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  164  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  223

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  224  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  259



>ref|XP_006288875.1| hypothetical protein CARUB_v10002234mg [Capsella rubella]
 gb|EOA21773.1| hypothetical protein CARUB_v10002234mg [Capsella rubella]
 emb|CDY55693.1| BnaC02g03430D [Brassica napus]
 emb|CDY11236.1| BnaA03g00720D [Brassica napus]
 emb|CDY07936.1| BnaC03g35870D [Brassica napus]
 emb|CDY04874.1| BnaAnng00560D [Brassica napus]
 emb|CDX80847.1| BnaC03g01010D [Brassica napus]
 emb|CDX73991.1| BnaA03g30560D [Brassica napus]
 emb|CDX70336.1| BnaA10g26850D [Brassica napus]
Length=136

 Score =   191 bits (484),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  136



>ref|XP_008644390.1| PREDICTED: 40S ribosomal protein S23-like [Zea mays]
Length=192

 Score =   192 bits (489),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQL+KNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  97   KGIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  156

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  157  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  192



>ref|NP_566351.1| 40S ribosomal protein S23-1 [Arabidopsis thaliana]
 sp|Q9SF35.2|RS231_ARATH RecName: Full=40S ribosomal protein S23-1; AltName: Full=S12 
[Arabidopsis thaliana]
 gb|AAM61055.1| putative 40S ribosomal protein S23 [Arabidopsis thaliana]
 gb|ABF58920.1| At3g09680 [Arabidopsis thaliana]
 gb|AEE74797.1| 40S ribosomal protein S23-1 [Arabidopsis thaliana]
Length=142

 Score =   191 bits (484),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|NP_195916.1| 40S ribosomal protein S23-2 [Arabidopsis thaliana]
 ref|XP_002873070.1| 40S ribosomal protein S23 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006398751.1| hypothetical protein EUTSA_v10014965mg [Eutrema salsugineum]
 ref|XP_006407650.1| hypothetical protein EUTSA_v10021720mg [Eutrema salsugineum]
 sp|P49201.2|RS232_ARATH RecName: Full=40S ribosomal protein S23-2; AltName: Full=S12 
[Arabidopsis thaliana]
 emb|CAB86050.1| putative protein [Arabidopsis thaliana]
 gb|AAK64160.1| unknown protein [Arabidopsis thaliana]
 gb|AAK96523.1| AT5g02960/F9G14_270 [Arabidopsis thaliana]
 gb|AAM44979.1| unknown protein [Arabidopsis thaliana]
 gb|EFH49329.1| 40S ribosomal protein S23 [Arabidopsis lyrata subsp. lyrata]
 gb|AED90540.1| 40S ribosomal protein S23-2 [Arabidopsis thaliana]
 gb|ESQ40204.1| hypothetical protein EUTSA_v10014965mg [Eutrema salsugineum]
 gb|ESQ49103.1| hypothetical protein EUTSA_v10021720mg [Eutrema salsugineum]
 gb|KFK38358.1| hypothetical protein AALP_AA3G103600 [Arabis alpina]
Length=142

 Score =   191 bits (484),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>gb|AAF23298.1|AC016661_23 putative 40S ribosomal protein S23 [Arabidopsis thaliana]
Length=136

 Score =   190 bits (483),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  136



>ref|NP_001131287.1| 40S ribosomal protein S23 [Zea mays]
 ref|NP_001281249.1| 40S ribosomal protein S23 [Zea mays]
 ref|XP_002463634.1| hypothetical protein SORBIDRAFT_01g003410 [Sorghum bicolor]
 ref|XP_002458722.1| hypothetical protein SORBIDRAFT_03g039010 [Sorghum bicolor]
 ref|XP_002441233.1| hypothetical protein SORBIDRAFT_09g022840 [Sorghum bicolor]
 ref|XP_004961806.1| PREDICTED: 40S ribosomal protein S23-like [Setaria italica]
 ref|XP_004970484.1| PREDICTED: 40S ribosomal protein S23-like [Setaria italica]
 ref|XP_004981270.1| PREDICTED: 40S ribosomal protein S23-like [Setaria italica]
 ref|XP_008665673.1| PREDICTED: 40S ribosomal protein S23 [Zea mays]
 ref|XP_008649720.1| PREDICTED: 40S ribosomal protein S23 [Zea mays]
 gb|ACF79628.1| unknown [Zea mays]
 gb|ACF82890.1| unknown [Zea mays]
 gb|ACF85454.1| unknown [Zea mays]
 gb|ACG24871.1| 40S ribosomal protein S23 [Zea mays]
 gb|ACG31194.1| 40S ribosomal protein S23 [Zea mays]
 gb|ACG31648.1| 40S ribosomal protein S23 [Zea mays]
 gb|ACG34489.1| 40S ribosomal protein S23 [Zea mays]
 gb|ACG36181.1| 40S ribosomal protein S23 [Zea mays]
 gb|ACG48307.1| 40S ribosomal protein S23 [Zea mays]
 gb|ACR37180.1| unknown [Zea mays]
 gb|EER90632.1| hypothetical protein SORBIDRAFT_01g003410 [Sorghum bicolor]
 gb|EES03842.1| hypothetical protein SORBIDRAFT_03g039010 [Sorghum bicolor]
 gb|EES19663.1| hypothetical protein SORBIDRAFT_09g022840 [Sorghum bicolor]
 gb|AFW67173.1| 40S ribosomal protein S23 [Zea mays]
 gb|AFW78298.1| 40S ribosomal protein S23 [Zea mays]
 gb|AFW82263.1| 40S ribosomal protein S23 [Zea mays]
 tpg|DAA52180.1| TPA: hypothetical protein ZEAMMB73_525462 [Zea mays]
 tpg|DAA56965.1| TPA: 40S ribosomal protein S23 [Zea mays]
Length=142

 Score =   191 bits (484),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQL+KNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_002968022.1| hypothetical protein SELMODRAFT_145246 [Selaginella moellendorffii]
 ref|XP_002992424.1| hypothetical protein SELMODRAFT_162320 [Selaginella moellendorffii]
 gb|EFJ06574.1| hypothetical protein SELMODRAFT_162320 [Selaginella moellendorffii]
 gb|EFJ31369.1| hypothetical protein SELMODRAFT_145246 [Selaginella moellendorffii]
Length=142

 Score =   191 bits (484),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_006299411.1| hypothetical protein CARUB_v10015571mg, partial [Capsella rubella]
 gb|EOA32309.1| hypothetical protein CARUB_v10015571mg, partial [Capsella rubella]
Length=161

 Score =   191 bits (485),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  66   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  125

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  126  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  161



>gb|ACF83276.1| unknown [Zea mays]
 gb|ACL53616.1| unknown [Zea mays]
 tpg|DAA56966.1| TPA: 40S ribosomal protein S23 [Zea mays]
Length=136

 Score =   190 bits (483),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQL+KNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  136



>ref|XP_003623100.1| 40S ribosomal protein S23, partial [Medicago truncatula]
Length=117

 Score =   189 bits (481),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  22   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  81

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  82   KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  117



>ref|XP_010107592.1| 40S ribosomal protein S23 [Morus notabilis]
 gb|EXC16274.1| 40S ribosomal protein S23 [Morus notabilis]
Length=179

 Score =   191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  84   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  143

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  144  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  179



>gb|KEH22874.1| 40S ribosomal protein S23-1 [Medicago truncatula]
Length=255

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  160  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  219

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  220  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  255



>ref|XP_010669684.1| PREDICTED: 40S ribosomal protein S23 [Beta vulgaris subsp. vulgaris]
 ref|XP_010667239.1| PREDICTED: 40S ribosomal protein S23 [Beta vulgaris subsp. vulgaris]
Length=142

 Score =   190 bits (483),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+GVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVAGVSLLALFKEKKEKPRS  142



>ref|XP_002884746.1| 40S ribosomal protein S23 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61005.1| 40S ribosomal protein S23 [Arabidopsis lyrata subsp. lyrata]
Length=142

 Score =   190 bits (482),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>emb|CBI32689.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  94   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  153

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  154  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  189



>emb|CDP06706.1| unnamed protein product [Coffea canephora]
Length=183

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  88   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  147

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  148  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  183



>emb|CBI16256.3| unnamed protein product [Vitis vinifera]
Length=175

 Score =   191 bits (485),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  80   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  139

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  140  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175



>ref|XP_007144531.1| hypothetical protein PHAVU_007G163700g [Phaseolus vulgaris]
 gb|ESW16525.1| hypothetical protein PHAVU_007G163700g [Phaseolus vulgaris]
Length=189

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  94   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  153

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  154  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  189



>gb|ACG36826.1| 40S ribosomal protein S23 [Zea mays]
Length=158

 Score =   190 bits (483),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQL+KNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  63   KGIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  122

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  123  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  158



>ref|XP_010924264.1| PREDICTED: 40S ribosomal protein S23-like [Elaeis guineensis]
 ref|XP_010936716.1| PREDICTED: 40S ribosomal protein S23-like [Elaeis guineensis]
Length=142

 Score =   189 bits (481),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_008800730.1| PREDICTED: 40S ribosomal protein S23-like [Phoenix dactylifera]
Length=142

 Score =   189 bits (481),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|NP_001242498.1| uncharacterized protein LOC100776345 [Glycine max]
 gb|ACU19839.1| unknown [Glycine max]
Length=142

 Score =   189 bits (481),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIA FVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAVFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|NP_001236975.1| uncharacterized protein LOC100306064 [Glycine max]
 gb|ACU14057.1| unknown [Glycine max]
Length=142

 Score =   189 bits (481),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            K HAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KSHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_009390177.1| PREDICTED: 40S ribosomal protein S23 [Musa acuminata subsp. malaccensis]
 ref|XP_009390963.1| PREDICTED: 40S ribosomal protein S23 [Musa acuminata subsp. malaccensis]
 ref|XP_009390968.1| PREDICTED: 40S ribosomal protein S23 isoform X3 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009400839.1| PREDICTED: 40S ribosomal protein S23 [Musa acuminata subsp. malaccensis]
 ref|XP_009380354.1| PREDICTED: 40S ribosomal protein S23 [Musa acuminata subsp. malaccensis]
Length=142

 Score =   189 bits (481),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_010251237.1| PREDICTED: 40S ribosomal protein S23-like [Nelumbo nucifera]
Length=142

 Score =   189 bits (481),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>gb|KDP46156.1| hypothetical protein JCGZ_06667 [Jatropha curcas]
Length=136

 Score =   189 bits (479),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  136



>emb|CDP08934.1| unnamed protein product [Coffea canephora]
Length=202

 Score =   191 bits (485),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  107  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  166

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSL+ALFKEKKEKPRS
Sbjct  167  KGHAVGDIPGVRFKVVKVSGVSLIALFKEKKEKPRS  202



>ref|NP_001044720.1| Os01g0834500 [Oryza sativa Japonica Group]
 ref|NP_001051708.1| Os03g0818400 [Oryza sativa Japonica Group]
 ref|NP_001172637.1| Os01g0834601 [Oryza sativa Japonica Group]
 ref|XP_003564554.1| PREDICTED: 40S ribosomal protein S23 [Brachypodium distachyon]
 ref|XP_003568277.1| PREDICTED: 40S ribosomal protein S23 [Brachypodium distachyon]
 ref|XP_006644968.1| PREDICTED: 40S ribosomal protein S23-like [Oryza brachyantha]
 ref|XP_006654522.1| PREDICTED: 40S ribosomal protein S23-like [Oryza brachyantha]
 pdb|3J60|X Chain X, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAB92932.1| putative 40s ribosomal protein S23 [Oryza sativa Japonica Group]
 dbj|BAB92933.1| putative 40s ribosomal protein S23 [Oryza sativa Japonica Group]
 dbj|BAC02683.1| putative 40s ribosomal protein S23 [Oryza sativa Japonica Group]
 dbj|BAC02684.1| putative 40s ribosomal protein S23 [Oryza sativa Japonica Group]
 gb|AAO60034.1| 40S ribosomal protein S23 [Oryza sativa Japonica Group]
 gb|AAO65856.1| 40S ribosomal protein S23 [Oryza sativa Japonica Group]
 gb|ABF99566.1| 40S ribosomal protein S23, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF06634.1| Os01g0834500 [Oryza sativa Japonica Group]
 dbj|BAF13622.1| Os03g0818400 [Oryza sativa Japonica Group]
 gb|EAY76400.1| hypothetical protein OsI_04329 [Oryza sativa Indica Group]
 gb|EAY92355.1| hypothetical protein OsI_14082 [Oryza sativa Indica Group]
 dbj|BAG91414.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95665.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91367.1| Os01g0834601 [Oryza sativa Japonica Group]
 dbj|BAJ98798.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91282.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT02409.1| 40S ribosomal protein S23 [Aegilops tauschii]
 gb|EMT13416.1| 40S ribosomal protein S23 [Aegilops tauschii]
 gb|EMT21069.1| 40S ribosomal protein S23 [Aegilops tauschii]
Length=142

 Score =   189 bits (479),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQL+KNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>gb|EEE60183.1| hypothetical protein OsJ_13124 [Oryza sativa Japonica Group]
 gb|AEH76889.1| 40S ribosomal protein S23 [Aegilops tauschii]
 gb|AEH76892.1| 40S ribosomal protein S23 [Triticum aestivum]
 gb|AEH76896.1| 40S ribosomal protein S23 [Triticum aestivum]
 gb|AEH76899.1| 40S ribosomal protein S23 [Triticum turgidum subsp. durum]
 gb|EMS63838.1| 40S ribosomal protein S23 [Triticum urartu]
Length=136

 Score =   188 bits (478),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQL+KNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  136



>emb|CDM85021.1| unnamed protein product [Triticum aestivum]
Length=163

 Score =   189 bits (480),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQL+KNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  68   KGIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  127

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  128  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  163



>gb|EMS58293.1| 40S ribosomal protein S23 [Triticum urartu]
Length=202

 Score =   191 bits (484),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQL+KNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  107  KGIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  166

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  167  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  202



>ref|XP_010475489.1| PREDICTED: 40S ribosomal protein S23-2-like [Camelina sativa]
Length=142

 Score =   188 bits (478),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSL ALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLNALFKEKKEKPRS  142



>ref|XP_010486539.1| PREDICTED: 40S ribosomal protein S23-2-like [Camelina sativa]
Length=136

 Score =   187 bits (476),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSL ALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLNALFKEKKEKPRS  136



>emb|CDY41304.1| BnaA01g32150D [Brassica napus]
 emb|CDY22194.1| BnaC01g39070D [Brassica napus]
Length=234

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  139  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  198

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  199  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  234



>gb|EMS46402.1| 40S ribosomal protein S23 [Triticum urartu]
Length=172

 Score =   189 bits (479),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQL+KNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR  178
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR  141



>gb|ACJ83931.1| unknown [Medicago truncatula]
Length=142

 Score =   187 bits (476),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP S
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPGS  142



>ref|XP_010464620.1| PREDICTED: 40S ribosomal protein S23-1-like [Camelina sativa]
Length=142

 Score =   187 bits (474),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSL ALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLNALFKEKKEKPRS  142



>gb|KJB36649.1| hypothetical protein B456_006G168700 [Gossypium raimondii]
Length=178

 Score =   187 bits (474),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEEN  VLIAGFGR
Sbjct  83   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENVSVLIAGFGR  142

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  143  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  178



>ref|XP_006391002.1| hypothetical protein EUTSA_v10019491mg [Eutrema salsugineum]
 gb|ESQ28288.1| hypothetical protein EUTSA_v10019491mg [Eutrema salsugineum]
Length=136

 Score =   185 bits (469),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK GIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  41   KGIVLEKTGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNHIEENDEVLVAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSL ALF+EKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLSALFREKKEKPRS  136



>gb|ADJ67168.1| ribosomal protein S23 [Jatropha curcas]
Length=156

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP  181
            KGHAVGDIPGVRFKVVKVSGVSLLALF+EKKEKP
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFQEKKEKP  140



>ref|XP_009797396.1| PREDICTED: 40S ribosomal protein S23-like [Nicotiana sylvestris]
Length=142

 Score =   184 bits (468),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNS IRKCARV+LIKNGKKI AFVPNDGCLNYIEENDEVLIAGFG+
Sbjct  47   KGIVLEKIGIEAKQPNSVIRKCARVKLIKNGKKITAFVPNDGCLNYIEENDEVLIAGFGQ  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  142



>ref|XP_005848558.1| hypothetical protein CHLNCDRAFT_59661 [Chlorella variabilis]
 gb|EFN56456.1| hypothetical protein CHLNCDRAFT_59661 [Chlorella variabilis]
Length=142

 Score =   184 bits (466),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKVSGVSLLALF+ KKEKPR+
Sbjct  107  RGHAVGDIPGVRFKVVKVSGVSLLALFRNKKEKPRN  142



>ref|XP_008620553.1| 40S ribosomal protein S23 [Saprolegnia diclina VS20]
 gb|EQC25985.1| 40S ribosomal protein S23 [Saprolegnia diclina VS20]
 gb|KDO33814.1| 40S ribosomal protein S23 [Saprolegnia parasitica CBS 223.65]
Length=145

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVP DGCLNY++ENDEVLIAGFGR
Sbjct  50   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPRDGCLNYVDENDEVLIAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKV+GVSLLAL+K+KKEKPRS
Sbjct  110  RGHAVGDIPGVRFKVVKVAGVSLLALYKDKKEKPRS  145



>emb|CCA18798.1| Ribosomal protein S23 putative [Albugo laibachii Nc14]
Length=145

 Score =   183 bits (464),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKN KKIAAFVP DGCLNYI+ENDEVLIAGFGR
Sbjct  50   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNSKKIAAFVPRDGCLNYIDENDEVLIAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKV+GVSLLAL+KEKKEKPRS
Sbjct  110  RGHAVGDIPGVRFKVVKVAGVSLLALYKEKKEKPRS  145



>gb|EAZ14059.1| hypothetical protein OsJ_03983 [Oryza sativa Japonica Group]
Length=312

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQL+KNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  217  KGIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  276

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  277  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  312


 Score =   184 bits (467),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQL+KNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP  181
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP
Sbjct  107  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP  140



>ref|XP_001690993.1| ribosomal protein S23, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 ref|XP_002947991.1| hypothetical protein VOLCADRAFT_79846 [Volvox carteri f. nagariensis]
 gb|EDP05439.1| ribosomal protein S23 [Chlamydomonas reinhardtii]
 gb|EFJ50979.1| hypothetical protein VOLCADRAFT_79846 [Volvox carteri f. nagariensis]
Length=142

 Score =   182 bits (462),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVP DGCLN+IEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPMDGCLNFIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKVSGVSLLALFK KKEKPRS
Sbjct  107  RGHAVGDIPGVRFKVVKVSGVSLLALFKGKKEKPRS  142



>gb|KIY98576.1| 40S ribosomal protein S23 [Monoraphidium neglectum]
Length=136

 Score =   182 bits (461),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVP DGCLN+IEENDEVLIAGFGR
Sbjct  41   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPMDGCLNFIEENDEVLIAGFGR  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKV+GVSLLALFK KKEKPRS
Sbjct  101  RGHAVGDIPGVRFKVVKVAGVSLLALFKSKKEKPRS  136



>ref|XP_009390966.1| PREDICTED: uncharacterized protein LOC103977233 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=398

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  303  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  362

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  363  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  398



>ref|XP_005651536.1| ribosomal protein S23 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE26992.1| ribosomal protein S23 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=142

 Score =   181 bits (460),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKV+GVSLLALF+ KKEKPR+
Sbjct  107  RGHAVGDIPGVRFKVVKVAGVSLLALFRGKKEKPRN  142



>ref|XP_010911313.1| PREDICTED: 40S ribosomal protein S23-like [Elaeis guineensis]
Length=136

 Score =   181 bits (458),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGI+LEKI IEAK  NSAIRKCARVQLIKNGKKIAAFVPNDGCLN+IEENDEVLIAGFG 
Sbjct  41   KGIILEKISIEAKHSNSAIRKCARVQLIKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGH  100

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  101  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  136



>ref|XP_009824591.1| 40S ribosomal protein S23 [Aphanomyces astaci]
 gb|ETV86119.1| 40S ribosomal protein S23 [Aphanomyces astaci]
Length=145

 Score =   181 bits (458),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRK  RVQLIKNGKKIAAFVP DGCLNY++ENDEVLIAGFGR
Sbjct  50   KGIVLEKIGIEAKQPNSAIRKSVRVQLIKNGKKIAAFVPRDGCLNYVDENDEVLIAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKVSGVSLLAL+KEKKEKPRS
Sbjct  110  RGHAVGDIPGVRFKVVKVSGVSLLALYKEKKEKPRS  145



>ref|XP_003740234.1| PREDICTED: 40S ribosomal protein S23-like [Metaseiulus occidentalis]
Length=143

 Score =   181 bits (458),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>ref|XP_011399420.1| 40S ribosomal protein S23-2 [Auxenochlorella protothecoides]
 gb|KFM22437.1| 40S ribosomal protein S23-2 [Auxenochlorella protothecoides]
Length=164

 Score =   181 bits (459),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLN+IEENDEVLIAGFGR
Sbjct  69   KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGR  128

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKV+GVSLLALF+ KKEKPR+
Sbjct  129  RGHAVGDIPGVRFKVVKVAGVSLLALFRGKKEKPRN  164



>ref|XP_001631263.1| predicted protein [Nematostella vectensis]
 ref|XP_001641794.1| predicted protein [Nematostella vectensis]
 gb|EDO39200.1| predicted protein [Nematostella vectensis]
 gb|EDO49731.1| predicted protein [Nematostella vectensis]
Length=143

 Score =   180 bits (457),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLNYIEENDEVLI+GFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEENDEVLISGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKV+ VSLLALFKEKKE+PRS
Sbjct  108  RGHAVGDIPGVRFKVVKVANVSLLALFKEKKERPRS  143



>ref|XP_008863841.1| 40S ribosomal protein S23 [Aphanomyces invadans]
 gb|ETW07748.1| 40S ribosomal protein S23 [Aphanomyces invadans]
Length=145

 Score =   180 bits (457),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRK  RVQLIKNGKKIAAFVP DGCLNY++ENDEVLIAGFGR
Sbjct  50   KGIVLEKIGIEAKQPNSAIRKSCRVQLIKNGKKIAAFVPRDGCLNYVDENDEVLIAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKVSGVSLLAL+KEKKEKPRS
Sbjct  110  RGHAVGDIPGVRFKVVKVSGVSLLALYKEKKEKPRS  145



>ref|XP_002177540.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC50354.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=143

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKC RVQLIKNGKKIAAFVP DGCLNYI+ENDEVLIAGFGR
Sbjct  48   KGIVLEKIGIEAKQPNSAIRKCVRVQLIKNGKKIAAFVPRDGCLNYIDENDEVLIAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
             GHAVGDIPGVRFKVVKV+GVSL AL+KEKKEKPRS
Sbjct  108  SGHAVGDIPGVRFKVVKVAGVSLWALYKEKKEKPRS  143



>gb|KFH62659.1| 40S ribosomal protein S23 [Mortierella verticillata NRRL 6337]
Length=145

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+++ENDEVLIAGFGR
Sbjct  50   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFVDENDEVLIAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
             GHAVGD+PGVRFKVVKVSGVSLLAL+KEKKEKPRS
Sbjct  110  SGHAVGDLPGVRFKVVKVSGVSLLALWKEKKEKPRS  145



>emb|CDH61389.1| 40s ribosomal protein s23 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDH51051.1| 40s ribosomal protein s23 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDH49070.1| 40s ribosomal protein s23 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDH49175.1| 40s ribosomal protein s23 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS12701.1| Putative 40S ribosomal protein S23 [Absidia idahoensis var. thermophila]
 emb|CDS08002.1| Putative 40S ribosomal protein S23 [Absidia idahoensis var. thermophila]
Length=145

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLNY++ENDEVLIAGFGR
Sbjct  50   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYVDENDEVLIAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG AVGDIPGVRFKVVKV+GVSLLAL+KEKKEKPRS
Sbjct  110  KGRAVGDIPGVRFKVVKVAGVSLLALYKEKKEKPRS  145



>gb|ESA17945.1| hypothetical protein GLOINDRAFT_344852 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX76202.1| ribosomal 40S subunit protein S23B [Rhizophagus irregularis DAOM 
197198w]
Length=145

 Score =   179 bits (455),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLNY++ENDEVL+AGFGR
Sbjct  50   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNYVDENDEVLLAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG A+GDIPGVRFKVVKVSGVSLLAL+KEKKEKPRS
Sbjct  110  KGRAIGDIPGVRFKVVKVSGVSLLALYKEKKEKPRS  145



>ref|XP_002290100.1| RS23, ribosomal protein 23 40S small ribosomal subunit [Thalassiosira 
pseudonana CCMP1335]
 gb|EED91852.1| RS23, ribosomal protein 23 40S small ribosomal subunit [Thalassiosira 
pseudonana CCMP1335]
Length=143

 Score =   179 bits (454),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKC RVQLIKNGKKIAAFVP DGCLNY++ENDEVL+AGFGR
Sbjct  48   KGIVLEKIGIEAKQPNSAIRKCVRVQLIKNGKKIAAFVPRDGCLNYVDENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
             GHAVGDIPGVRFK VKV+GVSLLAL+KEKKEKPRS
Sbjct  108  SGHAVGDIPGVRFKCVKVAGVSLLALYKEKKEKPRS  143



>gb|ACY66586.1| putative ribosomal protein S23e [Scylla paramamosain]
Length=143

 Score =   179 bits (454),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKC RVQLIKNGKKI+AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKIGIEAKQPNSAIRKCVRVQLIKNGKKISAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPG+RFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGIRFKVVKVANVSLLALYKEKKERPRS  143



>ref|XP_009038594.1| hypothetical protein AURANDRAFT_28783 [Aureococcus anophagefferens]
 gb|EGB06849.1| hypothetical protein AURANDRAFT_28783 [Aureococcus anophagefferens]
Length=144

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKC RVQLIKNGKKIAAFVP DGCLNY++ENDEVL+AGFGR
Sbjct  49   KGIVLEKIGIEAKQPNSAIRKCVRVQLIKNGKKIAAFVPRDGCLNYVDENDEVLVAGFGR  108

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFK+ KV+GVSLLAL+KEKKEKPRS
Sbjct  109  RGHAVGDIPGVRFKIAKVAGVSLLALYKEKKEKPRS  144



>emb|CDJ41145.1| Apicoplast 30S ribosomal protein S12 [Eimeria tenella]
Length=145

 Score =   179 bits (453),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIV+EK+GIEAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYI+ENDEVL+AGFGR
Sbjct  50   KGIVVEKLGIEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIDENDEVLVAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
             GHAVGDIPGVRFK+VKVSGVSLLALFKEKKEKPRS
Sbjct  110  SGHAVGDIPGVRFKIVKVSGVSLLALFKEKKEKPRS  145



>emb|CEI98769.1| Putative 40S ribosomal protein S23 [Rhizopus microsporus]
Length=154

 Score =   179 bits (454),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLNY++ENDEVLIAGFGR
Sbjct  59   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNYVDENDEVLIAGFGR  118

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG AVGDIPGVRFK+VKV+GVSLLAL+KEKKEKPRS
Sbjct  119  KGRAVGDIPGVRFKIVKVAGVSLLALYKEKKEKPRS  154



>emb|CEI99360.1| Putative 40S ribosomal protein S23 [Rhizopus microsporus]
Length=154

 Score =   179 bits (454),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLNY++ENDEVLIAGFGR
Sbjct  59   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNYVDENDEVLIAGFGR  118

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG AVGDIPGVRFK+VKV+GVSLLAL+KEKKEKPRS
Sbjct  119  KGRAVGDIPGVRFKIVKVAGVSLLALYKEKKEKPRS  154



>ref|XP_001656190.1| AAEL012686-PA [Aedes aegypti]
 ref|XP_001842887.1| 40S ribosomal protein S23 [Culex quinquefasciatus]
 ref|XP_003435869.1| AGAP012990-PA [Anopheles gambiae str. PEST]
 gb|AAV90712.1| ribosomal protein S23 [Aedes albopictus]
 gb|ABF18102.1| 40S ribosomal protein S23 [Aedes aegypti]
 gb|EAT35120.1| AAEL012686-PA [Aedes aegypti]
 gb|EDS28730.1| 40S ribosomal protein S23 [Culex quinquefasciatus]
 gb|ACF72879.1| ribosomal protein S23 [Ochlerotatus taeniorhynchus]
 gb|EGK97544.1| AGAP012990-PA [Anopheles gambiae str. PEST]
Length=143

 Score =   178 bits (452),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>sp|Q86FP7.1|RS23_DERVA RecName: Full=40S ribosomal protein S23 [Dermacentor variabilis]
 gb|AAP04351.1| 40S ribosomal protein S23 [Dermacentor variabilis]
Length=143

 Score =   178 bits (452),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>gb|ABD98760.1| putative ribosomal protein S23e [Graphocephala atropunctata]
Length=143

 Score =   178 bits (452),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>gb|EPB89248.1| 40S ribosomal protein S23 [Mucor circinelloides f. circinelloides 
1006PhL]
 gb|EPB91133.1| 40S ribosomal protein S23 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=145

 Score =   178 bits (452),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLNY++ENDEVLIAGFGR
Sbjct  50   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNYVDENDEVLIAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG A+GDIPGVRFKVVKV+GVSLLAL+KEKKEKPRS
Sbjct  110  KGRAIGDIPGVRFKVVKVAGVSLLALYKEKKEKPRS  145



>emb|CEG70261.1| Putative 40S ribosomal protein S23 [Rhizopus microsporus]
 emb|CEG67152.1| Putative 40S ribosomal protein S23 [Rhizopus microsporus]
 emb|CEJ02984.1| Putative 40S ribosomal protein S23 [Rhizopus microsporus]
 emb|CEJ01341.1| Putative 40S ribosomal protein S23 [Rhizopus microsporus]
 emb|CEI92271.1| Putative 40S ribosomal protein S23 [Rhizopus microsporus]
Length=145

 Score =   178 bits (452),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLNY++ENDEVLIAGFGR
Sbjct  50   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNYVDENDEVLIAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG AVGDIPGVRFK+VKV+GVSLLAL+KEKKEKPRS
Sbjct  110  KGRAVGDIPGVRFKIVKVAGVSLLALYKEKKEKPRS  145



>gb|AHY30855.1| ribosomal protein S23 [Periplaneta americana]
 gb|KDR18014.1| 40S ribosomal protein S23 [Zootermopsis nevadensis]
Length=143

 Score =   178 bits (452),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>gb|ABW23151.1| ribosomal protein rps23 [Arenicola marina]
Length=143

 Score =   178 bits (452),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>ref|XP_008468562.1| PREDICTED: 40S ribosomal protein S23 [Diaphorina citri]
 ref|XP_008473913.1| PREDICTED: 40S ribosomal protein S23 [Diaphorina citri]
 gb|ABG81976.1| putative ribosomal protein S23e [Diaphorina citri]
Length=143

 Score =   178 bits (452),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>ref|NP_001156067.1| 40S ribosomal protein S23-like [Acyrthosiphon pisum]
 dbj|BAH72869.1| ACYPI000819 [Acyrthosiphon pisum]
Length=143

 Score =   178 bits (452),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>gb|ABY62742.1| ribosomal protein S23e [Artemia franciscana]
Length=143

 Score =   178 bits (452),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>ref|XP_002433088.1| 40S ribosomal protein S23, putative [Pediculus humanus corporis]
 ref|XP_002433090.1| 40S ribosomal protein S23, putative [Pediculus humanus corporis]
 gb|EEB20350.1| 40S ribosomal protein S23, putative [Pediculus humanus corporis]
 gb|EEB20352.1| 40S ribosomal protein S23, putative [Pediculus humanus corporis]
Length=143

 Score =   178 bits (452),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>ref|XP_005759731.1| hypothetical protein EMIHUDRAFT_433073 [Emiliania huxleyi CCMP1516]
 ref|XP_005785624.1| hypothetical protein EMIHUDRAFT_434089 [Emiliania huxleyi CCMP1516]
 gb|EOD07302.1| hypothetical protein EMIHUDRAFT_433073 [Emiliania huxleyi CCMP1516]
 gb|EOD33195.1| hypothetical protein EMIHUDRAFT_434089 [Emiliania huxleyi CCMP1516]
Length=145

 Score =   178 bits (452),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKC R QLIKNGKKIAAFVP DGCLN+I+ENDEVLIAGFGR
Sbjct  50   KGIVLEKIGIEAKQPNSAIRKCVRAQLIKNGKKIAAFVPRDGCLNFIDENDEVLIAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKVSGV+LLAL++EKKEKPRS
Sbjct  110  KGHAVGDIPGVRFKVVKVSGVALLALYREKKEKPRS  145



>gb|ABM55585.1| putative ribosomal protein S23e [Maconellicoccus hirsutus]
Length=143

 Score =   178 bits (451),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>emb|CCQ18581.1| 40S ribosomal protein S23 [Sycon ciliatum]
Length=143

 Score =   178 bits (451),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>gb|ACD65149.1| putative 40S ribosomal protein RPS23 [Phoronis muelleri]
Length=143

 Score =   178 bits (451),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEENDEVLIAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVG IPGVRFKVVKV+ VSLLAL+KEKKE+PR+
Sbjct  108  KGHAVGGIPGVRFKVVKVASVSLLALYKEKKERPRT  143



>emb|CEG68669.1| Putative 40S ribosomal protein S23 [Rhizopus microsporus]
Length=162

 Score =   179 bits (453),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLNY++ENDEVLIAGFGR
Sbjct  67   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNYVDENDEVLIAGFGR  126

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG AVGDIPGVRFK+VKV+GVSLLAL+KEKKEKPRS
Sbjct  127  KGRAVGDIPGVRFKIVKVAGVSLLALYKEKKEKPRS  162



>ref|XP_003540751.1| PREDICTED: 40S ribosomal protein S23-like [Glycine max]
Length=165

 Score =   179 bits (453),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  456  IVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKG  277
            I+   +GIE KQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDE+LIAGFGRKG
Sbjct  72   IIYTFLGIETKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEMLIAGFGRKG  131

Query  276  HAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            HAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  132  HAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  165



>emb|CDJ56296.1| ribosomal protein S23, putative [Eimeria maxima]
Length=137

 Score =   177 bits (450),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIV+EK+GIEAKQPNSAIRKC RVQLIKN KKI AFVP DGCLNYI+ENDEVL+AGFGR
Sbjct  42   KGIVVEKLGIEAKQPNSAIRKCVRVQLIKNAKKITAFVPRDGCLNYIDENDEVLVAGFGR  101

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
             GHAVGDIPGVRFK+VKVSGVSLLALFKEKKEKPRS
Sbjct  102  SGHAVGDIPGVRFKIVKVSGVSLLALFKEKKEKPRS  137



>gb|AGH70206.1| 40S ribosomal protein S23 [Placozoa sp. H4]
Length=143

 Score =   177 bits (450),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFK+VKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKIVKVANVSLLALYKEKKERPRS  143



>ref|XP_002108915.1| 40S ribosomal protein S23 [Trichoplax adhaerens]
 gb|EDV29713.1| 40S ribosomal protein S23 [Trichoplax adhaerens]
Length=143

 Score =   177 bits (450),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFK+VKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKIVKVANVSLLALYKEKKERPRS  143



>gb|EIE78312.1| 40S ribosomal protein S23 [Rhizopus delemar RA 99-880]
 gb|EIE78509.1| 40S ribosomal protein S23 [Rhizopus delemar RA 99-880]
 gb|EIE79613.1| 40S ribosomal protein S23 [Rhizopus delemar RA 99-880]
 gb|EIE85918.1| 40S ribosomal protein S23 [Rhizopus delemar RA 99-880]
Length=145

 Score =   178 bits (451),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLNY++ENDEVLIAGFGR
Sbjct  50   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNYVDENDEVLIAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG A+GDIPGVRFK+VKV+GVSLLAL+KEKKEKPRS
Sbjct  110  KGRAIGDIPGVRFKIVKVAGVSLLALYKEKKEKPRS  145



>ref|XP_008915203.1| 40S ribosomal protein S23 [Phytophthora parasitica INRA-310]
 ref|XP_009533268.1| hypothetical protein PHYSODRAFT_355273 [Phytophthora sojae]
 gb|EGZ10523.1| hypothetical protein PHYSODRAFT_355273 [Phytophthora sojae]
 gb|ETI30946.1| 40S ribosomal protein S23 [Phytophthora parasitica P1569]
 gb|ETK71333.1| 40S ribosomal protein S23 [Phytophthora parasitica]
 gb|ETL24778.1| 40S ribosomal protein S23 [Phytophthora parasitica]
 gb|ETL77999.1| 40S ribosomal protein S23 [Phytophthora parasitica]
 gb|ETM31257.1| 40S ribosomal protein S23 [Phytophthora parasitica]
 gb|ETM99465.1| 40S ribosomal protein S23 [Phytophthora parasitica INRA-310]
 gb|ETO59656.1| 40S ribosomal protein S23 [Phytophthora parasitica P1976]
 gb|ETP00749.1| 40S ribosomal protein S23 [Phytophthora parasitica CJ01A1]
 gb|ETP28908.1| 40S ribosomal protein S23 [Phytophthora parasitica P10297]
Length=145

 Score =   177 bits (450),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRK  RVQLIKN KKIAAFVP DGCLNY++ENDEVLI+GFGR
Sbjct  50   KGIVLEKIGIEAKQPNSAIRKSCRVQLIKNSKKIAAFVPRDGCLNYVDENDEVLISGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKVSGVSLLAL+KEKKEKPRS
Sbjct  110  RGHAVGDIPGVRFKVVKVSGVSLLALYKEKKEKPRS  145



>ref|XP_002606537.1| hypothetical protein BRAFLDRAFT_130085 [Branchiostoma floridae]
 gb|AAN86978.1| ribosomal protein S23 [Branchiostoma belcheri tsingtauense]
 gb|EEN62547.1| hypothetical protein BRAFLDRAFT_130085 [Branchiostoma floridae]
Length=143

 Score =   177 bits (450),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLNYIEENDEVL++GFGR
Sbjct  48   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEENDEVLVSGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG AVGDIPGVRFKVVKV+ VSLLALFKEKKE+PRS
Sbjct  108  KGRAVGDIPGVRFKVVKVANVSLLALFKEKKERPRS  143



>emb|CDJ50577.1| ribosomal protein S23, putative [Eimeria brunetti]
Length=137

 Score =   177 bits (450),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIV+EK+GIEAKQPNSAIRKC RVQLIKN KKI AFVP DGCLNYI+ENDEVL+AGFGR
Sbjct  42   KGIVVEKLGIEAKQPNSAIRKCVRVQLIKNAKKITAFVPRDGCLNYIDENDEVLVAGFGR  101

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
             GHAVGDIPGVRFK+VKVSGVSL+ALFKEKKEKPRS
Sbjct  102  SGHAVGDIPGVRFKIVKVSGVSLMALFKEKKEKPRS  137



>gb|KHN05713.1| 40S ribosomal protein S23 [Glycine soja]
Length=140

 Score =   177 bits (450),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  456  IVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKG  277
            I+   +GIE KQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDE+LIAGFGRKG
Sbjct  47   IIYTFLGIETKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEMLIAGFGRKG  106

Query  276  HAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            HAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  107  HAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  140



>gb|EWM20921.1| 40s ribosomal protein s23 [Nannochloropsis gaditana]
Length=145

 Score =   177 bits (450),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKC RVQLIKNGKKIAAFVP DGCLN+++ENDEVLIAGFGR
Sbjct  50   KGIVLEKIGIEAKQPNSAIRKCVRVQLIKNGKKIAAFVPRDGCLNFVDENDEVLIAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
             GHAVGDIPGVRFKV+KVSGV LLALFK+KKEKPRS
Sbjct  110  SGHAVGDIPGVRFKVIKVSGVGLLALFKDKKEKPRS  145



>ref|XP_007888735.1| PREDICTED: 40S ribosomal protein S23 [Callorhinchus milii]
Length=143

 Score =   177 bits (450),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>gb|EIE84601.1| 40S ribosomal protein S23 [Rhizopus delemar RA 99-880]
Length=134

 Score =   177 bits (449),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLNY++ENDEVLIAGFGR
Sbjct  39   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNYVDENDEVLIAGFGR  98

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG A+GDIPGVRFK+VKV+GVSLLAL+KEKKEKPRS
Sbjct  99   KGRAIGDIPGVRFKIVKVAGVSLLALYKEKKEKPRS  134



>ref|XP_008319279.1| PREDICTED: 40S ribosomal protein S23 [Cynoglossus semilaevis]
Length=143

 Score =   177 bits (450),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>gb|KFH64309.1| small subunit ribosomal protein S23e [Mortierella verticillata 
NRRL 6337]
Length=282

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+++ENDEVLIAGFGR
Sbjct  187  KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFVDENDEVLIAGFGR  246

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
             GHAVGD+PGVRFKVVKVSGVSLLAL+KEKKEKPRS
Sbjct  247  SGHAVGDLPGVRFKVVKVSGVSLLALWKEKKEKPRS  282



>ref|XP_002734646.1| PREDICTED: 40S ribosomal protein S23-like [Saccoglossus kowalevskii]
Length=143

 Score =   177 bits (449),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSL AL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLWALYKEKKERPRS  143



>ref|XP_004493946.1| PREDICTED: 40S ribosomal protein S23-like [Cicer arietinum]
Length=91

 Score =   176 bits (445),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = -1

Query  438  GIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDI  259
            GIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDI
Sbjct  4    GIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDI  63

Query  258  PGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            PGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct  64   PGVRFKVVKVSGVSLLALFKEKKEKPRS  91



>gb|ADW95790.1| 40S ribosomal S23-like protein [Pectinaria gouldii]
 gb|AIU94807.1| 40S ribosomal protein [Phragmatopoma lapidosa]
Length=143

 Score =   177 bits (449),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNY+EENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYVEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFK+VKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKLVKVASVSLLALYKEKKERPRS  143



>gb|ELU03157.1| hypothetical protein CAPTEDRAFT_155210 [Capitella teleta]
Length=143

 Score =   177 bits (449),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PR+
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRA  143



>emb|CBY09292.1| unnamed protein product [Oikopleura dioica]
Length=143

 Score =   177 bits (449),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVL+KIG+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLNYIEENDEVLIAGFGR
Sbjct  48   KGIVLDKIGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEENDEVLIAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
             GHAVGDIPGVRFKVVKV+ VSLLALFK KKE+PRS
Sbjct  108  SGHAVGDIPGVRFKVVKVANVSLLALFKGKKERPRS  143



>gb|EFX84739.1| hypothetical protein DAPPUDRAFT_230600 [Daphnia pulex]
Length=143

 Score =   177 bits (448),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCL +IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLTFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>ref|XP_007825599.2| Ribosomal protein S12/S23 [Metarhizium robertsii ARSEF 23]
 gb|EXU96527.1| ribosomal protein S12 [Metarhizium robertsii]
 gb|KFG78225.1| ribosomal protein S28 [Metarhizium anisopliae]
 gb|EFY95083.2| Ribosomal protein S12/S23 [Metarhizium robertsii ARSEF 23]
 gb|KID60017.1| Ribosomal protein S12/S23, partial [Metarhizium anisopliae ARSEF 
549]
 gb|KID74821.1| Ribosomal protein S12/S23, partial [Metarhizium brunneum ARSEF 
3297]
Length=144

 Score =   177 bits (448),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLNYI+ENDEVL+AGFGR
Sbjct  49   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNYIDENDEVLLAGFGR  108

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG A+GDIPGVRFKVVKVSGVSLL+L++EKKEKPRS
Sbjct  109  KGRAIGDIPGVRFKVVKVSGVSLLSLWREKKEKPRS  144



>ref|NP_001292243.1| 40S ribosomal protein S23 [Crassostrea gigas]
 ref|XP_011456132.1| PREDICTED: 40S ribosomal protein S23 [Crassostrea gigas]
 gb|AAX47435.1| 40S ribosomal protein S23 [Crassostrea gigas]
Length=142

 Score =   177 bits (448),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLNY+EENDEVL+AGFGR
Sbjct  47   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYVEENDEVLVAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFK+VKV+ VSLLALFK KKE+PRS
Sbjct  107  KGHAVGDIPGVRFKIVKVANVSLLALFKGKKERPRS  142



>emb|CAD98683.1| ribosomal protein S23 [Cryptosporidium parvum]
Length=145

 Score =   177 bits (448),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIV+E+ GIEAKQPNSA+RKC RVQLIKNGKKI AFVP DGCLNYI+ENDEVL+AGFGR
Sbjct  50   KGIVVERFGIEAKQPNSAVRKCVRVQLIKNGKKITAFVPRDGCLNYIDENDEVLVAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGH+VGDIPGVRFK VKVSGVSLLALFKEKKEKPRS
Sbjct  110  KGHSVGDIPGVRFKAVKVSGVSLLALFKEKKEKPRS  145



>gb|ABW90428.1| putative ribosomal protein S23 [Barentsia elongata]
Length=143

 Score =   177 bits (448),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNHIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+GVSLLALFK KKE+PR 
Sbjct  108  KGHAVGDIPGVRFKVVKVAGVSLLALFKGKKERPRH  143



>ref|XP_001388310.1| ribosomal protein S23 [Cryptosporidium parvum Iowa II]
 gb|EAZ51504.1| ribosomal protein S23 [Cryptosporidium parvum Iowa II]
Length=161

 Score =   177 bits (449),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIV+E+ GIEAKQPNSA+RKC RVQLIKNGKKI AFVP DGCLNYI+ENDEVL+AGFGR
Sbjct  66   KGIVVERFGIEAKQPNSAVRKCVRVQLIKNGKKITAFVPRDGCLNYIDENDEVLVAGFGR  125

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGH+VGDIPGVRFK VKVSGVSLLALFKEKKEKPRS
Sbjct  126  KGHSVGDIPGVRFKAVKVSGVSLLALFKEKKEKPRS  161



>ref|WP_028830520.1| 30S ribosomal protein S12 [Proteobacteria bacterium JGI 0000113-E04]
Length=145

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKC RVQLIKNGKKIAAFVP DGCLNYI+ENDEVLI+GFGR
Sbjct  50   KGIVLEKIGIEAKQPNSAIRKCVRVQLIKNGKKIAAFVPRDGCLNYIDENDEVLISGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GH+VGDI GVRFKV KV+GVSLLAL+KEKKEKPRS
Sbjct  110  RGHSVGDIAGVRFKVAKVAGVSLLALYKEKKEKPRS  145



>gb|ACY71268.1| ribosomal protein S23 [Chrysomela tremula]
Length=143

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNHIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>ref|XP_006973124.1| PREDICTED: 40S ribosomal protein S23-like [Peromyscus maniculatus 
bairdii]
Length=143

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVTNVSLLALYKGKKERPRS  143



>emb|CAH04343.1| S23e ribosomal protein [Biphyllus lunatus]
 gb|AEE61593.1| unknown [Dendroctonus ponderosae]
 gb|ENN71689.1| hypothetical protein YQE_11612, partial [Dendroctonus ponderosae]
 gb|ERL87232.1| hypothetical protein D910_04630 [Dendroctonus ponderosae]
Length=143

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNHIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>ref|XP_005835765.1| small subunit ribosomal protein S23e, cytoplasmic [Guillardia 
theta CCMP2712]
 gb|EKX48785.1| small subunit ribosomal protein S23e, cytoplasmic [Guillardia 
theta CCMP2712]
Length=142

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIE+KQPNSA+RKC RVQLIKNGKKIAAFVPNDGCLN+I+ENDEVL+AGFGR
Sbjct  47   KGIVLEKIGIESKQPNSAVRKCVRVQLIKNGKKIAAFVPNDGCLNFIDENDEVLVAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
             GHA GDIPGVRFK+VKVSGV+LLALFKEKKEKPRS
Sbjct  107  SGHAKGDIPGVRFKIVKVSGVALLALFKEKKEKPRS  142



>emb|CAJ01861.1| ribosomal protein S23e [Meladema coriacea]
Length=142

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  47   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNHIEENDEVLVAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  107  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  142



>ref|XP_973351.1| PREDICTED: 40S ribosomal protein S23 [Tribolium castaneum]
 emb|CAH04342.1| S23e ribosomal protein [Carabus granulatus]
 emb|CAJ01862.1| ribosomal protein S23e [Sphaerius sp. APV-2005]
 emb|CAJ17218.1| ribosomal protein S23e [Georissus sp. APV-2005]
 gb|EEZ98852.1| hypothetical protein TcasGA2_TC004462 [Tribolium castaneum]
Length=143

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNHIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>gb|ABI52808.1| 40S ribosomal protein S23 [Argas monolakensis]
 gb|ABR23465.1| 40S ribosomal protein S23 [Ornithodoros parkeri]
Length=143

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>ref|XP_005103665.1| PREDICTED: 40S ribosomal protein S23-like [Aplysia californica]
Length=143

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFK+VKV+ VSLLALFK KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKIVKVANVSLLALFKGKKERPRS  143



>ref|XP_003062147.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53859.1| predicted protein [Micromonas pusilla CCMP1545]
Length=142

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+GIEAKQPNSAIRKC RVQLIKNGKKIAAFVP DGCLN+++ENDEVLIAGFGR
Sbjct  47   KGIVLEKLGIEAKQPNSAIRKCVRVQLIKNGKKIAAFVPRDGCLNFVDENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+GV+L ALF+EKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVAGVALTALFREKKEKPRS  142



>dbj|GAN09498.1| 40S ribosomal protein S23 [Mucor ambiguus]
Length=241

 Score =   179 bits (455),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLNY++ENDEVLIAGFGR
Sbjct  146  KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNYVDENDEVLIAGFGR  205

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG A+GDIPGVRFKVVKV+GVSLLAL+KEKKEKPRS
Sbjct  206  KGRAIGDIPGVRFKVVKVAGVSLLALYKEKKEKPRS  241



>dbj|BAN20179.1| ribosomal protein S23 [Riptortus pedestris]
Length=143

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>emb|CAJ01860.1| ribosomal protein S23e [Hister sp. APV-2005]
Length=143

 Score =   176 bits (447),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNHIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>ref|XP_010211874.1| PREDICTED: 40S ribosomal protein S23 [Tinamus guttatus]
Length=142

 Score =   176 bits (446),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  47   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  107  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  142



>ref|XP_002768542.1| ribosomal protein S23, putative [Perkinsus marinus ATCC 50983]
 ref|XP_002773428.1| ribosomal protein S23, putative [Perkinsus marinus ATCC 50983]
 ref|XP_002778933.1| ribosomal protein S23, putative [Perkinsus marinus ATCC 50983]
 ref|XP_002779371.1| ribosomal protein S23, putative [Perkinsus marinus ATCC 50983]
 gb|EER01260.1| ribosomal protein S23, putative [Perkinsus marinus ATCC 50983]
 gb|EER05244.1| ribosomal protein S23, putative [Perkinsus marinus ATCC 50983]
 gb|EER10728.1| ribosomal protein S23, putative [Perkinsus marinus ATCC 50983]
 gb|EER11166.1| ribosomal protein S23, putative [Perkinsus marinus ATCC 50983]
Length=145

 Score =   176 bits (447),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIV+EK+GIEAKQPNSAIRKC RVQLIKNGKKIAAFVPNDGCLN+I+ENDEVL++GFGR
Sbjct  50   KGIVVEKMGIEAKQPNSAIRKCCRVQLIKNGKKIAAFVPNDGCLNFIDENDEVLVSGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKV+G SLLAL+KEKKEKPRS
Sbjct  110  RGHAVGDIPGVRFKVVKVAGCSLLALYKEKKEKPRS  145



>gb|ADG29194.1| 40S ribosomal protein S23, partial [Epinephelus coioides]
Length=135

 Score =   176 bits (446),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  40   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  99

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  100  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  135



>ref|XP_010408179.1| PREDICTED: 40S ribosomal protein S23, partial [Corvus cornix 
cornix]
Length=138

 Score =   176 bits (446),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  43   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  102

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  103  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  138



>ref|XP_009639412.1| PREDICTED: 40S ribosomal protein S23, partial [Egretta garzetta]
Length=121

 Score =   176 bits (445),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  26   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  85

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  86   KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  121



>ref|XP_004636816.1| PREDICTED: 40S ribosomal protein S23-like [Octodon degus]
Length=143

 Score =   176 bits (446),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVASVSLLALYKGKKERPRS  143



>tpe|CAL69112.1| TPA: putative 40S ribosomal protein S23 [Spadella cephaloptera]
Length=143

 Score =   176 bits (446),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPKDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
             GHAVGDIPGVRFKVVKV+ VSLLALFKEKKE+PRS
Sbjct  108  SGHAVGDIPGVRFKVVKVANVSLLALFKEKKERPRS  143



>ref|XP_001418209.1| Ribosomal protein S23, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 ref|XP_003079816.1| 40S ribosomal protein S23 (ISS) [Ostreococcus tauri]
 emb|CAL53462.1| Nucleic acid-binding, OB-fold [Ostreococcus tauri]
 gb|ABO96502.1| Ribosomal protein S23, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=142

 Score =   176 bits (446),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKC RVQLIKNGKKIAAFVP DGCLN+ +ENDEVLIAGFGR
Sbjct  47   KGIVLEKIGIEAKQPNSAIRKCVRVQLIKNGKKIAAFVPRDGCLNFTDENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+GVSL ALF+EKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVAGVSLNALFREKKEKPRS  142



>emb|CDQ84030.1| unnamed protein product [Oncorhynchus mykiss]
Length=165

 Score =   177 bits (448),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  70   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  129

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  130  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  165



>ref|XP_005496177.1| PREDICTED: 40S ribosomal protein S23, partial [Zonotrichia albicollis]
 gb|KGL76498.1| 40S ribosomal protein S23, partial [Tinamus guttatus]
Length=130

 Score =   176 bits (445),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  35   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  94

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  95   KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  130



>gb|KFO06325.1| 40S ribosomal protein S23, partial [Balearica regulorum gibbericeps]
Length=133

 Score =   176 bits (445),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  38   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  97

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  98   KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  133



>sp|Q6EV23.1|RS23_PAPDA RecName: Full=40S ribosomal protein S23 [Papilio dardanus]
 sp|Q962Q7.1|RS23_SPOFR RecName: Full=40S ribosomal protein S23 [Spodoptera frugiperda]
 gb|AAK92191.1|AF400219_1 ribosomal protein S23 [Spodoptera frugiperda]
 emb|CAH04127.1| ribsomal protein S23e [Papilio dardanus]
 gb|ADT80660.1| ribosomal protein S23 [Euphydryas aurinia]
 dbj|BAM17700.1| ribosomal protein S23 [Papilio xuthus]
 dbj|BAM19006.1| ribosomal protein S23 [Papilio polytes]
Length=143

 Score =   176 bits (446),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>gb|AEL28841.1| ribosomal protein S23 [Heliconius melpomene cythera]
Length=143

 Score =   176 bits (446),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>ref|XP_004880193.1| PREDICTED: 40S ribosomal protein S23 [Heterocephalus glaber]
 ref|XP_004841696.1| PREDICTED: 40S ribosomal protein S23 isoform X2 [Heterocephalus 
glaber]
Length=148

 Score =   176 bits (447),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  53   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  112

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  113  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  148



>ref|XP_009511287.1| PREDICTED: 40S ribosomal protein S23, partial [Phalacrocorax 
carbo]
Length=97

 Score =   174 bits (442),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  2    KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  61

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  62   KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  97



>ref|XP_011376000.1| PREDICTED: 40S ribosomal protein S23 [Pteropus vampyrus]
Length=143

 Score =   176 bits (446),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVASVSLLALYKGKKERPRS  143



>ref|XP_009557726.1| PREDICTED: 40S ribosomal protein S23, partial [Cuculus canorus]
Length=147

 Score =   176 bits (446),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  52   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  111

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  112  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  147



>gb|AAV91403.1| ribosomal protein 5 [Lonomia obliqua]
 gb|ACY95346.1| ribosomal protein S23 [Manduca sexta]
Length=143

 Score =   176 bits (446),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>ref|XP_010308642.1| PREDICTED: 40S ribosomal protein S23, partial [Balearica regulorum 
gibbericeps]
 gb|KFP17915.1| 40S ribosomal protein S23, partial [Egretta garzetta]
Length=132

 Score =   176 bits (445),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  37   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  96

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  97   KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  132



>tpg|DAA24622.1| TPA: ribosomal protein S23-like [Bos taurus]
Length=143

 Score =   176 bits (446),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>ref|NP_001037273.1| ribosomal protein S23 [Bombyx mori]
 gb|AAU11821.1| ribosomal protein S23 [Bombyx mori]
 gb|AAV34880.1| ribosomal protein S23 [Bombyx mori]
Length=143

 Score =   176 bits (446),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>emb|CEP10565.1| hypothetical protein [Parasitella parasitica]
 emb|CEP08800.1| hypothetical protein [Parasitella parasitica]
Length=145

 Score =   176 bits (446),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLNY++ENDEVLIAGFGR
Sbjct  50   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNYVDENDEVLIAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG A+GDIPGVRFKVVKV+GV+L+AL+KEKKEKPRS
Sbjct  110  KGRAIGDIPGVRFKVVKVAGVALIALYKEKKEKPRS  145



>gb|EHJ73701.1| 40S ribosomal protein S23 [Danaus plexippus]
Length=112

 Score =   175 bits (443),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  17   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGR  76

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  77   KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  112



>ref|XP_003646303.1| hypothetical protein Ecym_4440 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET39486.1| hypothetical protein Ecym_4440 [Eremothecium cymbalariae DBVPG#7215]
Length=145

 Score =   176 bits (446),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+E+KQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLN+++ENDEVL+AGFGR
Sbjct  50   KGIVLEKIGVESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG AVGDIPGVRFKVVKVSGVSLLAL+KEKKEKPRS
Sbjct  110  KGKAVGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS  145



>ref|XP_007066505.1| PREDICTED: 40S ribosomal protein S23-like [Chelonia mydas]
Length=171

 Score =   177 bits (448),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  76   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  135

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  136  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  171



>ref|XP_005010799.1| PREDICTED: 40S ribosomal protein S23, partial [Anas platyrhynchos]
Length=111

 Score =   174 bits (442),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  16   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  75

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  76   KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  111



>ref|XP_010175359.1| PREDICTED: 40S ribosomal protein S23, partial [Caprimulgus carolinensis]
 ref|XP_010195707.1| PREDICTED: 40S ribosomal protein S23, partial [Colius striatus]
 ref|XP_010279982.1| PREDICTED: 40S ribosomal protein S23, partial [Phaethon lepturus]
Length=141

 Score =   176 bits (445),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  46   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  105

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  106  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  141



>tpg|DAA12825.1| TPA: ribosomal protein S23-like [Bos taurus]
Length=155

 Score =   176 bits (446),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KG+VLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  60   KGVVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  119

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  120  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  155



>gb|EAX05328.1| hCG1990955, isoform CRA_b, partial [Homo sapiens]
Length=109

 Score =   174 bits (442),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  14   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  73

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  74   KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  109



>gb|ELW63939.1| 40S ribosomal protein S23 [Tupaia chinensis]
Length=143

 Score =   176 bits (445),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVK++ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKIANVSLLALYKGKKERPRS  143



>ref|NP_001016.1| 40S ribosomal protein S23 [Homo sapiens]
 ref|NP_077137.1| 40S ribosomal protein S23 [Mus musculus]
 ref|NP_511172.1| 40S ribosomal protein S23 [Rattus norvegicus]
 ref|NP_001029862.1| 40S ribosomal protein S23 [Bos taurus]
 ref|NP_001180509.1| 40S ribosomal protein S23 [Macaca mulatta]
 ref|NP_001232329.1| putative ribosomal protein S23 [Taeniopygia guttata]
 ref|NP_001269298.1| 40S ribosomal protein S23 [Chinchilla lanigera]
 ref|NP_001291864.1| ribosomal protein S23 [Ailuropoda melanoleuca]
 ref|XP_001511270.1| PREDICTED: 40S ribosomal protein S23 [Ornithorhynchus anatinus]
 ref|XP_001504690.1| PREDICTED: 40S ribosomal protein S23 [Equus caballus]
 ref|XP_002713980.1| PREDICTED: 40S ribosomal protein S23 [Oryctolagus cuniculus]
 ref|XP_002744843.1| PREDICTED: 40S ribosomal protein S23 [Callithrix jacchus]
 ref|XP_003216326.1| PREDICTED: 40S ribosomal protein S23 [Anolis carolinensis]
 ref|XP_003261593.1| PREDICTED: 40S ribosomal protein S23 isoform 1 [Nomascus leucogenys]
 ref|XP_003479546.1| PREDICTED: 40S ribosomal protein S23 [Cavia porcellus]
 ref|XP_003503773.1| PREDICTED: 40S ribosomal protein S23 [Cricetulus griseus]
 ref|XP_424903.3| PREDICTED: 40S ribosomal protein S23 [Gallus gallus]
 ref|XP_003759921.1| PREDICTED: 40S ribosomal protein S23-like [Sarcophilus harrisii]
 ref|XP_003786005.1| PREDICTED: 40S ribosomal protein S23 [Otolemur garnettii]
 ref|XP_003899938.1| PREDICTED: 40S ribosomal protein S23 [Papio anubis]
 ref|XP_003920840.1| PREDICTED: 40S ribosomal protein S23 [Saimiri boliviensis boliviensis]
 ref|XP_004009109.1| PREDICTED: 40S ribosomal protein S23 isoform 1 [Ovis aries]
 ref|XP_004009110.1| PREDICTED: 40S ribosomal protein S23 isoform 2 [Ovis aries]
 ref|XP_004042281.1| PREDICTED: 40S ribosomal protein S23 [Gorilla gorilla gorilla]
 ref|XP_004281689.1| PREDICTED: 40S ribosomal protein S23 [Orcinus orca]
 ref|XP_004325227.1| PREDICTED: 40S ribosomal protein S23-like isoform 1 [Tursiops 
truncatus]
 ref|XP_004325228.1| PREDICTED: 40S ribosomal protein S23-like isoform 2 [Tursiops 
truncatus]
 ref|XP_004405675.1| PREDICTED: 40S ribosomal protein S23 [Odobenus rosmarus divergens]
 ref|XP_004420454.1| PREDICTED: 40S ribosomal protein S23 [Ceratotherium simum simum]
 ref|XP_004483487.1| PREDICTED: 40S ribosomal protein S23 [Dasypus novemcinctus]
 ref|XP_004613223.1| PREDICTED: 40S ribosomal protein S23 [Sorex araneus]
 ref|XP_004651701.1| PREDICTED: 40S ribosomal protein S23 [Jaculus jaculus]
 ref|XP_004640994.1| PREDICTED: 40S ribosomal protein S23 [Octodon degus]
 ref|XP_004678215.1| PREDICTED: 40S ribosomal protein S23 [Condylura cristata]
 ref|XP_004759191.1| PREDICTED: 40S ribosomal protein S23 [Mustela putorius furo]
 ref|XP_004799713.1| PREDICTED: 40S ribosomal protein S23 [Mustela putorius furo]
 ref|XP_004841695.1| PREDICTED: 40S ribosomal protein S23 isoform X1 [Heterocephalus 
glaber]
 ref|XP_005143837.1| PREDICTED: 40S ribosomal protein S23 [Melopsittacus undulatus]
 ref|XP_005288226.1| PREDICTED: 40S ribosomal protein S23 [Chrysemys picta bellii]
 ref|XP_005288227.1| PREDICTED: 40S ribosomal protein S23 [Chrysemys picta bellii]
 ref|XP_005356574.1| PREDICTED: 40S ribosomal protein S23 [Microtus ochrogaster]
 ref|XP_005315713.1| PREDICTED: 40S ribosomal protein S23 [Ictidomys tridecemlineatus]
 ref|XP_005529506.1| PREDICTED: 40S ribosomal protein S23 [Pseudopodoces humilis]
 ref|XP_005557369.1| PREDICTED: 40S ribosomal protein S23 [Macaca fascicularis]
 ref|XP_005618212.1| PREDICTED: 40S ribosomal protein S23 [Canis lupus familiaris]
 ref|XP_005858171.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal protein S23 [Myotis 
brandtii]
 ref|XP_005903824.1| PREDICTED: 40S ribosomal protein S23 [Bos mutus]
 ref|XP_005997828.1| PREDICTED: 40S ribosomal protein S23 [Latimeria chalumnae]
 ref|XP_006081309.1| PREDICTED: 40S ribosomal protein S23 [Myotis lucifugus]
 ref|XP_006187333.1| PREDICTED: 40S ribosomal protein S23-like [Camelus ferus]
 ref|XP_006197687.1| PREDICTED: 40S ribosomal protein S23 [Vicugna pacos]
 ref|XP_006152733.1| PREDICTED: 40S ribosomal protein S23-like [Tupaia chinensis]
 ref|XP_006263674.1| PREDICTED: 40S ribosomal protein S23-like [Alligator mississippiensis]
 ref|XP_006775565.1| PREDICTED: 40S ribosomal protein S23 [Myotis davidii]
 ref|XP_006736071.1| PREDICTED: 40S ribosomal protein S23 [Leptonychotes weddellii]
 ref|XP_006870671.1| PREDICTED: 40S ribosomal protein S23 [Chrysochloris asiatica]
 ref|XP_006913256.1| PREDICTED: 40S ribosomal protein S23 [Pteropus alecto]
 ref|XP_006980534.1| PREDICTED: 40S ribosomal protein S23 [Peromyscus maniculatus 
bairdii]
 ref|XP_007066495.1| PREDICTED: 40S ribosomal protein S23-like isoform X1 [Chelonia 
mydas]
 ref|XP_007066496.1| PREDICTED: 40S ribosomal protein S23-like isoform X2 [Chelonia 
mydas]
 ref|XP_007115084.1| PREDICTED: 40S ribosomal protein S23 [Physeter catodon]
 ref|XP_006059412.1| PREDICTED: 40S ribosomal protein S23 [Bubalus bubalis]
 ref|XP_007193111.1| PREDICTED: 40S ribosomal protein S23 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007451772.1| PREDICTED: 40S ribosomal protein S23 [Lipotes vexillifer]
 ref|XP_007487419.1| PREDICTED: 40S ribosomal protein S23-like [Monodelphis domestica]
 ref|XP_007487423.1| PREDICTED: 40S ribosomal protein S23-like [Monodelphis domestica]
 ref|XP_007518855.1| PREDICTED: 40S ribosomal protein S23 [Erinaceus europaeus]
 ref|XP_007634345.1| PREDICTED: 40S ribosomal protein S23 [Cricetulus griseus]
 ref|XP_007941666.1| PREDICTED: 40S ribosomal protein S23 [Orycteropus afer afer]
 ref|XP_007975385.1| PREDICTED: 40S ribosomal protein S23 [Chlorocebus sabaeus]
 ref|XP_008053354.1| PREDICTED: 40S ribosomal protein S23 [Tarsius syrichta]
 ref|XP_008490354.1| PREDICTED: 40S ribosomal protein S23 [Calypte anna]
 ref|XP_008528881.1| PREDICTED: 40S ribosomal protein S23 [Equus przewalskii]
 ref|XP_008577314.1| PREDICTED: 40S ribosomal protein S23 [Galeopterus variegatus]
 ref|XP_008709297.1| PREDICTED: 40S ribosomal protein S23 [Ursus maritimus]
 ref|XP_008851519.1| PREDICTED: 40S ribosomal protein S23 [Nannospalax galili]
 ref|XP_008974029.1| PREDICTED: 40S ribosomal protein S23 [Pan paniscus]
 ref|XP_009239142.1| PREDICTED: 40S ribosomal protein S23 [Pongo abelii]
 ref|XP_009447188.1| PREDICTED: 40S ribosomal protein S23 [Pan troglodytes]
 ref|XP_010384342.1| PREDICTED: 40S ribosomal protein S23 [Rhinopithecus roxellana]
 ref|XP_010586556.1| PREDICTED: 40S ribosomal protein S23 [Loxodonta africana]
 ref|XP_010861675.1| PREDICTED: 40S ribosomal protein S23 [Bison bison bison]
 ref|XP_010947528.1| PREDICTED: 40S ribosomal protein S23 [Camelus bactrianus]
 ref|XP_010980316.1| PREDICTED: 40S ribosomal protein S23 [Camelus dromedarius]
 sp|P62268.3|RS23_RAT RecName: Full=40S ribosomal protein S23 [Rattus norvegicus]
 sp|P62266.3|RS23_HUMAN RecName: Full=40S ribosomal protein S23 [Homo sapiens]
 sp|P62267.3|RS23_MOUSE RecName: Full=40S ribosomal protein S23 [Mus musculus]
 sp|P62298.1|RS23_CHILA RecName: Full=40S ribosomal protein S23 [Chinchilla lanigera]
 sp|Q3T199.1|RS23_BOVIN RecName: Full=40S ribosomal protein S23 [Bos taurus]
 pdb|2ZKQ|LL Chain l, Structure Of A Mammalian Ribosomal 40s Subunit Within 
An 80s Complex Obtained By Docking Homology Models Of The 
Rna And Proteins Into An 8.7 A Cryo-em Map
 pdb|3J3A|X Chain X, Structure Of The Human 40s Ribosomal Proteins
 pdb|4KZX|X Chain X, Rabbit 40s Ribosomal Subunit In Complex With Eif1.
 pdb|4KZY|X Chain X, Rabbit 40s Ribosomal Subunit In Complex With Eif1 And 
Eif1a.
 pdb|4KZZ|X Chain X, Rabbit 40s Ribosomal Subunit In Complex With Mrna, Initiator 
Trna And Eif1a
 pdb|4CXC|X Chain X, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4CXG|X Chain X, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4CXH|X Chain X, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4UQ4|X Chain X, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Post-like State
 pdb|4UQ5|X Chain X, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Pre-like State
 pdb|4D61|X Chain X, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 dbj|BAA03400.1| yeast ribosomal protein S28 homologue [Homo sapiens]
 emb|CAA54584.1| ribosomal protein S23 [Rattus norvegicus]
 gb|AAH02145.1| Ribosomal protein S23 [Mus musculus]
 dbj|BAB22198.1| unnamed protein product [Mus musculus]
 dbj|BAB27050.1| unnamed protein product [Mus musculus]
 dbj|BAB27058.1| unnamed protein product [Mus musculus]
 dbj|BAB28238.1| unnamed protein product [Mus musculus]
 dbj|BAB28969.1| unnamed protein product [Mus musculus]
 dbj|BAC34329.1| unnamed protein product [Mus musculus]
 dbj|BAC40136.1| unnamed protein product [Mus musculus]
 gb|AAH54435.1| Ribosomal protein S23 [Mus musculus]
 gb|AAH58134.1| Ribosomal protein S23 [Rattus norvegicus]
 gb|AAS59430.1| ribosomal protein S23 [Chinchilla lanigera]
 gb|AAH70221.1| Ribosomal protein S23 [Homo sapiens]
 emb|CAG33277.1| RPS23 [Homo sapiens]
 gb|AAH78418.1| Ribosomal protein S23 [Mus musculus]
 dbj|BAE39173.1| unnamed protein product [Mus musculus]
 dbj|BAE40456.1| unnamed protein product [Mus musculus]
 gb|AAI02050.1| Ribosomal protein S23 [Bos taurus]
 gb|EAW95887.1| ribosomal protein S23, isoform CRA_a [Homo sapiens]
 gb|EAW95888.1| ribosomal protein S23, isoform CRA_a [Homo sapiens]
 gb|EDL35122.1| mCG124496 [Mus musculus]
 gb|EDM09997.1| rCG44462 [Rattus norvegicus]
 dbj|BAF83821.1| unnamed protein product [Homo sapiens]
 dbj|BAG34715.1| unnamed protein product [Homo sapiens]
 gb|ACH44467.1| putative ribosomal protein S23 [Taeniopygia guttata]
 gb|ACH46349.1| putative ribosomal protein S23 [Taeniopygia guttata]
 tpg|DAA27182.1| TPA: 40S ribosomal protein S23 [Bos taurus]
 gb|AEA39496.1| ribosomal protein S23 [Ailuropoda melanoleuca]
 gb|AEA39545.1| ribosomal protein S23 [Ailuropoda melanoleuca]
 gb|EGW09305.1| 40S ribosomal protein S23 [Cricetulus griseus]
 gb|EMP29541.1| 40S ribosomal protein S23 [Chelonia mydas]
Length=143

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>ref|XP_007432677.1| PREDICTED: 40S ribosomal protein S23-like [Python bivittatus]
 ref|XP_007432678.1| PREDICTED: 40S ribosomal protein S23 [Python bivittatus]
 gb|ETE65747.1| 40S ribosomal protein S23 [Ophiophagus hannah]
Length=143

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>ref|XP_006035617.1| PREDICTED: 40S ribosomal protein S23-like [Alligator sinensis]
 ref|XP_006263675.1| PREDICTED: 40S ribosomal protein S23-like [Alligator mississippiensis]
Length=143

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>ref|XP_010075782.1| PREDICTED: 40S ribosomal protein S23, partial [Pterocles gutturalis]
 gb|EMC78748.1| 40S ribosomal protein S23, partial [Columba livia]
 gb|KFO99578.1| 40S ribosomal protein S23, partial [Calypte anna]
 gb|KFQ31862.1| 40S ribosomal protein S23, partial [Merops nubicus]
 gb|KFQ44581.1| 40S ribosomal protein S23, partial [Nestor notabilis]
 gb|KFQ65583.1| 40S ribosomal protein S23, partial [Phaethon lepturus]
 gb|KFV63097.1| 40S ribosomal protein S23, partial [Picoides pubescens]
 gb|KFZ51520.1| 40S ribosomal protein S23, partial [Caprimulgus carolinensis]
Length=143

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>gb|EDL00975.1| mCG113987 [Mus musculus]
 gb|EHB00188.1| 40S ribosomal protein S23, partial [Heterocephalus glaber]
Length=143

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>ref|NP_998929.1| 40S ribosomal protein S23 [Sus scrofa]
 sp|Q6SA96.3|RS23_PIG RecName: Full=40S ribosomal protein S23 [Sus scrofa]
 pdb|4W23|X Chain X, Structure Of The 80s Mammalian Ribosome Bound To Eef2 
(this Entry Contains The Small Ribosomal Subunit)
 pdb|4W28|X Chain X, Structure Of The Translating Mammalian Ribosome-sec61 
Complex (this Entry Contains The Small Ribosomal Subunit)
 gb|AAR22386.1| ribosomal protein S23 [Sus scrofa]
Length=143

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>gb|ABV22458.1| ribosomal protein S23e [Oxyrrhis marina]
 gb|ABV22459.1| ribosomal protein S23e [Oxyrrhis marina]
Length=143

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIV+EKIGIEAKQPNSAIRKC RVQLIKNGKKIAAFVPNDGCLN+I+ENDE LIAGFGR
Sbjct  48   KGIVVEKIGIEAKQPNSAIRKCVRVQLIKNGKKIAAFVPNDGCLNFIDENDECLIAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKV+G +LLAL+KEKKEKPR+
Sbjct  108  RGHAVGDIPGVRFKVVKVAGCALLALYKEKKEKPRT  143



>dbj|BAB27102.1| unnamed protein product [Mus musculus]
Length=143

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>gb|AAR10268.1| similar to Drosophila melanogaster CG8415, partial [Drosophila 
yakuba]
Length=148

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DG LNYIEENDEVL+AGFGR
Sbjct  53   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVLVAGFGR  112

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  113  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  148



>emb|CBN80657.1| 40S ribosomal protein S23, partial [Dicentrarchus labrax]
Length=140

 Score =   176 bits (445),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  45   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  104

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  105  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  140



>sp|Q9GRJ3.1|RS23_LUMRU RecName: Full=40S ribosomal protein S23 [Lumbricus rubellus]
 emb|CAC14789.1| 40S ribosomal protein S23 [Lumbricus rubellus]
Length=143

 Score =   176 bits (445),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K+KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVASVSLLALYKQKKERPRS  143



>ref|XP_004586359.1| PREDICTED: 40S ribosomal protein S23 [Ochotona princeps]
Length=181

 Score =   177 bits (448),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  86   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  145

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  146  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  181



>emb|CEP13265.1| hypothetical protein [Parasitella parasitica]
Length=147

 Score =   176 bits (445),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIG+EAKQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLNY++ENDEVLIAGFGR
Sbjct  52   KGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNYVDENDEVLIAGFGR  111

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG A+GDIPGVRFKVVKV+GV+L+AL+KEKKEKPRS
Sbjct  112  KGRAIGDIPGVRFKVVKVAGVALIALYKEKKEKPRS  147



>gb|KFO57084.1| 40S ribosomal protein S23, partial [Corvus brachyrhynchos]
 gb|KFP29906.1| 40S ribosomal protein S23, partial [Colius striatus]
 gb|KFU99041.1| 40S ribosomal protein S23, partial [Pterocles gutturalis]
Length=144

 Score =   176 bits (445),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  49   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  108

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  109  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  144



>ref|XP_008940828.1| PREDICTED: 40S ribosomal protein S23, partial [Merops nubicus]
Length=148

 Score =   176 bits (445),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  53   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  112

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  113  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  148



>pdb|4D5L|X Chain X, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 gb|KFO75064.1| 40S ribosomal protein S23, partial [Cuculus canorus]
 gb|KFQ65633.1| 40S ribosomal protein S23, partial [Phaethon lepturus]
 gb|KFV88254.1| 40S ribosomal protein S23, partial [Struthio camelus australis]
Length=142

 Score =   175 bits (444),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  47   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  107  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  142



>ref|NP_001133209.1| ribosomal protein S23-1 [Salmo salar]
 ref|NP_001290828.1| 40S ribosomal protein S23 [Esox lucius]
 ref|NP_001291043.1| 40S ribosomal protein S23 [Esox lucius]
 ref|XP_010769244.1| PREDICTED: 40S ribosomal protein S23 [Notothenia coriiceps]
 dbj|BAF37942.1| Similar to ribosomal protein S23 [Oncorhynchus mykiss]
 gb|ACH70999.1| ribosomal protein S23-1 [Salmo salar]
 gb|ACH71000.1| ribosomal protein S23-2 [Salmo salar]
 gb|ACI69612.1| 40S ribosomal protein S23 [Salmo salar]
 gb|ACI69871.1| 40S ribosomal protein S23 [Salmo salar]
 gb|ACN10013.1| 40S ribosomal protein S23 [Salmo salar]
 gb|ACN12360.1| 40S ribosomal protein S23 [Salmo salar]
 gb|ACO11726.1| 40S ribosomal protein S23 [Caligus rogercresseyi]
 gb|ACO13670.1| 40S ribosomal protein S23 [Esox lucius]
 gb|ACO14099.1| 40S ribosomal protein S23 [Esox lucius]
 gb|ACQ57959.1| 40S ribosomal protein S23 [Anoplopoma fimbria]
Length=143

 Score =   176 bits (445),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>ref|NP_001187084.1| 40S ribosomal protein S23 [Ictalurus punctatus]
 sp|Q90YQ1.1|RS23_ICTPU RecName: Full=40S ribosomal protein S23 [Ictalurus punctatus]
 gb|AAK95205.1|AF402831_1 40S ribosomal protein S23 [Ictalurus punctatus]
Length=143

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>ref|XP_795223.2| PREDICTED: 40S ribosomal protein S23-like [Strongylocentrotus 
purpuratus]
Length=159

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  64   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  123

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSL ALFK KKE+PRS
Sbjct  124  KGHAVGDIPGVRFKVVKVANVSLWALFKGKKERPRS  159



>ref|XP_007251538.1| PREDICTED: 40S ribosomal protein S23-like [Astyanax mexicanus]
Length=143

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>ref|NP_001103591.1| 40S ribosomal protein S23 [Danio rerio]
 ref|XP_003448402.1| PREDICTED: 40S ribosomal protein S23-like [Oreochromis niloticus]
 ref|XP_004069370.1| PREDICTED: 40S ribosomal protein S23 [Oryzias latipes]
 ref|XP_004548837.1| PREDICTED: 40S ribosomal protein S23-like [Maylandia zebra]
 ref|XP_005724495.1| PREDICTED: 40S ribosomal protein S23-like [Pundamilia nyererei]
 ref|XP_005811694.1| PREDICTED: 40S ribosomal protein S23-like [Xiphophorus maculatus]
 ref|XP_005938950.1| PREDICTED: 40S ribosomal protein S23-like [Haplochromis burtoni]
 ref|XP_006631044.1| PREDICTED: 40S ribosomal protein S23-like [Lepisosteus oculatus]
 ref|XP_006783129.1| PREDICTED: 40S ribosomal protein S23-like [Neolamprologus brichardi]
 ref|XP_007575813.1| PREDICTED: 40S ribosomal protein S23 [Poecilia formosa]
 ref|XP_008303676.1| PREDICTED: 40S ribosomal protein S23 [Stegastes partitus]
 ref|XP_008406576.1| PREDICTED: 40S ribosomal protein S23 [Poecilia reticulata]
 ref|XP_010755168.1| PREDICTED: 40S ribosomal protein S23 [Larimichthys crocea]
 gb|AAT45256.1| 40S ribosomal protein S24-like protein [Sparus aurata]
 dbj|BAF45911.1| ribosomal protein S23 [Solea senegalensis]
 gb|AAI53999.1| Zgc:171710 protein [Danio rerio]
 gb|AAI71649.1| Zgc:171710 [Danio rerio]
 gb|AAI71653.1| Zgc:171710 [Danio rerio]
 gb|ACO08900.1| 40S ribosomal protein S23 [Osmerus mordax]
 gb|ACQ99325.1| 40S ribosomal protein S23 [Perca flavescens]
 gb|AEB31267.1| 40S ribosomal protein S24-like protein, partial [Epinephelus 
bruneus]
Length=143

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>ref|XP_002499765.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61023.1| predicted protein [Micromonas sp. RCC299]
Length=142

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+GIEAKQPNSAIRKC RVQLIKNGKKIAAFVP DGCLN+++ENDEVLIAGFGR
Sbjct  47   KGIVLEKLGIEAKQPNSAIRKCVRVQLIKNGKKIAAFVPRDGCLNFVDENDEVLIAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+GV+L ALF+EKKEKPRS
Sbjct  107  KGHAVGDIPGVRFKVVKVAGVALSALFREKKEKPRS  142



>gb|ERE81671.1| 40S ribosomal protein S23-like protein [Cricetulus griseus]
Length=151

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  56   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  115

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  116  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  151



>ref|XP_007079849.1| PREDICTED: 40S ribosomal protein S23 [Panthera tigris altaica]
Length=215

 Score =   178 bits (451),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  120  KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  179

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  180  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  215



>gb|ELR50552.1| 40S ribosomal protein S23, partial [Bos mutus]
Length=143

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>gb|ABV22462.1| ribosomal protein S23e [Oxyrrhis marina]
Length=143

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIV+EKIGIEAKQPNSAIRKC RVQLIKNGKKIAAFVPNDGCLN+I+ENDE LIAGFGR
Sbjct  48   KGIVVEKIGIEAKQPNSAIRKCVRVQLIKNGKKIAAFVPNDGCLNFIDENDECLIAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKV+G +LLAL+KEKKEKPR+
Sbjct  108  RGHAVGDIPGVRFKVVKVAGCALLALYKEKKEKPRT  143



>emb|CAG10754.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=142

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  47   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  106

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  107  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  142



>ref|XP_006124430.1| PREDICTED: 40S ribosomal protein S23-like, partial [Pelodiscus 
sinensis]
Length=147

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  52   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  111

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  112  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  147



>gb|KDN41434.1| putative 40S ribosomal protein S23 [Tilletiaria anomala UBC 951]
Length=143

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKK+AAFVPNDGCLN+++ENDEVLI+GFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVAAFVPNDGCLNFVDENDEVLISGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG A GDIPGVRFKVVKVSGV LLALFKEKKEKPRS
Sbjct  108  KGKAKGDIPGVRFKVVKVSGVGLLALFKEKKEKPRS  143



>ref|XP_003981174.2| PREDICTED: 40S ribosomal protein S23 [Felis catus]
Length=215

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  120  KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  179

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  180  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  215



>ref|XP_011275840.1| 30S ribosomal protein S12P [Wickerhamomyces ciferrii]
 emb|CCH42299.1| 30S ribosomal protein S12P [Wickerhamomyces ciferrii]
Length=145

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIE+KQPNSAIRKC RVQLIKNGK++ AFVPNDGCLNY++ENDEVL+AGFGR
Sbjct  50   KGIVLEKIGIESKQPNSAIRKCVRVQLIKNGKRVTAFVPNDGCLNYVDENDEVLLAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG A GDIPGVRFKVVKVSGVSLLAL+KEKKEKPRS
Sbjct  110  KGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS  145



>ref|NP_610939.2| ribosomal protein S23, isoform A [Drosophila melanogaster]
 ref|NP_001286410.1| ribosomal protein S23, isoform B [Drosophila melanogaster]
 ref|XP_001361764.1| GA21060 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_001959478.1| GF12897 [Drosophila ananassae]
 ref|XP_001975664.1| GG22436 [Drosophila erecta]
 ref|XP_001987305.1| GH20043 [Drosophila grimshawi]
 ref|XP_002005403.1| GI20452 [Drosophila mojavensis]
 ref|XP_002017629.1| GL17287 [Drosophila persimilis]
 ref|XP_002033811.1| GM20223 [Drosophila sechellia]
 ref|XP_002050700.1| GJ22302 [Drosophila virilis]
 ref|XP_002063110.1| GK21747 [Drosophila willistoni]
 ref|XP_002091277.1| GE12328 [Drosophila yakuba]
 ref|XP_002081467.1| GD25696 [Drosophila simulans]
 ref|XP_004526424.1| PREDICTED: 40S ribosomal protein S23-like [Ceratitis capitata]
 ref|XP_005177095.1| PREDICTED: 40S ribosomal protein S23 [Musca domestica]
 ref|XP_011190839.1| PREDICTED: 40S ribosomal protein S23 [Bactrocera cucurbitae]
 ref|XP_011202136.1| PREDICTED: 40S ribosomal protein S23 [Bactrocera dorsalis]
 sp|Q8T3U2.1|RS23_DROME RecName: Full=40S ribosomal protein S23 [Drosophila melanogaster]
 pdb|3J38|X Chain X, Structure Of The D. Melanogaster 40s Ribosomal Proteins
 gb|AAL90261.1| GM14585p [Drosophila melanogaster]
 gb|AAF58277.2| ribosomal protein S23, isoform A [Drosophila melanogaster]
 gb|EAL26343.1| GA21060 [Drosophila pseudoobscura pseudoobscura]
 gb|EDV36300.1| GF12897 [Drosophila ananassae]
 gb|EDV56064.1| GG22436 [Drosophila erecta]
 gb|EDW02172.1| GH20043 [Drosophila grimshawi]
 gb|EDW09338.1| GI20452 [Drosophila mojavensis]
 gb|EDW35468.1| GL17287 [Drosophila persimilis]
 gb|EDW47824.1| GM20223 [Drosophila sechellia]
 gb|EDW61893.1| GJ22302 [Drosophila virilis]
 gb|EDW74096.1| GK21747 [Drosophila willistoni]
 gb|EDW90989.1| GE12328 [Drosophila yakuba]
 gb|EDX07052.1| GD25696 [Drosophila simulans]
 gb|ACL84824.1| RpS23-PA, partial [synthetic construct]
 gb|ACL89763.1| RpS23-PA [synthetic construct]
 gb|AHN56208.1| ribosomal protein S23, isoform B [Drosophila melanogaster]
Length=143

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DG LNYIEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



>gb|AAR09841.1| similar to Drosophila melanogaster CG8415, partial [Drosophila 
yakuba]
Length=141

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DG LNYIEENDEVL+AGFGR
Sbjct  46   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVLVAGFGR  105

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  106  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  141



>ref|XP_010017251.1| PREDICTED: 40S ribosomal protein S23, partial [Nestor notabilis]
Length=151

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  56   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  115

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  116  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  151



>ref|XP_004206145.1| PREDICTED: 40S ribosomal protein S23-like isoform 1 [Hydra vulgaris]
 ref|XP_004206146.1| PREDICTED: 40S ribosomal protein S23-like isoform 2 [Hydra vulgaris]
Length=143

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL++GFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVSGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLALFK KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVASVSLLALFKGKKERPRS  143



>gb|EFB25891.1| hypothetical protein PANDA_004337 [Ailuropoda melanoleuca]
Length=173

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  78   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  137

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  138  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  173



>emb|CCK68433.1| hypothetical protein KNAG_0A07810 [Kazachstania naganishii CBS 
8797]
 emb|CCK68536.1| hypothetical protein KNAG_0B00890 [Kazachstania naganishii CBS 
8797]
Length=145

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+GIE+KQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLNY++ENDEVL+AGFGR
Sbjct  50   KGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNYVDENDEVLLAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG A GDIPGVRFKVVKVSGVSLLAL+KEKKEKPRS
Sbjct  110  KGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS  145



>ref|XP_008921333.1| PREDICTED: 40S ribosomal protein S23 [Manacus vitellinus]
Length=187

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  92   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  151

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  152  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  187



>emb|CBJ31696.1| Ribosomal protein S23, component of cytosolic 80S ribosome and 
40S small subunit [Ectocarpus siliculosus]
Length=206

 Score =   177 bits (449),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEKIGIEAKQPNSAIRKC RVQLIKNGKK+AAFVP DGCLN+ +ENDEVLI+GFGR
Sbjct  111  KGIVLEKIGIEAKQPNSAIRKCVRVQLIKNGKKLAAFVPRDGCLNFTDENDEVLISGFGR  170

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            +GHAVGDIPGVRFKVVKV+GV+LLAL+K+KKEKPRS
Sbjct  171  RGHAVGDIPGVRFKVVKVAGVALLALYKDKKEKPRS  206



>gb|KFW80273.1| 40S ribosomal protein S23, partial [Manacus vitellinus]
Length=144

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  49   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  108

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  109  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  144



>emb|CDQ67278.1| unnamed protein product [Oncorhynchus mykiss]
Length=166

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  71   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  130

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  131  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  166



>ref|XP_010279816.1| PREDICTED: 40S ribosomal protein S23-like, partial [Phaethon 
lepturus]
Length=155

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  60   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  119

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  120  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  155



>ref|XP_006990559.1| PREDICTED: 40S ribosomal protein S23-like [Peromyscus maniculatus 
bairdii]
Length=143

 Score =   175 bits (443),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKK  AF+PNDGCLN+IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKTTAFMPNDGCLNFIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKAKKERPRS  143



>ref|XP_002140715.1| 40S ribosomal protein S23 [Cryptosporidium muris RN66]
 gb|EEA06366.1| 40S ribosomal protein S23, putative [Cryptosporidium muris RN66]
Length=145

 Score =   175 bits (443),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIV+E+ GIEAKQPNSA+RKC RVQLIKNGKKI AFVP DGCLN+I+ENDEVL+AGFGR
Sbjct  50   KGIVVERFGIEAKQPNSAVRKCVRVQLIKNGKKITAFVPRDGCLNFIDENDEVLVAGFGR  109

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGH+VGDIPGVRFK VKVSGVSLLALFKEKKEKPRS
Sbjct  110  KGHSVGDIPGVRFKAVKVSGVSLLALFKEKKEKPRS  145



>gb|ETE65751.1| 40S ribosomal protein S23, partial [Ophiophagus hannah]
Length=154

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  59   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  118

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  119  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  154



>ref|XP_005236257.1| PREDICTED: 40S ribosomal protein S23 [Falco peregrinus]
 ref|XP_005444599.1| PREDICTED: 40S ribosomal protein S23 [Falco cherrug]
Length=208

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  113  KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  172

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  173  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  208



>ref|XP_005513905.1| PREDICTED: 40S ribosomal protein S23 [Columba livia]
Length=189

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  94   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  153

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  154  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  189



>gb|EPY79012.1| ribosomal protein S28ue-like protein [Camelus ferus]
Length=186

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  91   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  150

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  151  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  186



>ref|XP_008629242.1| PREDICTED: 40S ribosomal protein S23 [Corvus brachyrhynchos]
Length=185

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  90   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  149

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  150  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  185



>gb|KID82622.1| Ribosomal protein S12/S23 [Metarhizium guizhouense ARSEF 977]
 gb|KID89320.1| Ribosomal protein S12/S23, partial [Metarhizium majus ARSEF 297]
 gb|KID95083.1| Ribosomal protein S12/S23, partial [Metarhizium majus ARSEF 297]
Length=144

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVPNDGCLN+I+ENDEVL+AGFGR
Sbjct  49   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFIDENDEVLLAGFGR  108

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KG A+GDIPGVRFK+VKVSGVSLL+L++EKKEKPRS
Sbjct  109  KGRAIGDIPGVRFKIVKVSGVSLLSLWREKKEKPRS  144



>ref|XP_009909001.1| PREDICTED: 40S ribosomal protein S23 [Picoides pubescens]
Length=157

 Score =   175 bits (444),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  62   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  121

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  122  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  157



>gb|ACN10021.1| 40S ribosomal protein S23 [Salmo salar]
 gb|ACN12368.1| 40S ribosomal protein S23 [Salmo salar]
Length=200

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  105  KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  164

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  165  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  200



>gb|ABJ98616.1| 40S ribosomal protein S23, partial [Scophthalmus maximus]
Length=143

 Score =   174 bits (442),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN++EENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFLEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  143



>ref|XP_006124396.1| PREDICTED: 40S ribosomal protein S23-like [Pelodiscus sinensis]
Length=202

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGR
Sbjct  107  KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGR  166

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+K KKE+PRS
Sbjct  167  KGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS  202



>ref|XP_011336175.1| PREDICTED: 40S ribosomal protein S23-like [Cerapachys biroi]
 gb|EZA55933.1| 40S ribosomal protein S23 [Cerapachys biroi]
Length=143

 Score =   174 bits (442),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  462  KGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGR  283
            KGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLN IEENDEVL+AGFGR
Sbjct  48   KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNNIEENDEVLVAGFGR  107

Query  282  KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS  175
            KGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct  108  KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561614547535