BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF046B21

Length=456
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO80164.1|  hypothetical protein CISIN_1g005652mg                   134   7e-34   Citrus sinensis [apfelsine]
gb|KDO80159.1|  hypothetical protein CISIN_1g005652mg                   134   9e-34   Citrus sinensis [apfelsine]
gb|KDO80158.1|  hypothetical protein CISIN_1g005652mg                   134   1e-33   Citrus sinensis [apfelsine]
ref|XP_006450870.1|  hypothetical protein CICLE_v10007683mg             134   2e-33   Citrus clementina [clementine]
ref|XP_006475896.1|  PREDICTED: TBC1 domain family member 17-like       134   2e-33   Citrus sinensis [apfelsine]
gb|KDO80156.1|  hypothetical protein CISIN_1g005652mg                   134   2e-33   Citrus sinensis [apfelsine]
emb|CDP10442.1|  unnamed protein product                                134   2e-33   Coffea canephora [robusta coffee]
ref|XP_011017820.1|  PREDICTED: TBC1 domain family member 17-like...    132   8e-33   Populus euphratica
ref|XP_004508468.1|  PREDICTED: TBC1 domain family member 17-like...    132   8e-33   Cicer arietinum [garbanzo]
ref|XP_011017816.1|  PREDICTED: TBC1 domain family member 15-like...    132   1e-32   Populus euphratica
ref|XP_011017818.1|  PREDICTED: TBC1 domain family member 15-like...    132   1e-32   Populus euphratica
gb|KDO80165.1|  hypothetical protein CISIN_1g005652mg                   129   1e-32   Citrus sinensis [apfelsine]
gb|ABK92630.1|  unknown                                                 122   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002324638.2|  hypothetical protein POPTR_0018s12770g             131   2e-32   
ref|XP_006280129.1|  hypothetical protein CARUB_v10026023mg             131   2e-32   Capsella rubella
ref|XP_006372159.1|  hypothetical protein POPTR_0018s12770g             130   2e-32   
ref|XP_010557604.1|  PREDICTED: TBC1 domain family member 15            130   4e-32   Tarenaya hassleriana [spider flower]
ref|XP_007155039.1|  hypothetical protein PHAVU_003G167800g             130   4e-32   Phaseolus vulgaris [French bean]
ref|XP_009363991.1|  PREDICTED: TBC1 domain family member 15            130   4e-32   Pyrus x bretschneideri [bai li]
ref|XP_003542634.1|  PREDICTED: TBC1 domain family member 15-like       130   5e-32   Glycine max [soybeans]
gb|KHN22122.1|  TBC1 domain family member 15                            130   5e-32   Glycine soja [wild soybean]
ref|XP_003549744.1|  PREDICTED: TBC1 domain family member 15-like       129   7e-32   
ref|XP_008362894.1|  PREDICTED: TBC1 domain family member 17-like       129   8e-32   
ref|XP_010482626.1|  PREDICTED: TBC1 domain family member 15-like...    129   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010442797.1|  PREDICTED: TBC1 domain family member 15-like       129   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010445069.1|  PREDICTED: TBC1 domain family member 15-like...    129   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010482625.1|  PREDICTED: TBC1 domain family member 15-like...    129   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010445073.1|  PREDICTED: TBC1 domain family member 15-like...    129   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_007013521.1|  RabGAP/TBC domain-containing protein isoform 2     129   2e-31   
ref|XP_002864184.1|  hypothetical protein ARALYDRAFT_495330             129   2e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_010482627.1|  PREDICTED: TBC1 domain family member 15-like...    128   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_007013520.1|  RabGAP/TBC domain-containing protein isoform 1     129   2e-31   
ref|XP_006401805.1|  hypothetical protein EUTSA_v10012867mg             128   3e-31   Eutrema salsugineum [saltwater cress]
ref|XP_006401806.1|  hypothetical protein EUTSA_v10012867mg             128   3e-31   
ref|XP_011020167.1|  PREDICTED: TBC1 domain family member 15            128   3e-31   Populus euphratica
ref|XP_010112474.1|  TBC1 domain family member 15                       126   3e-31   
gb|KCW80045.1|  hypothetical protein EUGRSUZ_C01375                     126   3e-31   Eucalyptus grandis [rose gum]
ref|XP_002285365.1|  PREDICTED: TBC1 domain family member 17 isof...    127   3e-31   Vitis vinifera
ref|XP_010656458.1|  PREDICTED: GTPase-activating protein GYP7 is...    128   4e-31   Vitis vinifera
ref|XP_010656459.1|  PREDICTED: TBC1 domain family member 17 isof...    127   4e-31   Vitis vinifera
gb|EYU18249.1|  hypothetical protein MIMGU_mgv1a002604mg                127   6e-31   Erythranthe guttata [common monkey flower]
gb|AIU48673.1|  RabGAP/TBC domain-containing protein                    127   6e-31   Phaseolus vulgaris [French bean]
gb|AIU48656.1|  RabGAP/TBC domain-containing protein                    127   6e-31   Glycine max [soybeans]
ref|XP_010047970.1|  PREDICTED: TBC1 domain family member 15            127   6e-31   Eucalyptus grandis [rose gum]
gb|KJB27077.1|  hypothetical protein B456_004G276400                    127   7e-31   Gossypium raimondii
gb|KJB27078.1|  hypothetical protein B456_004G276400                    127   8e-31   Gossypium raimondii
gb|KHG01737.1|  TBC1 domain family member 15                            127   8e-31   Gossypium arboreum [tree cotton]
gb|KJB27079.1|  hypothetical protein B456_004G276400                    127   9e-31   Gossypium raimondii
gb|KJB54007.1|  hypothetical protein B456_009G016100                    126   1e-30   Gossypium raimondii
gb|KJB64719.1|  hypothetical protein B456_010G061900                    126   1e-30   Gossypium raimondii
ref|XP_010911930.1|  PREDICTED: TBC1 domain family member 17 isof...    125   1e-30   Elaeis guineensis
ref|XP_006358298.1|  PREDICTED: GTPase-activating protein gyp7-like     126   1e-30   Solanum tuberosum [potatoes]
ref|XP_007204093.1|  hypothetical protein PRUPE_ppa002904mg             125   1e-30   
ref|XP_006381119.1|  hypothetical protein POPTR_0006s06520g             122   1e-30   
emb|CDY65323.1|  BnaC02g44880D                                          126   2e-30   Brassica napus [oilseed rape]
ref|XP_003609386.1|  TBC1 domain family member                          125   2e-30   Medicago truncatula
ref|XP_008242808.1|  PREDICTED: TBC1 domain family member 17            125   2e-30   Prunus mume [ume]
emb|CDY27056.1|  BnaA02g10760D                                          125   2e-30   Brassica napus [oilseed rape]
ref|XP_004251725.1|  PREDICTED: TBC1 domain family member 17-like       125   2e-30   Solanum lycopersicum
ref|XP_010911929.1|  PREDICTED: TBC1 domain family member 15 isof...    125   3e-30   Elaeis guineensis
ref|XP_002527173.1|  conserved hypothetical protein                     125   3e-30   
ref|XP_008785780.1|  PREDICTED: TBC1 domain family member 15            125   3e-30   Phoenix dactylifera
ref|XP_006345222.1|  PREDICTED: TBC1 domain family member 15-like       125   4e-30   Solanum tuberosum [potatoes]
ref|XP_010323291.1|  PREDICTED: GTPase-activating protein gyp7          125   4e-30   Solanum lycopersicum
ref|XP_009127224.1|  PREDICTED: TBC1 domain family member 15            124   6e-30   Brassica rapa
ref|XP_009624893.1|  PREDICTED: TBC1 domain family member 15-like       124   8e-30   Nicotiana tomentosiformis
ref|XP_009758337.1|  PREDICTED: TBC1 domain family member 15-like       124   8e-30   Nicotiana sylvestris
ref|XP_004173869.1|  PREDICTED: TBC1 domain family member 15-like       117   9e-30   
ref|NP_200071.2|  RabGAP/TBC domain-containing protein                  124   9e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190524.1|  RabGAP/TBC domain-containing protein               124   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AIU48668.1|  RabGAP/TBC domain-containing protein                    123   1e-29   Manihot esculenta [manioc]
ref|XP_011084120.1|  PREDICTED: TBC1 domain family member 15            123   1e-29   Sesamum indicum [beniseed]
gb|KFK26862.1|  hypothetical protein AALP_AA8G303600                    123   1e-29   Arabis alpina [alpine rockcress]
ref|XP_008377303.1|  PREDICTED: TBC1 domain family member 17            123   2e-29   
ref|XP_004139297.1|  PREDICTED: TBC1 domain family member 15-like       123   2e-29   Cucumis sativus [cucumbers]
gb|AIU48653.1|  RabGAP/TBC domain-containing protein                    122   2e-29   Capsella rubella
ref|XP_010241554.1|  PREDICTED: TBC1 domain family member 17 isof...    122   3e-29   Nelumbo nucifera [Indian lotus]
ref|XP_009789610.1|  PREDICTED: TBC1 domain family member 15-like...    121   3e-29   Nicotiana sylvestris
ref|XP_010241556.1|  PREDICTED: TBC1 domain family member 15 isof...    122   3e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010241555.1|  PREDICTED: TBC1 domain family member 17 isof...    122   3e-29   Nelumbo nucifera [Indian lotus]
ref|XP_009789609.1|  PREDICTED: TBC1 domain family member 17-like...    122   3e-29   Nicotiana sylvestris
ref|XP_008456989.1|  PREDICTED: TBC1 domain family member 15            122   4e-29   Cucumis melo [Oriental melon]
gb|AIU48681.1|  RabGAP/TBC domain-containing protein                    122   4e-29   Vitis vinifera
ref|XP_010656460.1|  PREDICTED: GTPase-activating protein GYP7-like     113   4e-29   Vitis vinifera
ref|XP_009789608.1|  PREDICTED: TBC1 domain family member 17-like...    122   5e-29   Nicotiana sylvestris
gb|AIU48640.1|  RabGAP/TBC domain-containing protein                    121   5e-29   Arabidopsis lyrata [lyrate rockcress]
emb|CAN75817.1|  hypothetical protein VITISV_033040                     113   5e-29   Vitis vinifera
gb|AIU48650.1|  RabGAP/TBC domain-containing protein                    121   5e-29   Citrus clementina [clementine]
gb|AIU48652.1|  RabGAP/TBC domain-containing protein                    121   5e-29   Carica papaya [mamon]
gb|AIU48654.1|  RabGAP/TBC domain-containing protein                    121   5e-29   Citrus sinensis [apfelsine]
gb|AIU48658.1|  RabGAP/TBC domain-containing protein                    121   6e-29   Buxus sinica
gb|AIU48670.1|  RabGAP/TBC domain-containing protein                    121   6e-29   Populus trichocarpa [western balsam poplar]
gb|AIU48675.1|  RabGAP/TBC domain-containing protein                    121   7e-29   Ricinus communis
dbj|BAA98077.1|  unnamed protein product                                118   8e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AIU48671.1|  RabGAP/TBC domain-containing protein                    120   9e-29   Prunus persica
gb|AIU48680.1|  RabGAP/TBC domain-containing protein                    120   9e-29   Schrenkiella parvula
ref|XP_010687933.1|  PREDICTED: TBC1 domain family member 15 isof...    120   9e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004287286.1|  PREDICTED: TBC1 domain family member 15            121   1e-28   Fragaria vesca subsp. vesca
ref|XP_010687932.1|  PREDICTED: TBC1 domain family member 15 isof...    120   1e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|AIU48647.1|  RabGAP/TBC domain-containing protein                    120   1e-28   Theobroma cacao [chocolate]
emb|CBI28233.3|  unnamed protein product                                114   1e-28   Vitis vinifera
gb|AIU48684.1|  RabGAP/TBC domain-containing protein                    119   2e-28   Cinnamomum camphora
gb|AIU48645.1|  RabGAP/TBC domain-containing protein                    120   2e-28   Pinellia ternata
ref|XP_009593350.1|  PREDICTED: TBC1 domain family member 17 isof...    120   2e-28   Nicotiana tomentosiformis
ref|XP_009593351.1|  PREDICTED: TBC1 domain family member 15 isof...    119   2e-28   
gb|AIU48648.1|  RabGAP/TBC domain-containing protein                    119   2e-28   Acorus calamus [flagroot]
ref|XP_009593349.1|  PREDICTED: TBC1 domain family member 17 isof...    120   3e-28   Nicotiana tomentosiformis
gb|AIU48662.1|  RabGAP/TBC domain-containing protein                    119   4e-28   Chimonanthus praecox [wintersweet]
gb|AIU48669.1|  RabGAP/TBC domain-containing protein                    118   7e-28   Erythranthe guttata [common monkey flower]
gb|AIU48666.1|  RabGAP/TBC domain-containing protein                    118   9e-28   Medicago truncatula
gb|AIU48639.1|  RabGAP/TBC domain-containing protein                    118   1e-27   Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU48655.1|  RabGAP/TBC domain-containing protein                    118   1e-27   Eucalyptus grandis [rose gum]
gb|AIU48667.1|  RabGAP/TBC domain-containing protein                    117   2e-27   Canna indica [canna]
ref|XP_009420718.1|  PREDICTED: TBC1 domain family member 15            117   3e-27   
gb|AIU48641.1|  RabGAP/TBC domain-containing protein                    116   3e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AIU48690.1|  RabGAP/TBC domain-containing protein                    116   4e-27   Trachycarpus fortunei
gb|AIU48665.1|  RabGAP/TBC domain-containing protein                    115   6e-27   Aristolochia tagala
gb|AIU48643.1|  RabGAP/TBC domain-containing protein                    115   1e-26   Magnolia denudata [haku-mokuren]
gb|AIU48689.1|  RabGAP/TBC domain-containing protein                    114   2e-26   Alisma plantago-aquatica
ref|XP_011469988.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    114   2e-26   Fragaria vesca subsp. vesca
gb|AIU48691.1|  RabGAP/TBC domain-containing protein                    112   2e-26   Cabomba caroliniana
gb|AIU48687.1|  RabGAP/TBC domain-containing protein                    114   3e-26   Houttuynia cordata [chameleon-plant]
gb|AIU48664.1|  RabGAP/TBC domain-containing protein                    114   3e-26   Asparagus officinalis
gb|AIU48677.1|  RabGAP/TBC domain-containing protein                    114   3e-26   Yucca filamentosa [Adam's-needle]
gb|AIU48683.1|  RabGAP/TBC domain-containing protein                    113   4e-26   Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU48661.1|  RabGAP/TBC domain-containing protein                    113   4e-26   Ceratophyllum demersum [hornwort]
gb|AIU48660.1|  RabGAP/TBC domain-containing protein                    113   4e-26   Chloranthus japonicus
gb|AIU48676.1|  RabGAP/TBC domain-containing protein                    113   5e-26   Dioscorea oppositifolia
gb|AIU48657.1|  RabGAP/TBC domain-containing protein                    112   1e-25   Illicium henryi
gb|AIU48686.1|  RabGAP/TBC domain-containing protein                    111   2e-25   Ginkgo biloba [ginkgo]
gb|AIU48644.1|  RabGAP/TBC domain-containing protein                    108   2e-25   Musa acuminata [banana]
gb|AIU48651.1|  RabGAP/TBC domain-containing protein                    111   2e-25   Gossypium raimondii
gb|AIU48649.1|  RabGAP/TBC domain-containing protein                    108   2e-25   Sarcandra glabra
ref|XP_006647781.1|  PREDICTED: TBC1 domain family member 15-like       110   4e-25   Oryza brachyantha
ref|XP_001783529.1|  predicted protein                                  109   5e-25   
gb|EPS74110.1|  hypothetical protein M569_00644                         105   6e-25   Genlisea aurea
gb|AIU48682.1|  RabGAP/TBC domain-containing protein                    107   7e-25   Lactuca sativa [cultivated lettuce]
gb|AIU48672.1|  RabGAP/TBC domain-containing protein                    110   8e-25   Panicum virgatum
gb|AIU48678.1|  RabGAP/TBC domain-containing protein                    109   1e-24   Setaria italica
ref|XP_004953647.1|  PREDICTED: TBC1 domain family member 15-like       109   1e-24   Setaria italica
gb|AIU48642.1|  RabGAP/TBC domain-containing protein                    108   2e-24   Lilium brownii [Hong Kong lily]
gb|AIU48679.1|  RabGAP/TBC domain-containing protein                    108   2e-24   Sorghum bicolor [broomcorn]
gb|AIU48646.1|  RabGAP/TBC domain-containing protein                    107   5e-24   Brachypodium distachyon [annual false brome]
ref|XP_003570212.1|  PREDICTED: TBC1 domain family member 15            107   6e-24   Brachypodium distachyon [annual false brome]
ref|NP_001047892.1|  Os02g0709800                                       107   1e-23   
ref|XP_002452666.1|  hypothetical protein SORBIDRAFT_04g030250          107   1e-23   
gb|AIU48688.1|  RabGAP/TBC domain-containing protein                    104   1e-23   Zea mays [maize]
ref|NP_001168835.1|  uncharacterized protein LOC100382640               106   2e-23   Zea mays [maize]
ref|XP_006855176.1|  hypothetical protein AMTR_s00051p00106780          106   2e-23   Amborella trichopoda
gb|EMT03185.1|  TBC1 domain family member 15                            103   1e-22   
gb|AIU48659.1|  RabGAP/TBC domain-containing protein                    102   4e-22   Iris japonica
dbj|BAK05291.1|  predicted protein                                      102   5e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP30256.1|  hypothetical protein JCGZ_17038                       98.2    1e-20   Jatropha curcas
gb|EMS58117.1|  TBC1 domain family member 15                          97.1    3e-20   Triticum urartu
ref|XP_002972350.1|  hypothetical protein SELMODRAFT_97576            86.3    3e-17   
ref|XP_002971826.1|  hypothetical protein SELMODRAFT_96534            86.3    3e-17   
gb|EEC73873.1|  hypothetical protein OsI_08649                        62.4    2e-08   Oryza sativa Indica Group [Indian rice]



>gb|KDO80164.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=496

 Score =   134 bits (336),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  418  AILKRYRNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTP  477

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLPI N LL+SQ++D+V+
Sbjct  478  PSLPIDNGLLYSQQEDEVL  496



>gb|KDO80159.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=630

 Score =   134 bits (338),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  552  AILKRYRNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTP  611

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLPI N LL+SQ++D+V+
Sbjct  612  PSLPIDNGLLYSQQEDEVL  630



>gb|KDO80158.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=638

 Score =   134 bits (338),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  560  AILKRYRNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTP  619

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLPI N LL+SQ++D+V+
Sbjct  620  PSLPIDNGLLYSQQEDEVL  638



>ref|XP_006450870.1| hypothetical protein CICLE_v10007683mg [Citrus clementina]
 gb|ESR64110.1| hypothetical protein CICLE_v10007683mg [Citrus clementina]
Length=658

 Score =   134 bits (337),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  580  AILKRYRNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTP  639

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLPI N LL+SQ++D+V+
Sbjct  640  PSLPIDNGLLYSQQEDEVL  658



>ref|XP_006475896.1| PREDICTED: TBC1 domain family member 17-like [Citrus sinensis]
 gb|KDO80157.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=658

 Score =   134 bits (337),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  580  AILKRYRNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTP  639

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLPI N LL+SQ++D+V+
Sbjct  640  PSLPIDNGLLYSQQEDEVL  658



>gb|KDO80156.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=685

 Score =   134 bits (337),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  607  AILKRYRNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTP  666

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLPI N LL+SQ++D+V+
Sbjct  667  PSLPIDNGLLYSQQEDEVL  685



>emb|CDP10442.1| unnamed protein product [Coffea canephora]
Length=692

 Score =   134 bits (336),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/79 (75%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYRSKI+GE+MDFDTLL+FINEL GHIDL+  LRDAEALCLCAGE GAA IPPGTP
Sbjct  614  AILKRYRSKIMGEQMDFDTLLKFINELSGHIDLDAILRDAEALCLCAGENGAACIPPGTP  673

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLP++   ++ Q+DDD++
Sbjct  674  PSLPVEEASMYPQQDDDIL  692



>ref|XP_011017820.1| PREDICTED: TBC1 domain family member 17-like isoform X3 [Populus 
euphratica]
Length=637

 Score =   132 bits (332),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE MDFDTLL+FINEL GHIDL++ LRDAEALCLCAGE GAA IPPGTP
Sbjct  557  AILKRYRNKIMGEHMDFDTLLKFINELSGHIDLDSILRDAEALCLCAGENGAACIPPGTP  616

Query  275  PSLPI--QNLLLFSQEDDDVM  219
            PSLP   +N LL++QE+D+V+
Sbjct  617  PSLPTENENALLYTQEEDEVL  637



>ref|XP_004508468.1| PREDICTED: TBC1 domain family member 17-like isoform X1 [Cicer 
arietinum]
Length=705

 Score =   132 bits (333),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKR+RSKI+GE+MDFD+LL+FINEL GHIDL+ TLRDAEALC+CAGE GAARIPPGTP
Sbjct  627  AVLKRFRSKIMGEEMDFDSLLKFINELSGHIDLDATLRDAEALCICAGEEGAARIPPGTP  686

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLP+ +   + Q+DD+V+
Sbjct  687  PSLPVDDGSFYIQQDDEVL  705



>ref|XP_011017816.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
 ref|XP_011017817.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
Length=676

 Score =   132 bits (332),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE MDFDTLL+FINEL GHIDL++ LRDAEALCLCAGE GAA IPPGTP
Sbjct  596  AILKRYRNKIMGEHMDFDTLLKFINELSGHIDLDSILRDAEALCLCAGENGAACIPPGTP  655

Query  275  PSLPI--QNLLLFSQEDDDVM  219
            PSLP   +N LL++QE+D+V+
Sbjct  656  PSLPTENENALLYTQEEDEVL  676



>ref|XP_011017818.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Populus 
euphratica]
Length=661

 Score =   132 bits (331),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE MDFDTLL+FINEL GHIDL++ LRDAEALCLCAGE GAA IPPGTP
Sbjct  581  AILKRYRNKIMGEHMDFDTLLKFINELSGHIDLDSILRDAEALCLCAGENGAACIPPGTP  640

Query  275  PSLPI--QNLLLFSQEDDDVM  219
            PSLP   +N LL++QE+D+V+
Sbjct  641  PSLPTENENALLYTQEEDEVL  661



>gb|KDO80165.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=356

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  278  AILKRYRNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTP  337

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLPI N LL+SQ++D+V+
Sbjct  338  PSLPIDNGLLYSQQEDEVL  356



>gb|ABK92630.1| unknown [Populus trichocarpa]
Length=102

 Score =   122 bits (306),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+GE MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  23   AILKRYRKKIMGEHMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAAHIPPGTP  82

Query  275  PSLPI--QNLLLFSQEDD  228
            PSLP   +N LL++Q+D+
Sbjct  83   PSLPTENENALLYAQDDE  100



>ref|XP_002324638.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
 gb|EEF03203.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
Length=661

 Score =   131 bits (329),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE MDFDTLL+F NEL GHIDL++ LRDAEALC+CAGE GAA IPPGTP
Sbjct  581  AILKRYRNKIMGEHMDFDTLLKFTNELSGHIDLDSVLRDAEALCICAGENGAACIPPGTP  640

Query  275  PSLPI--QNLLLFSQEDDDVM  219
            PSLPI  +N LL++QE+D+V+
Sbjct  641  PSLPIENENALLYTQEEDEVL  661



>ref|XP_006280129.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
 gb|EOA13027.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
Length=672

 Score =   131 bits (329),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RSKI+GE+MDFDTLL+FINEL GHIDLE+T+RDAEALC+CAGE GAA IPPGTP
Sbjct  595  AILKRCRSKIMGEQMDFDTLLKFINELSGHIDLESTVRDAEALCICAGENGAASIPPGTP  654

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ +++L+  EDD
Sbjct  655  PSLPLDDIMLYPLEDD  670



>ref|XP_006372159.1| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
 gb|ERP49956.1| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
Length=630

 Score =   130 bits (328),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE MDFDTLL+F NEL GHIDL++ LRDAEALC+CAGE GAA IPPGTP
Sbjct  550  AILKRYRNKIMGEHMDFDTLLKFTNELSGHIDLDSVLRDAEALCICAGENGAACIPPGTP  609

Query  275  PSLPI--QNLLLFSQEDDDVM  219
            PSLPI  +N LL++QE+D+V+
Sbjct  610  PSLPIENENALLYTQEEDEVL  630



>ref|XP_010557604.1| PREDICTED: TBC1 domain family member 15 [Tarenaya hassleriana]
Length=669

 Score =   130 bits (327),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KIIGE+MDFDTLL+FINEL GHIDL++ LRDAEALC+CAGE GAA IPPGTP
Sbjct  592  AILKRYRRKIIGEQMDFDTLLKFINELSGHIDLDSVLRDAEALCICAGENGAASIPPGTP  651

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ + +L+ Q+D+
Sbjct  652  PSLPVDDGMLYPQQDE  667



>ref|XP_007155039.1| hypothetical protein PHAVU_003G167800g [Phaseolus vulgaris]
 gb|ESW27033.1| hypothetical protein PHAVU_003G167800g [Phaseolus vulgaris]
Length=652

 Score =   130 bits (327),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+GE MDFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAARIPPGTP
Sbjct  575  AILKRYRGKIVGEGMDFDTLLKFINELSGHIDLDATLRDAEALCICAGENGAARIPPGTP  634

Query  275  PSLPIQNLLLFSQEDD  228
            PSLPI +  +++Q+D+
Sbjct  635  PSLPIDDGSVYAQQDE  650



>ref|XP_009363991.1| PREDICTED: TBC1 domain family member 15 [Pyrus x bretschneideri]
Length=658

 Score =   130 bits (327),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+RSKIIGE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTP
Sbjct  579  AILKRHRSKIIGEQMDFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAASIPPGTP  638

Query  275  PSLPIQNLLLFSQED-DDVM  219
            PSLP+ ++LL+ Q++ DD++
Sbjct  639  PSLPVDDVLLYPQQELDDIL  658



>ref|XP_003542634.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
Length=656

 Score =   130 bits (326),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KIIGE+MDFDTLL+FINEL GHI+L+ TLRDAEALC+CAGE GAARIPPGTP
Sbjct  577  AILKRYRGKIIGEEMDFDTLLKFINELSGHINLDATLRDAEALCICAGENGAARIPPGTP  636

Query  275  PSLPIQNLLLFSQEDDD  225
            PSLP+++   ++Q++ D
Sbjct  637  PSLPVEDGSFYAQQEQD  653



>gb|KHN22122.1| TBC1 domain family member 15 [Glycine soja]
Length=656

 Score =   130 bits (326),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KIIGE+MDFDTLL+FINEL GHI+L+ TLRDAEALC+CAGE GAARIPPGTP
Sbjct  577  AILKRYRGKIIGEEMDFDTLLKFINELSGHINLDATLRDAEALCICAGENGAARIPPGTP  636

Query  275  PSLPIQNLLLFSQEDDD  225
            PSLP+++   ++Q++ D
Sbjct  637  PSLPVEDGSFYAQQEQD  653



>ref|XP_003549744.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
 gb|KHN15067.1| TBC1 domain family member 15 [Glycine soja]
Length=655

 Score =   129 bits (325),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KIIGE+MDFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAARIPPGTP
Sbjct  576  AILKRYRGKIIGEQMDFDTLLKFINELSGHIDLDATLRDAEALCICAGENGAARIPPGTP  635

Query  275  PSLPIQNLLLFSQEDDD  225
            PSLP ++   ++Q++ D
Sbjct  636  PSLPHEDGSFYAQQEQD  652



>ref|XP_008362894.1| PREDICTED: TBC1 domain family member 17-like [Malus domestica]
Length=659

 Score =   129 bits (325),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 59/80 (74%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+RSKIIGE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTP
Sbjct  580  AILKRHRSKIIGEQMDFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAASIPPGTP  639

Query  275  PSLPIQNLLLF-SQEDDDVM  219
            PSLP+ ++LL+  QE DD++
Sbjct  640  PSLPVDDVLLYPXQELDDIL  659



>ref|XP_010482626.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score =   129 bits (323),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  595  AILKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTP  654

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+  ++L+  EDD
Sbjct  655  PSLPLDEVMLYPLEDD  670



>ref|XP_010442797.1| PREDICTED: TBC1 domain family member 15-like [Camelina sativa]
Length=672

 Score =   129 bits (323),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  595  AILKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTP  654

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+  ++L+  EDD
Sbjct  655  PSLPLDEVMLYPLEDD  670



>ref|XP_010445069.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score =   129 bits (323),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  601  AILKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTP  660

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+  ++L+  EDD
Sbjct  661  PSLPLDEVMLYPLEDD  676



>ref|XP_010482625.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score =   129 bits (323),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  601  AILKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTP  660

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+  ++L+  EDD
Sbjct  661  PSLPLDEVMLYPLEDD  676



>ref|XP_010445073.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score =   129 bits (323),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  595  AILKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTP  654

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+  ++L+  EDD
Sbjct  655  PSLPLDEVMLYPLEDD  670



>ref|XP_007013521.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY31140.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
Length=656

 Score =   129 bits (323),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKRYR KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTP
Sbjct  579  AVLKRYRGKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAACIPPGTP  638

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ N L +SQ+D+
Sbjct  639  PSLPVDNGLFYSQQDE  654



>ref|XP_002864184.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40443.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
Length=674

 Score =   129 bits (323),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  597  AVLKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTP  656

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ +  L+ QEDD
Sbjct  657  PSLPLDDGTLYPQEDD  672



>ref|XP_010482627.1| PREDICTED: TBC1 domain family member 15-like isoform X3 [Camelina 
sativa]
Length=679

 Score =   128 bits (322),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  602  AILKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTP  661

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+  ++L+  EDD
Sbjct  662  PSLPLDEVMLYPLEDD  677



>ref|XP_007013520.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY31139.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
Length=743

 Score =   129 bits (323),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKRYR KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTP
Sbjct  666  AVLKRYRGKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAACIPPGTP  725

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ N L +SQ+D+
Sbjct  726  PSLPVDNGLFYSQQDE  741



>ref|XP_006401805.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43258.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=675

 Score =   128 bits (322),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  598  AILKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTP  657

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+   +L+ Q+DD
Sbjct  658  PSLPLDEGILYPQDDD  673



>ref|XP_006401806.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43259.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=681

 Score =   128 bits (322),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  604  AILKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTP  663

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+   +L+ Q+DD
Sbjct  664  PSLPLDEGILYPQDDD  679



>ref|XP_011020167.1| PREDICTED: TBC1 domain family member 15 [Populus euphratica]
Length=660

 Score =   128 bits (321),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 59/78 (76%), Positives = 68/78 (87%), Gaps = 2/78 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+GE MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAARIPPGTP
Sbjct  581  AILKRYRKKIMGEHMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAARIPPGTP  640

Query  275  PSLPI--QNLLLFSQEDD  228
            PSLP   +N LL++Q+D+
Sbjct  641  PSLPTENENALLYAQDDE  658



>ref|XP_010112474.1| TBC1 domain family member 15 [Morus notabilis]
 gb|EXC33718.1| TBC1 domain family member 15 [Morus notabilis]
Length=517

 Score =   126 bits (317),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 60/77 (78%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR R+KII E+MDFDTLL+FINEL GHIDL++ LRDAEALC+CAGE GAA IPPGTP
Sbjct  439  AILKRQRNKIISEQMDFDTLLKFINELSGHIDLDSVLRDAEALCICAGENGAACIPPGTP  498

Query  275  PSLPI-QNLLLFSQEDD  228
            PSLPI  N LL+ QEDD
Sbjct  499  PSLPIADNGLLYPQEDD  515



>gb|KCW80045.1| hypothetical protein EUGRSUZ_C01375 [Eucalyptus grandis]
Length=527

 Score =   126 bits (317),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            +ILKRYR KI+GE+MDFDTLL+FINEL G IDL T LRDAEALC+CAGE GAA IPPGTP
Sbjct  450  SILKRYRKKIMGEQMDFDTLLKFINELSGLIDLNTILRDAEALCICAGENGAACIPPGTP  509

Query  275  PSLPIQNLLLFSQEDD  228
            PSLPI++ LL+ Q+DD
Sbjct  510  PSLPIESSLLYPQQDD  525



>ref|XP_002285365.1| PREDICTED: TBC1 domain family member 17 isoform X3 [Vitis vinifera]
Length=657

 Score =   127 bits (320),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTP
Sbjct  580  AILKRYRNKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAANIPPGTP  639

Query  275  PSLPIQNLLLFSQEDD  228
            PSLPI + LL  Q+DD
Sbjct  640  PSLPIDSGLLCPQQDD  655



>ref|XP_010656458.1| PREDICTED: GTPase-activating protein GYP7 isoform X1 [Vitis vinifera]
Length=696

 Score =   128 bits (321),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTP
Sbjct  619  AILKRYRNKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAANIPPGTP  678

Query  275  PSLPIQNLLLFSQEDD  228
            PSLPI + LL  Q+DD
Sbjct  679  PSLPIDSGLLCPQQDD  694



>ref|XP_010656459.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Vitis vinifera]
 emb|CBI28236.3| unnamed protein product [Vitis vinifera]
Length=684

 Score =   127 bits (320),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTP
Sbjct  607  AILKRYRNKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAANIPPGTP  666

Query  275  PSLPIQNLLLFSQEDD  228
            PSLPI + LL  Q+DD
Sbjct  667  PSLPIDSGLLCPQQDD  682



>gb|EYU18249.1| hypothetical protein MIMGU_mgv1a002604mg [Erythranthe guttata]
Length=655

 Score =   127 bits (319),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+ TLR+AEALC+CAGE G A IPPGTP
Sbjct  577  AILKRYRNKIMGEQMDFDTLLKFINELSGQIDLDATLREAEALCICAGENGEASIPPGTP  636

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLP+++  ++ Q DDDV+
Sbjct  637  PSLPLEDASVYPQLDDDVL  655



>gb|AIU48673.1| RabGAP/TBC domain-containing protein, partial [Phaseolus vulgaris]
Length=623

 Score =   127 bits (318),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+GE MDFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAARIPPGTP
Sbjct  552  AILKRYRGKIVGEGMDFDTLLKFINELSGHIDLDATLRDAEALCICAGENGAARIPPGTP  611

Query  275  PSLPIQNL  252
            PSLPI ++
Sbjct  612  PSLPIDSV  619



>gb|AIU48656.1| RabGAP/TBC domain-containing protein, partial [Glycine max]
Length=625

 Score =   127 bits (318),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KIIGE+MDFDTLL+FINEL GHI+L+ TLRDAEALC+CAGE GAARIPPGTP
Sbjct  554  AILKRYRGKIIGEEMDFDTLLKFINELSGHINLDATLRDAEALCICAGENGAARIPPGTP  613

Query  275  PSLPIQNL  252
            PSLP+++ 
Sbjct  614  PSLPVESF  621



>ref|XP_010047970.1| PREDICTED: TBC1 domain family member 15 [Eucalyptus grandis]
 gb|KCW80044.1| hypothetical protein EUGRSUZ_C01375 [Eucalyptus grandis]
Length=654

 Score =   127 bits (318),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            +ILKRYR KI+GE+MDFDTLL+FINEL G IDL T LRDAEALC+CAGE GAA IPPGTP
Sbjct  577  SILKRYRKKIMGEQMDFDTLLKFINELSGLIDLNTILRDAEALCICAGENGAACIPPGTP  636

Query  275  PSLPIQNLLLFSQEDD  228
            PSLPI++ LL+ Q+DD
Sbjct  637  PSLPIESSLLYPQQDD  652



>gb|KJB27077.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=639

 Score =   127 bits (318),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KIIG++MDFDTLL FINEL G +DL+ TLRDAEALC+CAGE GA  IPPGTP
Sbjct  562  AILKRYRGKIIGDQMDFDTLLRFINELSGRVDLDATLRDAEALCICAGEKGADCIPPGTP  621

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ N LL+SQ+D+
Sbjct  622  PSLPVDNGLLYSQQDE  637



>gb|KJB27078.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=656

 Score =   127 bits (318),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KIIG++MDFDTLL FINEL G +DL+ TLRDAEALC+CAGE GA  IPPGTP
Sbjct  579  AILKRYRGKIIGDQMDFDTLLRFINELSGRVDLDATLRDAEALCICAGEKGADCIPPGTP  638

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ N LL+SQ+D+
Sbjct  639  PSLPVDNGLLYSQQDE  654



>gb|KHG01737.1| TBC1 domain family member 15 [Gossypium arboreum]
Length=683

 Score =   127 bits (318),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KIIGE+MDFDTL+ FINEL G IDL+ TLRDAEALC+CAGE GA  IPPGTP
Sbjct  606  AILKRYRGKIIGEQMDFDTLIRFINELSGWIDLDATLRDAEALCICAGERGADCIPPGTP  665

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ N LL+SQ+D+
Sbjct  666  PSLPVDNGLLYSQQDE  681



>gb|KJB27079.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=683

 Score =   127 bits (318),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KIIG++MDFDTLL FINEL G +DL+ TLRDAEALC+CAGE GA  IPPGTP
Sbjct  606  AILKRYRGKIIGDQMDFDTLLRFINELSGRVDLDATLRDAEALCICAGEKGADCIPPGTP  665

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ N LL+SQ+D+
Sbjct  666  PSLPVDNGLLYSQQDE  681



>gb|KJB54007.1| hypothetical protein B456_009G016100 [Gossypium raimondii]
Length=657

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKRYR KIIGE+M+FDTLL+FINEL GHID++ TLRDAEALCLCAGE G+A IPPGTP
Sbjct  578  ALLKRYRGKIIGEQMEFDTLLKFINELSGHIDIDVTLRDAEALCLCAGENGSACIPPGTP  637

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLP ++  LF+ E DD +
Sbjct  638  PSLPREDGFLFNSELDDTV  656



>gb|KJB64719.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=653

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+GE+MDFDTLL+FINEL G I+L+  LRDAEALC+CAGE GAA IPPGT 
Sbjct  575  AILKRYRGKIMGEQMDFDTLLKFINELSGQIELDAILRDAEALCICAGENGAACIPPGTV  634

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLP+ N L +SQ+DD+V+
Sbjct  635  PSLPVDNGLFYSQQDDEVL  653



>ref|XP_010911930.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Elaeis guineensis]
Length=532

 Score =   125 bits (313),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+GE+MDFDTLL+FINEL GHIDL+ T+RDAEALC CAGE G A IPPGTP
Sbjct  454  AILKRYRKKIMGEQMDFDTLLKFINELSGHIDLDGTIRDAEALCACAGENGTACIPPGTP  513

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLP++  +    +DDDV+
Sbjct  514  PSLPVETDMGLYPQDDDVL  532



>ref|XP_006358298.1| PREDICTED: GTPase-activating protein gyp7-like [Solanum tuberosum]
Length=678

 Score =   126 bits (317),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AIL+R+RSKIIGE+MDFDTLL+FINEL GHI+L+ TLRDAEALC+CAGE G A IPPGTP
Sbjct  599  AILRRHRSKIIGEEMDFDTLLKFINELSGHINLDATLRDAEALCICAGENGEACIPPGTP  658

Query  275  PSLPIQNLLLFSQEDDD  225
            PSLP +   +++Q+DDD
Sbjct  659  PSLPFEITSMYNQQDDD  675



>ref|XP_007204093.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
 gb|EMJ05292.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
Length=622

 Score =   125 bits (315),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 3/82 (4%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+RSKIIGE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTP
Sbjct  541  AILKRHRSKIIGEQMDFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAACIPPGTP  600

Query  275  PSLPIQN--LLLFSQED-DDVM  219
            PSLP+ +  LLL+ Q++ DDV+
Sbjct  601  PSLPVDDYGLLLYPQQELDDVL  622



>ref|XP_006381119.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
 ref|XP_006381120.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
 gb|ERP58916.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
 gb|ERP58917.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
Length=315

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+GE MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  236  AILKRYRKKIMGEHMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAAHIPPGTP  295

Query  275  PSLPI--QNLLLFSQEDD  228
            PSLP   +N LL++Q+D+
Sbjct  296  PSLPTENENALLYAQDDE  313



>emb|CDY65323.1| BnaC02g44880D [Brassica napus]
Length=672

 Score =   126 bits (316),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RS I+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  595  AILKRCRSTIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTP  654

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ + +++S EDD
Sbjct  655  PSLPLDDGIVYSLEDD  670



>ref|XP_003609386.1| TBC1 domain family member [Medicago truncatula]
 gb|AES91583.1| RabGAP/TBC domain protein [Medicago truncatula]
Length=666

 Score =   125 bits (315),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKR R KIIGE+MDFD+LL+FINEL GHIDL+ TLRDAEAL +CAGE GAARIPPGTP
Sbjct  588  AVLKRCRGKIIGEEMDFDSLLKFINELSGHIDLDATLRDAEALSICAGEEGAARIPPGTP  647

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLP+ +   + Q+DD+V+
Sbjct  648  PSLPVDDGSFYYQQDDEVL  666



>ref|XP_008242808.1| PREDICTED: TBC1 domain family member 17 [Prunus mume]
Length=661

 Score =   125 bits (315),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 3/82 (4%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+RSKIIGE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTP
Sbjct  580  AILKRHRSKIIGEQMDFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAACIPPGTP  639

Query  275  PSLPIQN--LLLFSQED-DDVM  219
            PSLP+ +  LLL+ Q++ DDV+
Sbjct  640  PSLPVDDYGLLLYPQQELDDVL  661



>emb|CDY27056.1| BnaA02g10760D [Brassica napus]
Length=672

 Score =   125 bits (315),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RS IIGE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  595  AILKRCRSTIIGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTP  654

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ + +++S +DD
Sbjct  655  PSLPLDDGIVYSLDDD  670



>ref|XP_004251725.1| PREDICTED: TBC1 domain family member 17-like [Solanum lycopersicum]
Length=656

 Score =   125 bits (314),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/77 (73%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+RSKIIGE MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE G + IPPGTP
Sbjct  576  AILKRHRSKIIGEGMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGESCIPPGTP  635

Query  275  PSLPIQNLLLFSQEDDD  225
            PSLP+ +  ++ Q+DDD
Sbjct  636  PSLPVDDASMYYQQDDD  652



>ref|XP_010911929.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Elaeis guineensis]
Length=667

 Score =   125 bits (314),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+GE+MDFDTLL+FINEL GHIDL+ T+RDAEALC CAGE G A IPPGTP
Sbjct  589  AILKRYRKKIMGEQMDFDTLLKFINELSGHIDLDGTIRDAEALCACAGENGTACIPPGTP  648

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLP++  +    +DDDV+
Sbjct  649  PSLPVETDMGLYPQDDDVL  667



>ref|XP_002527173.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35186.1| conserved hypothetical protein [Ricinus communis]
Length=645

 Score =   125 bits (314),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 70/78 (90%), Gaps = 2/78 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            +ILKRYR+KI+GE+MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  566  SILKRYRNKIMGEQMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAACIPPGTP  625

Query  275  PSLPIQNL--LLFSQEDD  228
            PSLP++N   LL++Q+D+
Sbjct  626  PSLPLENENGLLYAQQDE  643



>ref|XP_008785780.1| PREDICTED: TBC1 domain family member 15 [Phoenix dactylifera]
Length=666

 Score =   125 bits (313),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKRYR KI+GE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTP
Sbjct  588  AVLKRYRKKIMGEQMDFDTLLKFINELSGHIDLDGMIRDAEALCVCAGESGAACIPPGTP  647

Query  275  PSLPIQ-NLLLFSQEDD  228
            PSLP++ ++ L+ QEDD
Sbjct  648  PSLPVETDMGLYPQEDD  664



>ref|XP_006345222.1| PREDICTED: TBC1 domain family member 15-like [Solanum tuberosum]
Length=656

 Score =   125 bits (313),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 56/77 (73%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+RSKIIGE MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE G + IPPGTP
Sbjct  577  AILKRHRSKIIGEGMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGESCIPPGTP  636

Query  275  PSLPIQNLLLFSQEDDD  225
            PSLP+ +  ++ Q+DDD
Sbjct  637  PSLPVDDASMYYQQDDD  653



>ref|XP_010323291.1| PREDICTED: GTPase-activating protein gyp7 [Solanum lycopersicum]
Length=678

 Score =   125 bits (313),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AIL+R+RSKIIGE+MDFDTLL+FINEL GHI+L+ TLR+AEALC+CAGE G A IPPGTP
Sbjct  599  AILRRHRSKIIGEEMDFDTLLKFINELSGHINLDATLREAEALCICAGENGEACIPPGTP  658

Query  275  PSLPIQNLLLFSQEDDD  225
            PSLP +   +++Q+DDD
Sbjct  659  PSLPFEITSMYNQQDDD  675



>ref|XP_009127224.1| PREDICTED: TBC1 domain family member 15 [Brassica rapa]
Length=672

 Score =   124 bits (312),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RS I+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  595  AILKRCRSTIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTP  654

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ + +++S +DD
Sbjct  655  PSLPLDDGIVYSLDDD  670



>ref|XP_009624893.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana tomentosiformis]
Length=649

 Score =   124 bits (310),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 56/77 (73%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYRSKII E+MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE G + IPPGTP
Sbjct  570  AILKRYRSKIIREEMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGESCIPPGTP  629

Query  275  PSLPIQNLLLFSQEDDD  225
            PSLP+ +  ++ Q+DDD
Sbjct  630  PSLPLDDASMYYQQDDD  646



>ref|XP_009758337.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana sylvestris]
Length=649

 Score =   124 bits (310),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 56/77 (73%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYRSKII E+MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE G + IPPGTP
Sbjct  570  AILKRYRSKIIREEMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGESCIPPGTP  629

Query  275  PSLPIQNLLLFSQEDDD  225
            PSLP+ +  ++ Q+DDD
Sbjct  630  PSLPLDDASMYYQQDDD  646



>ref|XP_004173869.1| PREDICTED: TBC1 domain family member 15-like, partial [Cucumis 
sativus]
Length=191

 Score =   117 bits (294),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKRYR+KI+GE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTP
Sbjct  114  AVLKRYRNKIMGEQMDFDTLLKFINELSGHIDLDAAIRDAEALCVCAGENGAANIPPGTP  173

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ +   + Q+D+
Sbjct  174  PSLPLDDGSYYIQQDE  189



>ref|NP_200071.2| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96237.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=673

 Score =   124 bits (310),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+ AGE GAA IPPGTP
Sbjct  596  AVLKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCIEAGENGAASIPPGTP  655

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ +  L+ QEDD
Sbjct  656  PSLPLDDGTLYPQEDD  671



>ref|NP_001190524.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96238.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=690

 Score =   124 bits (310),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+ AGE GAA IPPGTP
Sbjct  613  AVLKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCIEAGENGAASIPPGTP  672

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ +  L+ QEDD
Sbjct  673  PSLPLDDGTLYPQEDD  688



>gb|AIU48668.1| RabGAP/TBC domain-containing protein, partial [Manihot esculenta]
Length=627

 Score =   123 bits (309),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  556  AILKRYRNKIMGEQMDFDTLLKFINELSGHIDLDAVLRDAEALCICAGENGAAAIPPGTP  615

Query  275  PSLPIQNLLLFSQE  234
            PSLP++  LL+S E
Sbjct  616  PSLPLE--LLYSDE  627



>ref|XP_011084120.1| PREDICTED: TBC1 domain family member 15 [Sesamum indicum]
Length=654

 Score =   123 bits (309),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 55/79 (70%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+RSKI+GE+MDFDTLL+FINEL G I+L+ TLR+AEALC+CAGE G A IPPGTP
Sbjct  576  AILKRHRSKIMGEQMDFDTLLKFINELSGQIELDATLREAEALCICAGENGEACIPPGTP  635

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLPI++ L++ Q +DD++
Sbjct  636  PSLPIEDGLVYPQLEDDIL  654



>gb|KFK26862.1| hypothetical protein AALP_AA8G303600 [Arabis alpina]
Length=675

 Score =   123 bits (309),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RSKI+G++MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  598  AILKRCRSKIMGDQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTP  657

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+   +L+  +DD
Sbjct  658  PSLPLDEEILYPLDDD  673



>ref|XP_008377303.1| PREDICTED: TBC1 domain family member 17 [Malus domestica]
Length=660

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+RSKIIGE+MDFDTLL+FINEL  HIDL+  +RDAEALC+ AGE GAA IPPGTP
Sbjct  581  AILKRHRSKIIGEQMDFDTLLKFINELSXHIDLDAVVRDAEALCIXAGENGAASIPPGTP  640

Query  275  PSLPIQNLLLFSQED-DDVM  219
            PSLP+ ++LL+ Q++ DD++
Sbjct  641  PSLPVDDVLLYPQQELDDIL  660



>ref|XP_004139297.1| PREDICTED: TBC1 domain family member 15-like [Cucumis sativus]
 gb|KGN60701.1| hypothetical protein Csa_2G007450 [Cucumis sativus]
Length=655

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKRYR+KI+GE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTP
Sbjct  578  AVLKRYRNKIMGEQMDFDTLLKFINELSGHIDLDAAIRDAEALCVCAGENGAANIPPGTP  637

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ +   + Q+D+
Sbjct  638  PSLPLDDGSYYIQQDE  653



>gb|AIU48653.1| RabGAP/TBC domain-containing protein, partial [Capsella rubella]
Length=626

 Score =   122 bits (307),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RSKI+GE+MDFDTLL+FINEL GHIDLE+T+RDAEALC+CAGE GAA IPPGTP
Sbjct  555  AILKRCRSKIMGEQMDFDTLLKFINELSGHIDLESTVRDAEALCICAGENGAASIPPGTP  614

Query  275  PSLPIQNL  252
            PSLP+  L
Sbjct  615  PSLPLDML  622



>ref|XP_010241554.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Nelumbo nucifera]
Length=707

 Score =   122 bits (307),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 68/78 (87%), Gaps = 1/78 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+G++MDFDT+L+FINEL GHIDL+ TL+DAEALC+CAGE G A IPPGTP
Sbjct  630  AILKRYRKKIMGDQMDFDTVLKFINELSGHIDLDATLKDAEALCMCAGENGEACIPPGTP  689

Query  275  PSLPIQNL-LLFSQEDDD  225
            PSLPI++   L+ Q+DDD
Sbjct  690  PSLPIEDTGSLYPQQDDD  707



>ref|XP_009789610.1| PREDICTED: TBC1 domain family member 15-like isoform X3 [Nicotiana 
sylvestris]
Length=563

 Score =   121 bits (304),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AIL+RYRSKIIGE+MDFDTLL+FINEL GHIDL+ TLR+AEAL +CAGE G A IPPGTP
Sbjct  484  AILRRYRSKIIGEEMDFDTLLKFINELSGHIDLDATLREAEALFICAGENGEACIPPGTP  543

Query  275  PSLPIQNL-LLFSQEDDDVM  219
            PS P +   + + Q+DDDV+
Sbjct  544  PSFPFEGTSMCYQQDDDDVL  563



>ref|XP_010241556.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Nelumbo nucifera]
Length=673

 Score =   122 bits (307),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 68/78 (87%), Gaps = 1/78 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+G++MDFDT+L+FINEL GHIDL+ TL+DAEALC+CAGE G A IPPGTP
Sbjct  596  AILKRYRKKIMGDQMDFDTVLKFINELSGHIDLDATLKDAEALCMCAGENGEACIPPGTP  655

Query  275  PSLPIQNL-LLFSQEDDD  225
            PSLPI++   L+ Q+DDD
Sbjct  656  PSLPIEDTGSLYPQQDDD  673



>ref|XP_010241555.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Nelumbo nucifera]
Length=700

 Score =   122 bits (307),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 68/78 (87%), Gaps = 1/78 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+G++MDFDT+L+FINEL GHIDL+ TL+DAEALC+CAGE G A IPPGTP
Sbjct  623  AILKRYRKKIMGDQMDFDTVLKFINELSGHIDLDATLKDAEALCMCAGENGEACIPPGTP  682

Query  275  PSLPIQNL-LLFSQEDDD  225
            PSLPI++   L+ Q+DDD
Sbjct  683  PSLPIEDTGSLYPQQDDD  700



>ref|XP_009789609.1| PREDICTED: TBC1 domain family member 17-like isoform X2 [Nicotiana 
sylvestris]
Length=626

 Score =   122 bits (305),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AIL+RYRSKIIGE+MDFDTLL+FINEL GHIDL+ TLR+AEAL +CAGE G A IPPGTP
Sbjct  547  AILRRYRSKIIGEEMDFDTLLKFINELSGHIDLDATLREAEALFICAGENGEACIPPGTP  606

Query  275  PSLPIQNL-LLFSQEDDDVM  219
            PS P +   + + Q+DDDV+
Sbjct  607  PSFPFEGTSMCYQQDDDDVL  626



>ref|XP_008456989.1| PREDICTED: TBC1 domain family member 15 [Cucumis melo]
Length=655

 Score =   122 bits (306),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKRYR+KI+GE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTP
Sbjct  578  AVLKRYRNKIMGEQMDFDTLLKFINELSGHIDLDAAIRDAEALCVCAGENGAANIPPGTP  637

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ +   + Q D+
Sbjct  638  PSLPLDDGSYYIQHDE  653



>gb|AIU48681.1| RabGAP/TBC domain-containing protein, partial [Vitis vinifera]
Length=629

 Score =   122 bits (305),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTP
Sbjct  558  AILKRYRNKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAANIPPGTP  617

Query  275  PSLPIQNL  252
            PSLPI  L
Sbjct  618  PSLPIDLL  625



>ref|XP_010656460.1| PREDICTED: GTPase-activating protein GYP7-like [Vitis vinifera]
Length=100

 Score =   113 bits (283),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK YR  I+GE+M FDTLL+FINEL G IDL+  LRDA+ALC+CAGE GAA IPPGTP
Sbjct  23   AILKGYRDNIMGEQMSFDTLLKFINELRGQIDLDAILRDAQALCICAGENGAASIPPGTP  82

Query  275  PSLPIQNLLLFSQEDD  228
            PSLPI + LL+ Q+DD
Sbjct  83   PSLPIDSGLLYPQQDD  98



>ref|XP_009789608.1| PREDICTED: TBC1 domain family member 17-like isoform X1 [Nicotiana 
sylvestris]
Length=676

 Score =   122 bits (305),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AIL+RYRSKIIGE+MDFDTLL+FINEL GHIDL+ TLR+AEAL +CAGE G A IPPGTP
Sbjct  597  AILRRYRSKIIGEEMDFDTLLKFINELSGHIDLDATLREAEALFICAGENGEACIPPGTP  656

Query  275  PSLPIQNL-LLFSQEDDDVM  219
            PS P +   + + Q+DDDV+
Sbjct  657  PSFPFEGTSMCYQQDDDDVL  676



>gb|AIU48640.1| RabGAP/TBC domain-containing protein, partial [Arabidopsis lyrata]
Length=627

 Score =   121 bits (304),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  556  AVLKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTP  615

Query  275  PSLPIQNL  252
            PSLP+  L
Sbjct  616  PSLPLDTL  623



>emb|CAN75817.1| hypothetical protein VITISV_033040 [Vitis vinifera]
Length=100

 Score =   113 bits (283),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK YR  I+GE+M FDTLL+FINEL G IDL+  LRDA+ALC+CAGE GAA IPPGTP
Sbjct  23   AILKGYRDNIMGEQMSFDTLLKFINELRGQIDLDAILRDAQALCICAGENGAASIPPGTP  82

Query  275  PSLPIQNLLLFSQEDD  228
            PSLPI + LL+ Q+DD
Sbjct  83   PSLPIDSGLLYPQQDD  98



>gb|AIU48650.1| RabGAP/TBC domain-containing protein, partial [Citrus clementina]
Length=629

 Score =   121 bits (304),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  558  AILKRYRNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTP  617

Query  275  PSLPIQNLLLFSQE  234
            PSLPI   LL+S++
Sbjct  618  PSLPID--LLYSED  629



>gb|AIU48652.1| RabGAP/TBC domain-containing protein, partial [Carica papaya]
Length=628

 Score =   121 bits (304),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR  I+GE+MDFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE G+A IPPGTP
Sbjct  557  AILKRYRGMIMGEQMDFDTLLKFINELSGHIDLDATLRDAEALCICAGENGSACIPPGTP  616

Query  275  PSLPIQNL  252
            PSLPI +L
Sbjct  617  PSLPIDSL  624



>gb|AIU48654.1| RabGAP/TBC domain-containing protein, partial [Citrus sinensis]
Length=629

 Score =   121 bits (304),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  558  AILKRYRNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTP  617

Query  275  PSLPIQNLLLFSQE  234
            PSLPI   LL+S++
Sbjct  618  PSLPID--LLYSED  629



>gb|AIU48658.1| RabGAP/TBC domain-containing protein, partial [Buxus sinica]
Length=629

 Score =   121 bits (304),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTP
Sbjct  558  AILKRYRKKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAACIPPGTP  617

Query  275  PSLPIQNLLL  246
            PS+PI+ L L
Sbjct  618  PSMPIELLYL  627



>gb|AIU48670.1| RabGAP/TBC domain-containing protein, partial [Populus trichocarpa]
Length=627

 Score =   121 bits (304),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE MDFDTLL+F NEL GHIDL++ LRDAEALC+CAGE GAA IPPGTP
Sbjct  556  AILKRYRNKIMGEHMDFDTLLKFTNELSGHIDLDSVLRDAEALCICAGENGAACIPPGTP  615

Query  275  PSLPIQNLLLFSQE  234
            PSLPI+  LL++++
Sbjct  616  PSLPIE--LLYTED  627



>gb|AIU48675.1| RabGAP/TBC domain-containing protein, partial [Ricinus communis]
Length=610

 Score =   121 bits (303),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            +ILKRYR+KI+GE+MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  539  SILKRYRNKIMGEQMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAACIPPGTP  598

Query  275  PSLPIQNLLLFSQE  234
            PSLP++  LL++ E
Sbjct  599  PSLPLE--LLYADE  610



>dbj|BAA98077.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42472.1| unknown protein [Arabidopsis thaliana]
 gb|ABH11525.1| rabGAP [Arabidopsis thaliana]
Length=338

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+ AGE GAA IPPGTP
Sbjct  261  AVLKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCIEAGENGAASIPPGTP  320

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP+ +  L+ QEDD
Sbjct  321  PSLPLDDGTLYPQEDD  336



>gb|AIU48671.1| RabGAP/TBC domain-containing protein, partial [Prunus persica]
Length=589

 Score =   120 bits (301),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+RSKIIGE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTP
Sbjct  518  AILKRHRSKIIGEQMDFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAACIPPGTP  577

Query  275  PSLPIQNL  252
            PSLP+  L
Sbjct  578  PSLPVDLL  585



>gb|AIU48680.1| RabGAP/TBC domain-containing protein, partial [Schrenkiella parvula]
Length=628

 Score =   120 bits (302),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTP
Sbjct  557  AILKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTP  616

Query  275  PSLPIQNL  252
            PSLP+  L
Sbjct  617  PSLPLDIL  624



>ref|XP_010687933.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=622

 Score =   120 bits (302),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR R+KIIGE+MDFDTLL+FIN L GHIDL+  LRDAEALC+C+GE GAA IPPGTP
Sbjct  544  AILKRCRNKIIGEQMDFDTLLKFINGLSGHIDLDAILRDAEALCICSGETGAACIPPGTP  603

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLP++N  L SQ +D+++
Sbjct  604  PSLPMENGPLSSQLEDEIL  622



>ref|XP_004287286.1| PREDICTED: TBC1 domain family member 15 [Fragaria vesca subsp. 
vesca]
Length=659

 Score =   121 bits (303),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYRSKIIGE+MDFDTLL+FINEL G I+L+  +RDAEALC+CAGE G A IPPGTP
Sbjct  580  AILKRYRSKIIGEQMDFDTLLKFINELSGQINLDAVVRDAEALCICAGENGDACIPPGTP  639

Query  275  PSLPIQNLLLFSQEDDD  225
            PSLP+ + LL+ Q++ D
Sbjct  640  PSLPVDDGLLYPQQELD  656



>ref|XP_010687932.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=656

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR R+KIIGE+MDFDTLL+FIN L GHIDL+  LRDAEALC+C+GE GAA IPPGTP
Sbjct  578  AILKRCRNKIIGEQMDFDTLLKFINGLSGHIDLDAILRDAEALCICSGETGAACIPPGTP  637

Query  275  PSLPIQNLLLFSQEDDDVM  219
            PSLP++N  L SQ +D+++
Sbjct  638  PSLPMENGPLSSQLEDEIL  656



>gb|AIU48647.1| RabGAP/TBC domain-containing protein, partial [Theobroma cacao]
Length=603

 Score =   120 bits (301),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 2/74 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKRYR KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTP
Sbjct  532  AVLKRYRGKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAACIPPGTP  591

Query  275  PSLPIQNLLLFSQE  234
            PSLP+   L +S E
Sbjct  592  PSLPVD--LFYSDE  603



>emb|CBI28233.3| unnamed protein product [Vitis vinifera]
Length=152

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK YR  I+GE+M FDTLL+FINEL G IDL+  LRDA+ALC+CAGE GAA IPPGTP
Sbjct  75   AILKGYRDNIMGEQMSFDTLLKFINELRGQIDLDAILRDAQALCICAGENGAASIPPGTP  134

Query  275  PSLPIQNLLLFSQEDD  228
            PSLPI + LL+ Q+DD
Sbjct  135  PSLPIDSGLLYPQQDD  150



>gb|AIU48684.1| RabGAP/TBC domain-containing protein, partial [Cinnamomum camphora]
Length=561

 Score =   119 bits (299),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 3/75 (4%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+R KIIGE+MDFDTLL+FINEL GH+DL++ LRDAEALC+CAGE GAA IPPGTP
Sbjct  490  AILKRHRKKIIGEQMDFDTLLKFINELSGHLDLDSALRDAEALCICAGENGAACIPPGTP  549

Query  275  PSLPIQNLLLFSQED  231
            PSLP++    F+ +D
Sbjct  550  PSLPVE---FFNSDD  561



>gb|AIU48645.1| RabGAP/TBC domain-containing protein, partial [Pinellia ternata]
Length=624

 Score =   120 bits (300),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKRYR KI+GE+MDFDTLL+FINEL GHI+L+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  553  AVLKRYRKKIMGEQMDFDTLLKFINELSGHINLDDILRDAEALCICAGENGAACIPPGTP  612

Query  275  PSLPIQNLLLFSQE  234
            PSLP++  LL+S++
Sbjct  613  PSLPME--LLYSEQ  624



>ref|XP_009593350.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Nicotiana 
tomentosiformis]
Length=626

 Score =   120 bits (300),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AIL+RYRSKIIGE+MDFDTLL+FINEL G IDL+ TLR+AEAL +CAGE G A IPPGTP
Sbjct  547  AILRRYRSKIIGEEMDFDTLLKFINELSGQIDLDATLREAEALFICAGENGEACIPPGTP  606

Query  275  PSLPIQNLLLFSQEDDD  225
            PS P +   ++ Q+DDD
Sbjct  607  PSFPFEGTSMYYQQDDD  623



>ref|XP_009593351.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Nicotiana 
tomentosiformis]
Length=563

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AIL+RYRSKIIGE+MDFDTLL+FINEL G IDL+ TLR+AEAL +CAGE G A IPPGTP
Sbjct  484  AILRRYRSKIIGEEMDFDTLLKFINELSGQIDLDATLREAEALFICAGENGEACIPPGTP  543

Query  275  PSLPIQNLLLFSQEDDD  225
            PS P +   ++ Q+DDD
Sbjct  544  PSFPFEGTSMYYQQDDD  560



>gb|AIU48648.1| RabGAP/TBC domain-containing protein, partial [Acorus calamus]
Length=550

 Score =   119 bits (297),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRY  KIIGE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE G A IPPGTP
Sbjct  479  AILKRYSKKIIGEQMDFDTLLKFINELSGHIDLDGIIRDAEALCVCAGENGEACIPPGTP  538

Query  275  PSLPIQNLLL  246
            PSLPI+++ L
Sbjct  539  PSLPIESMYL  548



>ref|XP_009593349.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Nicotiana 
tomentosiformis]
Length=676

 Score =   120 bits (300),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AIL+RYRSKIIGE+MDFDTLL+FINEL G IDL+ TLR+AEAL +CAGE G A IPPGTP
Sbjct  597  AILRRYRSKIIGEEMDFDTLLKFINELSGQIDLDATLREAEALFICAGENGEACIPPGTP  656

Query  275  PSLPIQNLLLFSQEDDD  225
            PS P +   ++ Q+DDD
Sbjct  657  PSFPFEGTSMYYQQDDD  673



>gb|AIU48662.1| RabGAP/TBC domain-containing protein, partial [Chimonanthus praecox]
Length=627

 Score =   119 bits (297),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 4/76 (5%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+  +IIGE+MDFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAA IPPGTP
Sbjct  556  AILKRFCKRIIGEQMDFDTLLKFINELSGHIDLDRTLRDAEALCICAGENGAACIPPGTP  615

Query  275  PSLPIQNLLLFSQEDD  228
            PSLP++    FS  DD
Sbjct  616  PSLPVE----FSYPDD  627



>gb|AIU48669.1| RabGAP/TBC domain-containing protein, partial [Erythranthe guttata]
Length=624

 Score =   118 bits (296),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL G IDL+ TLR+AEALC+CAGE G A IPPGTP
Sbjct  553  AILKRYRNKIMGEQMDFDTLLKFINELSGQIDLDATLREAEALCICAGENGEASIPPGTP  612

Query  275  PSLPIQNL  252
            PSLP++++
Sbjct  613  PSLPLESV  620



>gb|AIU48666.1| RabGAP/TBC domain-containing protein, partial [Medicago truncatula]
Length=626

 Score =   118 bits (295),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKR R KIIGE+MDFD+LL+FINEL GHIDL+ TLRDAEAL +CAGE GAARIPPGTP
Sbjct  555  AVLKRCRGKIIGEEMDFDSLLKFINELSGHIDLDATLRDAEALSICAGEEGAARIPPGTP  614

Query  275  PSLPIQNL  252
            PSLP+ + 
Sbjct  615  PSLPVDSF  622



>gb|AIU48639.1| RabGAP/TBC domain-containing protein, partial [Aquilegia coerulea]
Length=625

 Score =   118 bits (295),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 2/74 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK++R+KI+GE+MDFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAA IPPGTP
Sbjct  554  AILKKHRAKIMGEQMDFDTLLKFINELSGHIDLDVTLRDAEALCVCAGENGAACIPPGTP  613

Query  275  PSLPIQNLLLFSQE  234
             SLPI+  LL+  E
Sbjct  614  ASLPIE--LLYPDE  625



>gb|AIU48655.1| RabGAP/TBC domain-containing protein, partial [Eucalyptus grandis]
Length=624

 Score =   118 bits (295),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            +ILKRYR KI+GE+MDFDTLL+FINEL G IDL T LRDAEALC+CAGE GAA IPPGTP
Sbjct  554  SILKRYRKKIMGEQMDFDTLLKFINELSGLIDLNTILRDAEALCICAGENGAACIPPGTP  613

Query  275  PSLPIQNL  252
            PSLPI+ L
Sbjct  614  PSLPIELL  621



>gb|AIU48667.1| RabGAP/TBC domain-containing protein, partial [Canna indica]
Length=628

 Score =   117 bits (293),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+R KI+GE+MDFDTLL+FINEL GHIDL+ T+R+AEALC CAGE GAA IPPGTP
Sbjct  557  AILKRHRKKIMGEQMDFDTLLKFINELSGHIDLDWTIREAEALCTCAGENGAACIPPGTP  616

Query  275  PSLPIQ  258
            PSLPI+
Sbjct  617  PSLPIE  622



>ref|XP_009420718.1| PREDICTED: TBC1 domain family member 15 [Musa acuminata subsp. 
malaccensis]
Length=667

 Score =   117 bits (292),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 68/77 (88%), Gaps = 1/77 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK +R KI+GE+MDFDTLL+FINEL G+IDL+ T+R+AEALC+CAGE GAA IPPGTP
Sbjct  589  AILKSHRKKIMGEQMDFDTLLKFINELSGNIDLDWTIREAEALCICAGENGAACIPPGTP  648

Query  275  PSLPIQ-NLLLFSQEDD  228
            PSLPI+ ++ L+ QED+
Sbjct  649  PSLPIEPDMGLYPQEDE  665



>gb|AIU48641.1| RabGAP/TBC domain-containing protein, partial [Arabidopsis thaliana]
Length=626

 Score =   116 bits (291),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKR RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+ AGE GAA IPPGTP
Sbjct  555  AVLKRCRSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCIEAGENGAASIPPGTP  614

Query  275  PSLPIQNL  252
            PSLP+  L
Sbjct  615  PSLPLDTL  622



>gb|AIU48690.1| RabGAP/TBC domain-containing protein, partial [Trachycarpus fortunei]
Length=627

 Score =   116 bits (291),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 51/66 (77%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+GE+MDFDTLL+FINEL GHI+L+ T+RDAEALC+CAGE GAA IPPGTP
Sbjct  556  AILKRYRKKIMGEQMDFDTLLKFINELSGHINLDGTIRDAEALCVCAGENGAACIPPGTP  615

Query  275  PSLPIQ  258
             SLP++
Sbjct  616  ASLPVE  621



>gb|AIU48665.1| RabGAP/TBC domain-containing protein, partial [Aristolochia tagala]
Length=616

 Score =   115 bits (289),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KIIGE+MDFDTLL+FINEL G I+L+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  545  AILKRYRKKIIGEQMDFDTLLKFINELSGSIELDGILRDAEALCICAGENGAACIPPGTP  604

Query  275  PSLPIQN  255
            PSLP ++
Sbjct  605  PSLPFES  611



>gb|AIU48643.1| RabGAP/TBC domain-containing protein, partial [Magnolia denudata]
Length=622

 Score =   115 bits (287),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+G++MDFDTLL+FINEL GHIDL   +RD EALC+CAGE G+A IPPGTP
Sbjct  557  AILKRYRQKIMGDQMDFDTLLKFINELSGHIDLNGAIRDGEALCICAGENGSACIPPGTP  616

Query  275  PSLPI  261
            PSLPI
Sbjct  617  PSLPI  621



>gb|AIU48689.1| RabGAP/TBC domain-containing protein, partial [Alisma plantago-aquatica]
Length=628

 Score =   114 bits (286),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+GE+MDFDTLL+FINEL G +DL++ +RDAEALC+CAGE G A IPPGTP
Sbjct  557  AILKRYRKKIMGEQMDFDTLLKFINELSGRVDLDSIIRDAEALCICAGENGEACIPPGTP  616

Query  275  PSLPIQN  255
            PSLP+++
Sbjct  617  PSLPLES  623



>ref|XP_011469988.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 15-like 
[Fragaria vesca subsp. vesca]
Length=634

 Score =   114 bits (286),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRY SKIIGE+MDFDTLL+FINEL G I+L+  +RDAEALC+CAGE G A IPP TP
Sbjct  555  AILKRYGSKIIGEQMDFDTLLKFINELSGQINLDAVVRDAEALCICAGENGDACIPPETP  614

Query  275  PSLPIQNLLLFSQEDDD  225
            PSLP+ + LL+ Q++ D
Sbjct  615  PSLPVDDGLLYPQQEVD  631



>gb|AIU48691.1| RabGAP/TBC domain-containing protein, partial [Cabomba caroliniana]
Length=409

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KII E+MDFDTLL+FINEL  HI L++TLRDAEALC+CAGE GAA IPPGTP
Sbjct  344  AILKRYRRKIIDEQMDFDTLLKFINELSCHIHLDSTLRDAEALCVCAGENGAALIPPGTP  403

Query  275  PSLPIQ  258
            PSLP++
Sbjct  404  PSLPVE  409



>gb|AIU48687.1| RabGAP/TBC domain-containing protein, partial [Houttuynia cordata]
Length=622

 Score =   114 bits (284),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+R KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  551  AILKRHRKKIMGEQMDFDTLLKFINELSGQIDLDGILRDAEALCICAGENGAACIPPGTP  610

Query  275  PSLP  264
            PSLP
Sbjct  611  PSLP  614



>gb|AIU48664.1| RabGAP/TBC domain-containing protein, partial [Asparagus officinalis]
Length=625

 Score =   114 bits (284),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK+YR +I+GE+MDFDTLL+FINEL GHI+L+  +RDAEALC CAGE GAA IPPGTP
Sbjct  556  AILKKYRQRIVGEQMDFDTLLKFINELSGHINLDDIIRDAEALCNCAGEQGAACIPPGTP  615

Query  275  PSLPIQN  255
            PS+P+++
Sbjct  616  PSMPLED  622



>gb|AIU48677.1| RabGAP/TBC domain-containing protein, partial [Yucca filamentosa]
Length=624

 Score =   114 bits (284),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK+YR KIIGE+MDFDTLL++INEL G I+L+  +RDAEALCLCAGE GAA IPPGTP
Sbjct  555  AILKKYRKKIIGEQMDFDTLLKYINELSGRINLDEIIRDAEALCLCAGENGAACIPPGTP  614

Query  275  PSLPIQN  255
            PS+P+++
Sbjct  615  PSMPLED  621



>gb|AIU48683.1| RabGAP/TBC domain-containing protein, partial [Ceratophyllum 
platyacanthum subsp. oryzetorum]
Length=615

 Score =   113 bits (283),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRY  KI+ EKMDFDTLL+FINEL GHI+L+  LRDAEALC+CAGE G A IPPGTP
Sbjct  551  AILKRYAKKIVNEKMDFDTLLKFINELSGHINLDEALRDAEALCVCAGENGEACIPPGTP  610

Query  275  PSLPI  261
            PSLPI
Sbjct  611  PSLPI  615



>gb|AIU48661.1| RabGAP/TBC domain-containing protein, partial [Ceratophyllum 
demersum]
Length=615

 Score =   113 bits (283),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRY  KI+ EKMDFDTLL+FINEL GHI+L+  LRDAEALC+CAGE G A IPPGTP
Sbjct  551  AILKRYAKKIVNEKMDFDTLLKFINELSGHINLDEALRDAEALCVCAGENGEACIPPGTP  610

Query  275  PSLPI  261
            PSLPI
Sbjct  611  PSLPI  615



>gb|AIU48660.1| RabGAP/TBC domain-containing protein, partial [Chloranthus japonicus]
Length=627

 Score =   113 bits (283),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 2/74 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRY  KI+ E+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  556  AILKRYHKKIMDEEMDFDTLLKFINELSGRIDLDAALRDAEALCICAGENGAACIPPGTP  615

Query  275  PSLPIQNLLLFSQE  234
            PSLP++  LL+S +
Sbjct  616  PSLPVE--LLYSDD  627



>gb|AIU48676.1| RabGAP/TBC domain-containing protein, partial [Dioscorea oppositifolia]
Length=625

 Score =   113 bits (282),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK+YR KII E+MDFDTLL+FINEL G IDL++ ++DAEALC+CAGE GAA IPPGTP
Sbjct  554  AILKKYRKKIIDEQMDFDTLLKFINELSGQIDLDSIIKDAEALCICAGENGAACIPPGTP  613

Query  275  PSLPIQ  258
            PSLP++
Sbjct  614  PSLPLE  619



>gb|AIU48657.1| RabGAP/TBC domain-containing protein, partial [Illicium henryi]
Length=619

 Score =   112 bits (280),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRY  KI+ E+MDFDTLL+FINEL G I+LE TLRDAEALC+CAGE GAA IPPGTP
Sbjct  554  AILKRYHKKIMDEQMDFDTLLKFINELSGRIELEGTLRDAEALCICAGENGAACIPPGTP  613

Query  275  PSLPI  261
            PSLP+
Sbjct  614  PSLPL  618



>gb|AIU48686.1| RabGAP/TBC domain-containing protein, partial [Ginkgo biloba]
Length=617

 Score =   111 bits (278),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKR+R KII EKMDFDTLL+FINEL  HIDLE TLRDAEALC+CAG+ G+A IP GTP
Sbjct  553  ALLKRHRKKIIDEKMDFDTLLKFINELSCHIDLEATLRDAEALCICAGDTGSACIPQGTP  612

Query  275  PSLPI  261
            PSLPI
Sbjct  613  PSLPI  617



>gb|AIU48644.1| RabGAP/TBC domain-containing protein, partial [Musa acuminata]
Length=319

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK +R KI+GE+MDFDTLL+FINEL G+IDL+ T+R+AEALC+CAGE GAA IPPGTP
Sbjct  248  AILKSHRKKIMGEQMDFDTLLKFINELSGNIDLDWTIREAEALCICAGENGAACIPPGTP  307

Query  275  PSLPIQ  258
            PSLPI+
Sbjct  308  PSLPIE  313



>gb|AIU48651.1| RabGAP/TBC domain-containing protein, partial [Gossypium raimondii]
Length=624

 Score =   111 bits (277),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+GE+MDFDTLL+FINEL G I+L+  LRDAEALC+CAGE GAA IPPGT 
Sbjct  553  AILKRYRGKIMGEQMDFDTLLKFINELSGQIELDAILRDAEALCICAGENGAACIPPGTV  612

Query  275  PSLPIQNLLLFSQED  231
            PSLP+    LF  +D
Sbjct  613  PSLPVD---LFYSDD  624



>gb|AIU48649.1| RabGAP/TBC domain-containing protein, partial [Sarcandra glabra]
Length=355

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 2/74 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR KI+ E+MDFDTLL+FINEL G IDL+  LRDAEALC+ AGE GAA IPPGTP
Sbjct  284  AILKRYRKKIVDEEMDFDTLLKFINELSGQIDLDAALRDAEALCIVAGENGAACIPPGTP  343

Query  275  PSLPIQNLLLFSQE  234
            PSLP++  LL+S +
Sbjct  344  PSLPVE--LLYSDD  355



>ref|XP_006647781.1| PREDICTED: TBC1 domain family member 15-like [Oryza brachyantha]
Length=635

 Score =   110 bits (276),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYRS+IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC+ AGE GAA IPPGTP
Sbjct  557  AILKRYRSRIIGEQMDFDTLLKFINELSGEINLDRAIQDAEALCVIAGEKGAACIPPGTP  616

Query  275  PSLPIQ-NLLLFSQEDD  228
            PS+PI+ +  L+ Q+D+
Sbjct  617  PSMPIETDGGLYVQQDE  633



>ref|XP_001783529.1| predicted protein [Physcomitrella patens]
 gb|EDQ51665.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   109 bits (272),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 49/65 (75%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+R KI+ E+M+FDTLL+FINEL GHI+LE+TLRD EALCL AGE G A IPPGTP
Sbjct  411  AILKRHRRKIMDEQMEFDTLLKFINELSGHIELESTLRDTEALCLFAGEKGTACIPPGTP  470

Query  275  PSLPI  261
            PSLP+
Sbjct  471  PSLPV  475



>gb|EPS74110.1| hypothetical protein M569_00644 [Genlisea aurea]
Length=202

 Score =   105 bits (262),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 62/75 (83%), Gaps = 2/75 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK++RSKII E+M FDTLL+FINEL G + ++  LRDAEALC+CAGE GAA IPPGTP
Sbjct  117  AILKKHRSKIIREEMSFDTLLKFINELSGQMKVDEILRDAEALCICAGENGAASIPPGTP  176

Query  275  PSLPIQN--LLLFSQ  237
            PSLPI +   LL+SQ
Sbjct  177  PSLPIDDDSSLLYSQ  191



>gb|AIU48682.1| RabGAP/TBC domain-containing protein, partial [Lactuca sativa]
Length=351

 Score =   107 bits (268),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKR+R KI+GE+MDFDTLL+FINEL G I+L+  LRDAEALC+CAGE GAA IPPGTP
Sbjct  280  AILKRHRGKIMGEEMDFDTLLKFINELSGQIELDPVLRDAEALCVCAGENGAASIPPGTP  339

Query  275  PSLPI  261
            P+LPI
Sbjct  340  PALPI  344



>gb|AIU48672.1| RabGAP/TBC domain-containing protein, partial [Panicum virgatum]
Length=628

 Score =   110 bits (274),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 62/75 (83%), Gaps = 3/75 (4%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR +IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTP
Sbjct  557  AILKRYRQRIIGEQMDFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTP  616

Query  275  PSLPIQNLLLFSQED  231
            PS+PI+   L+ QED
Sbjct  617  PSMPIE---LYVQED  628



>gb|AIU48678.1| RabGAP/TBC domain-containing protein, partial [Setaria italica]
Length=628

 Score =   109 bits (272),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 62/75 (83%), Gaps = 3/75 (4%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR +IIGE+MDFDTLL+FINEL G I+L+  L+DAEALC  AGE GA+ IPPGTP
Sbjct  557  AILKRYRQRIIGEQMDFDTLLKFINELSGQINLDRALQDAEALCTIAGENGASCIPPGTP  616

Query  275  PSLPIQNLLLFSQED  231
            PS+PI+   L+ Q+D
Sbjct  617  PSMPIE---LYVQQD  628



>ref|XP_004953647.1| PREDICTED: TBC1 domain family member 15-like [Setaria italica]
Length=672

 Score =   109 bits (272),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR +IIGE+MDFDTLL+FINEL G I+L+  L+DAEALC  AGE GA+ IPPGTP
Sbjct  594  AILKRYRQRIIGEQMDFDTLLKFINELSGQINLDRALQDAEALCTIAGENGASCIPPGTP  653

Query  275  PSLPIQ-NLLLFSQEDD  228
            PS+PI+ +  L+ Q+DD
Sbjct  654  PSMPIETDGGLYVQQDD  670



>gb|AIU48642.1| RabGAP/TBC domain-containing protein, partial [Lilium brownii]
Length=620

 Score =   108 bits (271),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/65 (75%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK+YR KI+ E+MDFDTLL+FINEL  HIDL+ T+R+AEALC+ AGE GAA IPPGTP
Sbjct  549  AILKQYRRKIMDEQMDFDTLLKFINELSDHIDLDRTIREAEALCVLAGENGAASIPPGTP  608

Query  275  PSLPI  261
            PSLPI
Sbjct  609  PSLPI  613



>gb|AIU48679.1| RabGAP/TBC domain-containing protein, partial [Sorghum bicolor]
Length=616

 Score =   108 bits (271),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 62/75 (83%), Gaps = 3/75 (4%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK+YR +IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTP
Sbjct  545  AILKKYRQRIIGEQMDFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTP  604

Query  275  PSLPIQNLLLFSQED  231
            PS+PI+   L+ QED
Sbjct  605  PSMPIE---LYVQED  616



>gb|AIU48646.1| RabGAP/TBC domain-containing protein, partial [Brachypodium distachyon]
Length=628

 Score =   107 bits (268),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR +IIGE MDFDTLL+FINEL G I+++  ++DAEALC  AG+ GAA IPPGTP
Sbjct  557  AILKRYRQRIIGEGMDFDTLLKFINELSGQINIDQAIQDAEALCTIAGDNGAACIPPGTP  616

Query  275  PSLPIQNLLLFSQED  231
            PSLP++   L+ QED
Sbjct  617  PSLPVE---LYLQED  628



>ref|XP_003570212.1| PREDICTED: TBC1 domain family member 15 [Brachypodium distachyon]
Length=677

 Score =   107 bits (268),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR +IIGE MDFDTLL+FINEL G I+++  ++DAEALC  AG+ GAA IPPGTP
Sbjct  599  AILKRYRQRIIGEGMDFDTLLKFINELSGQINIDQAIQDAEALCTIAGDNGAACIPPGTP  658

Query  275  PSLPIQ-NLLLFSQEDD  228
            PSLP++ +  L+ QEDD
Sbjct  659  PSLPVETDGGLYLQEDD  675



>ref|NP_001047892.1| Os02g0709800 [Oryza sativa Japonica Group]
 dbj|BAD72476.1| GTPase activating protein-like [Oryza sativa Japonica Group]
 dbj|BAF09806.1| Os02g0709800 [Oryza sativa Japonica Group]
 dbj|BAG91061.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57667.1| hypothetical protein OsJ_08107 [Oryza sativa Japonica Group]
Length=679

 Score =   107 bits (266),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYRS+IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC  AG  GAA IPPGTP
Sbjct  601  AILKRYRSRIIGEQMDFDTLLKFINELSGEINLDRAIQDAEALCDQAGPNGAACIPPGTP  660

Query  275  PSLPIQ-NLLLFSQEDD  228
            PS+PI+ +  L+ QED+
Sbjct  661  PSMPIETDGGLYVQEDE  677



>ref|XP_002452666.1| hypothetical protein SORBIDRAFT_04g030250 [Sorghum bicolor]
 gb|EES05642.1| hypothetical protein SORBIDRAFT_04g030250 [Sorghum bicolor]
Length=661

 Score =   107 bits (266),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK+YR +IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTP
Sbjct  583  AILKKYRQRIIGEQMDFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTP  642

Query  275  PSLPIQ-NLLLFSQEDD  228
            PS+PI+ +  L+ QED+
Sbjct  643  PSMPIETDGGLYVQEDE  659



>gb|AIU48688.1| RabGAP/TBC domain-containing protein, partial [Zea mays]
Length=450

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 62/75 (83%), Gaps = 3/75 (4%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK+YR +IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTP
Sbjct  379  AILKKYRQRIIGEQMDFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTP  438

Query  275  PSLPIQNLLLFSQED  231
            PS+P++   ++ QED
Sbjct  439  PSMPVE---MYVQED  450



>ref|NP_001168835.1| uncharacterized protein LOC100382640 [Zea mays]
 gb|ACN30830.1| unknown [Zea mays]
 gb|AFW63576.2| hypothetical protein ZEAMMB73_375304 [Zea mays]
Length=671

 Score =   106 bits (264),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK+YR +IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTP
Sbjct  593  AILKKYRQRIIGEQMDFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTP  652

Query  275  PSLPIQ-NLLLFSQEDD  228
            PS+P++ +  ++ QED+
Sbjct  653  PSMPVETDGGMYVQEDE  669



>ref|XP_006855176.1| hypothetical protein AMTR_s00051p00106780 [Amborella trichopoda]
 gb|ERN16643.1| hypothetical protein AMTR_s00051p00106780 [Amborella trichopoda]
Length=688

 Score =   106 bits (264),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK++R KII E+MDFDTLL+FINEL  HI LE TL+DAEALC+ AGE  AA IPPGTP
Sbjct  618  AILKKHRKKIIEERMDFDTLLKFINELSCHITLEATLKDAEALCIIAGENKAACIPPGTP  677

Query  275  PSLPIQNLLL  246
            PSLP++  LL
Sbjct  678  PSLPVEGGLL  687



>gb|EMT03185.1| TBC1 domain family member 15 [Aegilops tauschii]
Length=591

 Score =   103 bits (257),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
             ILKRYR +IIGE MDFDTLL+FINEL G I+++  ++DAEALC  AGE GA  IPPGTP
Sbjct  513  GILKRYRLRIIGEGMDFDTLLKFINELSGQINIDRAIQDAEALCTIAGEAGADCIPPGTP  572

Query  275  PSLPIQ-NLLLFSQEDD  228
            PS+PI+ +  L+ QEDD
Sbjct  573  PSMPIETDGGLYLQEDD  589



>gb|AIU48659.1| RabGAP/TBC domain-containing protein, partial [Iris japonica]
Length=629

 Score =   102 bits (254),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILK ++ KI+ E+MDFDTLL+FINEL   IDL++ +RDAEALC+CAGE GAA IPPGTP
Sbjct  558  AILKSHKKKIMEEQMDFDTLLKFINELSNQIDLDSIIRDAEALCICAGENGAACIPPGTP  617

Query  275  PSLP  264
            PS P
Sbjct  618  PSCP  621



>dbj|BAK05291.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=680

 Score =   102 bits (254),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 49/77 (64%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
             IL+RYR +IIGE MDFDTLL+FINEL G I+++  ++DAEALC  AGE GA  IPPGTP
Sbjct  602  GILRRYRLRIIGEGMDFDTLLKFINELSGQINIDRAIQDAEALCTIAGERGADCIPPGTP  661

Query  275  PSLPIQ-NLLLFSQEDD  228
            PS+PI+ +  L+ QEDD
Sbjct  662  PSMPIETDGGLYLQEDD  678



>gb|KDP30256.1| hypothetical protein JCGZ_17038 [Jatropha curcas]
Length=687

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 69/78 (88%), Gaps = 2/78 (3%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            AILKRYR+KI+GE+MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA +PPGTP
Sbjct  608  AILKRYRNKIMGEQMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAACVPPGTP  667

Query  275  PSLPIQNL--LLFSQEDD  228
            PSLP +N   LL++Q+D+
Sbjct  668  PSLPPENENGLLYTQQDE  685



>gb|EMS58117.1| TBC1 domain family member 15 [Triticum urartu]
Length=583

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 2/76 (3%)
 Frame = -2

Query  449  LKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPS  270
             KRYR +IIGE MDFDTLL+FINEL G I+++  ++DAEALC  AGE GA  IPPGTPPS
Sbjct  465  FKRYRLRIIGEGMDFDTLLKFINELSGQINIDRAIQDAEALCSIAGEAGADCIPPGTPPS  524

Query  269  LPIQNL--LLFSQEDD  228
            +PI+    LL S E D
Sbjct  525  MPIETDGGLLQSPESD  540



>ref|XP_002972350.1| hypothetical protein SELMODRAFT_97576 [Selaginella moellendorffii]
 gb|EFJ26436.1| hypothetical protein SELMODRAFT_97576 [Selaginella moellendorffii]
Length=337

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKR+R KI+ E M FDTLL+FINEL GHI+L +TL  AE LC  AG+ GAA IPPGTP
Sbjct  250  ALLKRHRRKIMDEHMVFDTLLKFINELSGHINLVSTLHGAETLCRLAGDAGAACIPPGTP  309

Query  275  PSL  267
            P+L
Sbjct  310  PAL  312



>ref|XP_002971826.1| hypothetical protein SELMODRAFT_96534 [Selaginella moellendorffii]
 gb|EFJ26743.1| hypothetical protein SELMODRAFT_96534 [Selaginella moellendorffii]
Length=351

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  276
            A+LKR+R KI+ E M FDTLL+FINEL GHI+L +TL  AE LC  AG+ GAA IPPGTP
Sbjct  264  ALLKRHRRKIMDEHMVFDTLLKFINELSGHINLVSTLHGAETLCRLAGDAGAACIPPGTP  323

Query  275  PSL  267
            P+L
Sbjct  324  PAL  326



>gb|EEC73873.1| hypothetical protein OsI_08649 [Oryza sativa Indica Group]
Length=682

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  455  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLR  342
            AILKRYRS+IIGE+MDFDTLL+FINEL G I+L+  ++
Sbjct  599  AILKRYRSRIIGEQMDFDTLLKFINELSGEINLDRAIQ  636



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566299029105