BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF046B08

Length=416
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACL26686.1|  flavonoid 3'-hydroxylase                              85.5    1e-16   Ipomoea ternifolia
gb|AEH42500.1|  flavonoid 3'-hydroxylase                              85.5    2e-16   Ipomoea batatas [batate]
gb|AEH42499.1|  flavonoid 3'-hydroxylase                              85.5    2e-16   Ipomoea batatas [batate]
gb|ABW86861.1|  flavonoid 3'-hydroxylase                              85.5    2e-16   Ipomoea batatas [batate]
gb|ABW69693.1|  flavonoid 3'-hydrogenase                              85.5    2e-16   Ipomoea purpurea
dbj|BAD00187.1|  flavonoid 3'-hydroxylase                             85.5    2e-16   Ipomoea nil [qian niu]
gb|AAR00229.1|  flavonoid 3'-hydroxylase                              85.5    2e-16   Ipomoea purpurea
gb|ACB29666.1|  flavonoid 3'-hydroxylase                              85.1    2e-16   Ipomoea batatas [batate]
gb|AEH42501.1|  flavonoid 3'-hydroxylase                              85.1    2e-16   Ipomoea batatas [batate]
gb|AAS46257.1|  flavonoid 3'-hydroxylase                              84.7    3e-16   Ipomoea quamoclit [bejuco de cipres]
gb|ACS71532.1|  flavonoid 3' hydroxylase                              84.3    4e-16   Ipomoea horsfalliae [Kuhio-vine]
gb|ACL26685.1|  flavonoid 3'-hydroxylase                              84.0    5e-16   Ipomoea coccinea [red morning-glory]
dbj|BAD00189.1|  flavonoid 3'-hydroxylase                             82.4    2e-15   Ipomoea tricolor [campanilla]
dbj|BAJ11756.1|  flavonoid 3'-hydroxylase                             77.4    1e-13   Calystegia pubescens
dbj|BAJ08322.1|  flavonoid 3'-hydroxylase                             74.7    1e-12   Calystegia soldanella
gb|EPS62116.1|  hypothetical protein M569_12679                       64.7    1e-10   Genlisea aurea
emb|CDP16533.1|  unnamed protein product                              65.9    9e-10   Coffea canephora [robusta coffee]
emb|CDP19009.1|  unnamed protein product                              65.9    9e-10   Coffea canephora [robusta coffee]
gb|AFK73718.1|  cytochrome P450                                       65.9    9e-10   Papaver somniferum
emb|CDP19008.1|  unnamed protein product                              65.9    1e-09   Coffea canephora [robusta coffee]
gb|ACV74415.1|  putative flavonoid-3'-hydroxylase                     65.5    1e-09   Camellia sinensis [black tea]
gb|ADE80941.1|  flavonoid 3'-hydroxylase                              64.7    3e-09   Epimedium sagittatum
ref|XP_011072866.1|  PREDICTED: flavonoid 3'-monooxygenase            64.3    3e-09   Sesamum indicum [beniseed]
gb|EYU36856.1|  hypothetical protein MIMGU_mgv1a009393mg              63.5    3e-09   Erythranthe guttata [common monkey flower]
gb|ADZ28515.1|  flavonoid-3'-hydroxylase                              64.3    3e-09   Camellia nitidissima
gb|AAP88702.1|  flavonoid 3'-hydroxylase                              59.7    3e-09   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE71221.1|  putative flavonoid 3'-hydroxylase                    63.9    5e-09   Trifolium pratense [peavine clover]
gb|KEH32010.1|  flavonoid hydroxylase                                 63.5    5e-09   Medicago truncatula
ref|XP_010259651.1|  PREDICTED: flavonoid 3'-monooxygenase            63.5    6e-09   Nelumbo nucifera [Indian lotus]
gb|AAO47849.1|  flavonoid 3'-hydroxylase                              60.5    6e-09   Glycine max [soybeans]
gb|ADA85878.1|  flavonoid 3'-hydroxylase                              63.5    6e-09   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABB29899.1|  flavonoid 3'-hydroxylase                              63.5    6e-09   Osteospermum hybrid cultivar
gb|ADA85883.1|  flavonoid 3'-hydroxylase                              63.5    6e-09   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85882.1|  flavonoid 3'-hydroxylase                              63.5    6e-09   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85881.1|  flavonoid 3'-hydroxylase                              63.5    6e-09   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85879.1|  flavonoid 3'-hydroxylase                              63.5    6e-09   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADM26615.1|  flavonoid 3'-hydroxylase                              63.2    7e-09   Cynara cardunculus var. scolymus [artichoke]
ref|XP_004508739.1|  PREDICTED: flavonoid 3'-monooxygenase-like       62.8    1e-08   
gb|ABB53383.1|  flavonoid-3'-hydroxylase                              62.4    1e-08   Antirrhinum majus [garden snapdragon]
dbj|BAJ16330.1|  flavonoid 3'-hydroxylase                             62.4    1e-08   Antirrhinum kelloggii
gb|ACN65826.1|  flavonoid 3'-hydroxylase                              62.0    2e-08   Echinops bannaticus
ref|XP_003598945.1|  Flavonoid 3'-hydroxylase                         62.0    2e-08   Medicago truncatula
gb|AAG49298.1|AF313488_1  putative flavonoid 3'-hydroxylase           62.0    2e-08   Callistephus chinensis [Chinese aster]
gb|AAO47857.1|  flavonoid 3'-hydroxylase                              60.8    2e-08   Glycine max [soybeans]
dbj|BAF96945.1|  flavonoid 3'-hydroxylase                             61.6    2e-08   Rhododendron x pulchrum
ref|XP_010258076.1|  PREDICTED: flavonoid 3'-monooxygenase-like       61.6    2e-08   Nelumbo nucifera [Indian lotus]
gb|AIY51698.1|  flavonoid 3'-hydroxylase                              61.2    3e-08   Penstemon neomexicanus
gb|ADA85880.1|  flavonoid 3'-hydroxylase                              61.2    4e-08   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AIY51699.1|  flavonoid 3'-hydroxylase                              61.2    4e-08   Penstemon barbatus
dbj|BAE72874.1|  flavonoid 3'-hydroxylase                             60.8    4e-08   Glandularia x hybrida [garden verbena]
gb|KEH33153.1|  flavonoid hydroxylase                                 60.8    5e-08   Medicago truncatula
gb|KHN17812.1|  Flavonoid 3'-monooxygenase                            60.5    6e-08   Glycine soja [wild soybean]
gb|AGC29948.1|  CYP75B65                                              60.5    6e-08   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|NP_001237015.1|  flavonoid 3'-hydroxylase                         60.5    6e-08   Glycine max [soybeans]
gb|ACR33790.1|  flavonoid 3'-hydroxylase                              60.5    6e-08   Glycine max [soybeans]
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632           60.5    6e-08   
emb|CBI15132.3|  unnamed protein product                              59.7    9e-08   Vitis vinifera
gb|ADB77825.1|  flavonoid 3'-hydroxylase allele 1                     60.1    9e-08   Dahlia pinnata
dbj|BAH89259.1|  putative flavonoid 3'-hydroxylase                    59.7    1e-07   Diospyros kaki [Japanese persimmon]
ref|NP_196416.1|  Flavonoid 3'-monooxygenase                          59.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                     59.7    1e-07   Dahlia pinnata
ref|XP_006399285.1|  hypothetical protein EUTSA_v10013289mg           59.7    1e-07   Eutrema salsugineum [saltwater cress]
dbj|BAJ16337.1|  flavonoid 3' hydroxylase-like protein                56.6    1e-07   Torenia fournieri [bluewings]
gb|AAS91654.1|  flavonoid 3'-hydroxylase                              56.6    1e-07   Triticum aestivum [Canadian hard winter wheat]
gb|ABC47161.1|  flavonoid 3'-hydroxylase                              59.7    1e-07   Pilosella officinarum [mouse-ear hawkweed]
ref|XP_004515962.1|  PREDICTED: flavonoid 3'-monooxygenase-like       59.3    2e-07   
dbj|BAE47004.1|  flavonoid 3'-hydroxylase                             59.3    2e-07   Vitis vinifera
ref|XP_002284151.1|  PREDICTED: flavonoid 3'-monooxygenase            59.3    2e-07   Vitis vinifera
gb|ACN65827.1|  flavonoid 3'-hydroxylase                              59.3    2e-07   Centaurea cyanus [bachelor's-button]
emb|CAN62275.1|  hypothetical protein VITISV_007552                   58.9    2e-07   Vitis vinifera
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like       59.3    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase            59.3    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like       59.3    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg           58.9    2e-07   Capsella rubella
gb|AJO67972.1|  flavonoid-3'-hydroxylase                              57.0    2e-07   Prunus avium [gean]
gb|ADK56126.1|  putative flavonoid 3'-hydroxylase                     58.9    2e-07   Coreopsis grandiflora
gb|AJO67966.1|  flavonoid-3'-hydroxylase                              56.6    2e-07   Prunus avium [gean]
gb|EMS55165.1|  Flavonoid 3'-monooxygenase                            56.6    2e-07   Triticum urartu
gb|ACM62746.1|  flavonoid 3'-hydroxylase                              58.5    2e-07   Garcinia mangostana [mangosteen]
ref|XP_008794133.1|  PREDICTED: flavonoid 3'-monooxygenase-like       58.5    3e-07   Phoenix dactylifera
gb|AJD25177.1|  cytochrome P450 CYP75B79                              58.5    3e-07   Salvia miltiorrhiza [Chinese salvia]
gb|AGO03825.1|  flavonoid 3`5`-hydroxylase                            58.5    3e-07   Cichorium intybus [radicchio]
gb|AGG18092.1|  flavonoid 3'-hydroxylase                              57.4    3e-07   Prunus armeniaca
gb|AGG18103.1|  flavonoid 3'-hydroxylase                              57.0    3e-07   Prunus persica
gb|ACO35757.1|  flavonoid 3'-hydroxylase                              58.2    3e-07   Rudbeckia hirta
gb|ABA64468.1|  flavonoid 3'-hydroxylase                              58.2    3e-07   Gerbera hybrid cultivar
ref|XP_010105826.1|  Flavonoid 3'-monooxygenase                       58.2    3e-07   Morus notabilis
gb|AHY35313.1|  flavonoid 3'-hydroxylase 1                            58.2    3e-07   Morus notabilis
gb|AIT52346.1|  flavonoid 3'-monooxygenase 1                          58.2    4e-07   Daucus carota [carrots]
dbj|BAB59005.1|  flavonoid 3'-hydroxylase                             58.2    4e-07   Perilla frutescens var. crispa
gb|EMT05634.1|  Flavonoid 3'-monooxygenase                            56.2    4e-07   
gb|AES69199.2|  flavonoid hydroxylase                                 57.8    4e-07   Medicago truncatula
gb|AIU98513.1|  flavonoid 3'-hydroxylase                              57.8    4e-07   Paeonia suffruticosa [moutan peony]
gb|AAO47851.1|  flavonoid 3'-hydroxylase                              57.4    4e-07   Glycine max [soybeans]
ref|NP_001267916.1|  flavonoid 3' hydroxylase                         57.8    5e-07   Vitis vinifera
ref|XP_011011227.1|  PREDICTED: flavonoid 3'-monooxygenase            57.8    5e-07   Populus euphratica
gb|AEN71546.1|  flavanone 3'-hydroxylase                              57.8    5e-07   Paeonia suffruticosa [moutan peony]
ref|XP_010936313.1|  PREDICTED: flavonoid 3'-monooxygenase-like       57.8    5e-07   Elaeis guineensis
gb|AIY22748.1|  flavonoid 3'-hydroxylase                              57.8    5e-07   Iochroma calycinum
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                             57.8    5e-07   Gynura bicolor
ref|XP_006665050.1|  PREDICTED: flavonoid 3'-monooxygenase-like       57.8    6e-07   Oryza brachyantha
gb|AIY22749.1|  flavonoid 3'-hydroxylase                              57.4    6e-07   Iochroma cyaneum
gb|KCW83706.1|  hypothetical protein EUGRSUZ_B00580                   57.4    6e-07   Eucalyptus grandis [rose gum]
gb|AIY22747.1|  flavonoid 3'-hydroxylase                              57.4    6e-07   Iochroma calycinum
emb|CAI54278.1|  flavonoid-3'-hydroxylase                             57.4    6e-07   Vitis vinifera
ref|XP_003598948.1|  Flavonoid 3'-hydroxylase                         57.4    6e-07   
gb|KCW83705.1|  hypothetical protein EUGRSUZ_B00580                   57.4    6e-07   Eucalyptus grandis [rose gum]
emb|CAN68303.1|  hypothetical protein VITISV_041731                   57.4    7e-07   Vitis vinifera
dbj|BAE47005.1|  flavonoid 3'-hydroxylase                             57.4    7e-07   Vitis vinifera
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                            57.4    7e-07   Prunus avium [gean]
ref|XP_002514665.1|  flavonoid 3-hydroxylase, putative                57.0    7e-07   
gb|AEX07282.1|  F3'H                                                  57.4    7e-07   Arachis hypogaea [goober]
ref|XP_008240031.1|  PREDICTED: flavonoid 3'-monooxygenase            57.0    8e-07   Prunus mume [ume]
ref|XP_007209917.1|  hypothetical protein PRUPE_ppa004433mg           57.0    8e-07   Prunus persica
gb|ACN38268.1|  flavonoid 3' hydroxylase                              57.0    8e-07   Vitis amurensis
ref|XP_006837147.1|  hypothetical protein AMTR_s00110p00149730        57.0    9e-07   
ref|XP_010030579.1|  PREDICTED: flavonoid 3'-monooxygenase-like       57.0    9e-07   Eucalyptus grandis [rose gum]
gb|ACO35755.1|  chalcone 3-hydroxylase                                57.0    1e-06   Cosmos sulphureus [orange cosmos]
gb|AGL81348.1|  flavanone 3' hydroxylase                              56.6    1e-06   Pyrus communis
gb|ACO35754.1|  flavonoid 3'-hydroxylase                              56.6    1e-06   Dahlia pinnata
ref|XP_009338402.1|  PREDICTED: flavonoid 3'-monooxygenase            56.6    1e-06   Pyrus x bretschneideri [bai li]
gb|ACN65825.1|  flavonoid 3'-hydroxylase                              56.6    1e-06   Cichorium intybus [radicchio]
gb|ACR14869.1|  flavonoid 3' hydroxylase IIb                          56.6    1e-06   Malus domestica [apple tree]
gb|ACR14867.1|  flavonoid 3' hydroxylase                              56.6    1e-06   Malus domestica [apple tree]
ref|XP_008393217.1|  PREDICTED: flavonoid 3'-monooxygenase-like       56.6    1e-06   
ref|XP_007138248.1|  hypothetical protein PHAVU_009G192400g           56.6    1e-06   Phaseolus vulgaris [French bean]
gb|ACO35756.1|  flavonoid 3'-hydroxylase                              56.6    1e-06   Tagetes erecta [big marigold]
gb|AHA49900.1|  flavonoid 3' hydroxylase                              56.6    1e-06   Malus hybrid cultivar
ref|XP_008374610.1|  PREDICTED: flavonoid 3'-monooxygenase-like       56.6    1e-06   Malus domestica [apple tree]
dbj|BAF49324.1|  flavonoid 3'-hydroxylase                             56.2    1e-06   Lobelia erinus
dbj|BAO58432.1|  flavonoid 3'-hydroxylase                             56.2    1e-06   Vaccinium ashei
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                              56.2    1e-06   Eustoma exaltatum subsp. russellianum [bluebells]
gb|AHY35314.1|  flavonoid 3'-hydroxylase 2                            56.2    1e-06   Morus notabilis
ref|XP_003598947.1|  Flavonoid 3'-hydroxylase                         55.5    1e-06   
ref|XP_008791304.1|  PREDICTED: flavonoid 3'-monooxygenase-like       56.2    2e-06   Phoenix dactylifera
ref|XP_002319761.1|  hypothetical protein POPTR_0013s07050g           56.2    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_009394321.1|  PREDICTED: flavonoid 3'-monooxygenase            56.2    2e-06   
ref|XP_007037548.1|  Flavonoid 3'-hydroxylase isoform 2               56.2    2e-06   Theobroma cacao [chocolate]
ref|XP_010105825.1|  Flavonoid 3'-monooxygenase                       56.2    2e-06   Morus notabilis
ref|XP_003574810.2|  PREDICTED: flavonoid 3'-monooxygenase-like       56.2    2e-06   Brachypodium distachyon [annual false brome]
ref|XP_010030575.1|  PREDICTED: flavonoid 3'-monooxygenase-like       55.8    2e-06   Eucalyptus grandis [rose gum]
gb|EYU23554.1|  hypothetical protein MIMGU_mgv1a004224mg              55.8    2e-06   Erythranthe guttata [common monkey flower]
gb|KJB51032.1|  hypothetical protein B456_008G198200                  55.8    2e-06   Gossypium raimondii
gb|ACY06905.1|  flavonoid 3'-hydroxylase                              55.8    2e-06   Gossypium hirsutum [American cotton]
gb|ADP24158.1|  flavonoid 3'-hydroxylase                              55.8    2e-06   Gossypium hirsutum [American cotton]
gb|KHG07922.1|  Flavonoid 3',5'-hydroxylase                           55.8    2e-06   Gossypium arboreum [tree cotton]
gb|AFI71898.1|  flavonoid 3'-hydroxylase                              55.5    3e-06   Paeonia lactiflora [common garden peony]
ref|NP_001064338.1|  Os10g0320100                                     55.5    3e-06   
gb|AJD25178.1|  cytochrome P450 CYP75B80                              55.5    3e-06   Salvia miltiorrhiza [Chinese salvia]
ref|NP_001141292.1|  uncharacterized protein LOC100273383             55.5    3e-06   
ref|XP_008678758.1|  PREDICTED: flavonoid 3'-monooxygenase-like       55.5    3e-06   Zea mays [maize]
ref|XP_010030596.1|  PREDICTED: flavonoid 3'-monooxygenase-like       55.5    3e-06   Eucalyptus grandis [rose gum]
gb|KDP31334.1|  hypothetical protein JCGZ_11710                       55.1    3e-06   Jatropha curcas
gb|AGO02167.1|  flavonoid 3'-hydroxylase                              55.1    3e-06   Nekemias grossedentata
gb|AGT50323.1|  flavonoid 3'-hydroxylase                              55.1    4e-06   Meconopsis pseudohorridula
gb|AFW72123.1|  red aleurone1                                         55.1    4e-06   
gb|AGT50319.1|  flavonoid 3'-hydroxylase                              55.1    4e-06   Meconopsis quintuplinervia
gb|AEE60887.1|  flavonoid 3'-hydroxylase                              55.1    4e-06   Fragaria virginiana
ref|NP_001274347.1|  uncharacterized protein LOC101314754             55.1    4e-06   Fragaria vesca [alpine strawberry]
gb|ACO35752.1|  flavonoid 3'-hydroxylase                              55.1    4e-06   Cosmos sulphureus [orange cosmos]
gb|AIB06740.1|  flavanone 3'-hydroxylase                              55.1    4e-06   Mangifera indica
gb|AEE60885.1|  flavonoid 3'-hydroxylase                              55.1    4e-06   Fragaria x ananassa
gb|AEE60886.1|  flavonoid 3'-hydroxylase                              55.1    4e-06   Fragaria x ananassa
gb|AEE60883.1|  flavonoid 3'-hydroxylase                              54.7    4e-06   Fragaria vesca [alpine strawberry]
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                 54.7    4e-06   Callistephus chinensis [Chinese aster]
gb|AFW62812.1|  putative cytochrome P450 superfamily protein          55.1    4e-06   
gb|AEE60888.1|  flavonoid 3'-hydroxylase                              54.7    4e-06   Fragaria chiloensis
gb|AJA79074.1|  flavonoid 3' hydroxylase                              54.7    4e-06   Prunus persica
dbj|BAL63027.1|  flavonoid 3'-hydroxylase                             54.7    5e-06   Fragaria x ananassa
gb|ADG21952.1|  flavonoid 3'-hydroxylase                              50.8    5e-06   Morella rubra [Chinese arbutus]
gb|ABG54321.1|  flavonoid 3'-hydroxylase                              54.7    5e-06   Sorghum bicolor [broomcorn]
ref|XP_002452385.1|  hypothetical protein SORBIDRAFT_04g024730        54.7    5e-06   Sorghum bicolor [broomcorn]
gb|AGT50324.1|  flavonoid 3'-hydroxylase                              54.7    5e-06   Papaver nudicaule [Arctic poppy]
gb|AGT50313.1|  flavonoid 3'-hydroxylase                              54.7    5e-06   Meconopsis lancifolia
sp|Q9SBQ9.1|F3PH_PETHY  RecName: Full=Flavonoid 3'-monooxygenase;...  54.7    6e-06   Petunia x hybrida [garden petunia]
gb|AGT50325.1|  flavonoid 3'-hydroxylase                              54.3    6e-06   Papaver radicatum
ref|XP_006440736.1|  hypothetical protein CICLE_v10019637mg           54.3    7e-06   
ref|XP_010695197.1|  PREDICTED: flavonoid 3'-monooxygenase            54.3    7e-06   Beta vulgaris subsp. vulgaris [field beet]
gb|AGT50311.1|  flavonoid 3'-hydroxylase                              54.3    7e-06   Meconopsis horridula [prickly blue-poppy]
gb|AGT50318.1|  flavonoid 3'-hydroxylase                              54.3    7e-06   Meconopsis punicea [red poppywort]
dbj|BAB87839.1|  flavonoid 3'-hydroxalase                             53.9    8e-06   Torenia hybrid cultivar
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase            53.9    9e-06   Brassica rapa
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                    53.9    9e-06   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_010939156.1|  PREDICTED: flavonoid 3'-monooxygenase-like       53.9    1e-05   Elaeis guineensis
ref|XP_002454110.1|  hypothetical protein SORBIDRAFT_04g024750        53.9    1e-05   
ref|XP_009771410.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...  53.9    1e-05   Nicotiana sylvestris
emb|CDX99037.1|  BnaC09g47980D                                        53.9    1e-05   
gb|AAS48419.1|  flavonoid 3'-hydroxylase                              53.5    1e-05   Allium cepa
gb|AFQ92056.1|  flavonoid 3' hydroxylase                              53.5    1e-05   Pyrus pyrifolia [sha li]
ref|XP_004983036.1|  PREDICTED: flavonoid 3'-monooxygenase-like       53.5    1e-05   Setaria italica
dbj|BAD91808.1|  flavonoid 3'-hydroxylase                             53.5    1e-05   Gentiana triflora
ref|XP_003525450.1|  PREDICTED: flavonoid 3'-monooxygenase-like       53.5    1e-05   Glycine max [soybeans]
gb|KHN48734.1|  Flavonoid 3'-monooxygenase                            53.5    1e-05   Glycine soja [wild soybean]
gb|ABB43031.1|  flavonoid 3'5'-hydroxylase                            53.1    1e-05   Osteospermum hybrid cultivar
gb|ACO35753.1|  flavonoid 3'-hydroxylase                              53.1    1e-05   Bidens aurea
gb|EMT22073.1|  Flavonoid 3'-monooxygenase                            52.8    2e-05   
gb|AGI16386.1|  flavonoid 3' hydroxylase                              53.1    2e-05   Ribes nigrum [European black currant]
gb|AHB18038.1|  flavonoid 3'-hydroxylase                              52.4    2e-05   Anthurium andraeanum [flamingo-lily]
gb|ABG54319.1|  flavonoid 3'-hydroxylase                              52.8    2e-05   Sorghum bicolor [broomcorn]
gb|AAG49301.1|AF313491_1  flavonoid 3'-hydroxylase                    52.8    2e-05   Matthiola incana
ref|XP_006477655.1|  PREDICTED: flavonoid 3'-monooxygenase-like       52.4    3e-05   Citrus sinensis [apfelsine]
dbj|BAN05297.1|  flavonoid 3'-hydroxylase                             52.4    3e-05   Dianthus caryophyllus [carnation]
dbj|BAJ98136.1|  predicted protein                                    52.4    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002452380.1|  hypothetical protein SORBIDRAFT_04g024710        52.4    3e-05   Sorghum bicolor [broomcorn]
gb|ABG54320.1|  flavonoid 3'-hydroxylase                              52.4    3e-05   Sorghum bicolor [broomcorn]
gb|AAV74194.1|  flavonoid 3'-hydroxylase                              52.4    3e-05   Sorghum bicolor [broomcorn]
ref|XP_006345132.1|  PREDICTED: flavonoid 3'-monooxygenase-like       52.0    3e-05   Solanum tuberosum [potatoes]
gb|AAX19888.1|  flavonoid-3',5'-hydroxylase                           52.0    3e-05   Pericallis cruenta
gb|EMS66050.1|  Flavonoid 3'-monooxygenase                            51.6    4e-05   Triticum urartu
gb|AHZ08763.1|  flavonoid 3'-monooxygenase                            52.0    4e-05   Nicotiana tabacum [American tobacco]
ref|XP_009788494.1|  PREDICTED: flavonoid 3'-monooxygenase            52.0    4e-05   Nicotiana sylvestris
gb|AIC73642.1|  flavonoid 3'-hydroxylase                              51.6    5e-05   Anthurium andraeanum [flamingo-lily]
dbj|BAM28972.1|  flavonoid 3'-hydroxylase                             51.6    5e-05   Lilium hybrid division I
dbj|BAM28971.1|  flavonoid 3'-hydroxylase                             51.6    6e-05   Lilium hybrid division I
gb|AGT50309.1|  flavonoid 3'-hydroxylase                              51.2    6e-05   Meconopsis delavayi
ref|XP_006579509.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...  51.2    6e-05   
ref|XP_003525448.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...  51.2    6e-05   Glycine max [soybeans]
gb|KHN48735.1|  Flavonoid 3'-monooxygenase                            51.2    6e-05   Glycine soja [wild soybean]
ref|XP_007155244.1|  hypothetical protein PHAVU_003G1855001g          50.8    7e-05   Phaseolus vulgaris [French bean]
ref|XP_007155243.1|  hypothetical protein PHAVU_003G1855001g          50.8    7e-05   Phaseolus vulgaris [French bean]
ref|XP_007155245.1|  hypothetical protein PHAVU_003G1855001g          50.8    7e-05   Phaseolus vulgaris [French bean]
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                    51.2    7e-05   Pelargonium x hortorum [bedding geranium]
gb|ABM46853.1|  flavonoid 3'-hydroxylase                              51.2    7e-05   Ageratina adenophora
dbj|BAB87838.1|  flavonoid 3'-hydroxylase                             51.2    8e-05   Torenia hybrid cultivar
ref|XP_002978324.1|  hypothetical protein SELMODRAFT_108642           48.9    8e-05   
ref|XP_003525447.1|  PREDICTED: flavonoid 3'-monooxygenase-like       51.2    8e-05   Glycine max [soybeans]
ref|XP_002439914.1|  hypothetical protein SORBIDRAFT_09g022480        50.8    8e-05   Sorghum bicolor [broomcorn]
gb|AHZ31753.1|  flavonoid 3'-hydroxylase                              50.8    9e-05   Viola x wittrockiana
ref|XP_002970157.1|  hypothetical protein SELMODRAFT_93320            48.5    1e-04   
dbj|BAM28973.1|  flavonoid 3'-hydroxylase                             50.4    1e-04   Lilium hybrid division I
gb|AHI58943.1|  flavonoid 3'-hydroxylase                              50.4    1e-04   Nicotiana tabacum [American tobacco]
ref|XP_009597267.1|  PREDICTED: flavonoid 3'-monooxygenase            50.4    1e-04   Nicotiana tomentosiformis
ref|XP_007037547.1|  Flavonoid 3'-hydroxylase isoform 1               50.4    1e-04   
gb|ABB43030.1|  flavonoid 3'5'-hydroxylase                            50.4    1e-04   Pericallis cruenta
gb|AGT28741.1|  flavonoid 3'-hydroxylase                              50.1    1e-04   Fragaria x ananassa
ref|NP_001289844.1|  flavonoid 3'-monooxygenase                       50.1    2e-04   Solanum lycopersicum
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                            49.7    2e-04   Echinops bannaticus
gb|AGG40645.1|  flavanone 3'-hydroxylase                              49.7    2e-04   Narcissus tazetta
emb|CDX69984.1|  BnaA10g23330D                                        49.7    2e-04   
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                    49.7    2e-04   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|ABC58722.1|  flavonoid 3'-hydroxylase                              49.7    2e-04   Brassica napus [oilseed rape]
ref|XP_010233685.1|  PREDICTED: flavonoid 3'-monooxygenase-like       49.7    2e-04   Brachypodium distachyon [annual false brome]
dbj|BAN62871.1|  flavonoid 3'-hydroxylase                             49.3    3e-04   Dianthus caryophyllus [carnation]
ref|XP_003562884.1|  PREDICTED: flavonoid 3'-monooxygenase-like       49.3    3e-04   
gb|AGO03826.1|  flavonoid 3`5`-hydroxylase                            49.3    3e-04   Billardiera heterophylla
ref|XP_003577475.1|  PREDICTED: flavonoid 3'-monooxygenase-like       49.3    3e-04   Brachypodium distachyon [annual false brome]
gb|AII26679.1|  flavonoid 3'-monooxygenase                            49.3    3e-04   Indosasa hispida
gb|AII26680.1|  flavonoid 3'-hydroxylase                              49.3    3e-04   Indosasa hispida
gb|AEF33624.1|  flavonoid 3' hydroxylase                              49.3    3e-04   Zea mays [maize]
dbj|BAJ95115.1|  predicted protein                                    49.3    3e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFP95893.1|  F3'H                                                  48.9    4e-04   Narcissus tazetta
gb|AHL83556.1|  flavonoid-3'-hydroxylase                              48.5    5e-04   Iris x hollandica [Dutch iris]
gb|AEA06595.1|  flavonoid 3'-hydroxylase                              48.5    5e-04   Chromolaena odorata
gb|ABV80349.1|  cytochrome P450-dependent monooxygenase               48.5    5e-04   Selaginella moellendorffii
gb|AHX02955.1|  flavonoid 3'5'-hydroxylase                            48.1    7e-04   Iris x hollandica [Dutch iris]



>gb|ACL26686.1| flavonoid 3'-hydroxylase [Ipomoea ternifolia]
Length=519

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  480  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>gb|AEH42500.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  479  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  518



>gb|AEH42499.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  479  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  518



>gb|ABW86861.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=517

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  478  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  517



>gb|ABW69693.1| flavonoid 3'-hydrogenase [Ipomoea purpurea]
Length=519

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  480  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>dbj|BAD00187.1| flavonoid 3'-hydroxylase [Ipomoea nil]
 dbj|BAD00190.1| flavonoid 3'-hydroxylase [Ipomoea nil]
Length=519

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  480  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>gb|AAR00229.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00188.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00191.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
Length=519

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  480  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>gb|ACB29666.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            NGQSVETLNMEEAYGLTLQRA+PLMLHPKPRLQPHLYTLN
Sbjct  479  NGQSVETLNMEEAYGLTLQRAIPLMLHPKPRLQPHLYTLN  518



>gb|AEH42501.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            NGQSVETLNMEEAYGLTLQRA+PLMLHPKPRLQPHLYTLN
Sbjct  479  NGQSVETLNMEEAYGLTLQRAIPLMLHPKPRLQPHLYTLN  518



>gb|AAS46257.1| flavonoid 3'-hydroxylase [Ipomoea quamoclit]
Length=519

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            NGQSVETLNMEE+YGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  480  NGQSVETLNMEESYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>gb|ACS71532.1| flavonoid 3' hydroxylase [Ipomoea horsfalliae]
Length=517

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            NGQSV+TLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  478  NGQSVDTLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  517



>gb|ACL26685.1| flavonoid 3'-hydroxylase [Ipomoea coccinea]
Length=519

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            NGQSVETLNMEEAYGLTLQR VPLMLHPKPRLQPHLYTLN
Sbjct  480  NGQSVETLNMEEAYGLTLQRVVPLMLHPKPRLQPHLYTLN  519



>dbj|BAD00189.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
 dbj|BAD00192.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
Length=522

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            +GQSV+TLNMEEAYGLTLQRAVPLMLHPKPRLQPH+YTLN
Sbjct  483  DGQSVDTLNMEEAYGLTLQRAVPLMLHPKPRLQPHIYTLN  522



>dbj|BAJ11756.1| flavonoid 3'-hydroxylase [Calystegia pubescens]
Length=520

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +GQS+ETLNMEEAYGLTLQRAVPLM+HPKPRLQPHLY+
Sbjct  483  SGQSIETLNMEEAYGLTLQRAVPLMVHPKPRLQPHLYS  520



>dbj|BAJ08322.1| flavonoid 3'-hydroxylase [Calystegia soldanella]
Length=520

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +GQS+ETLNMEEAYGLTLQRAVPLM+HPKPRLQPH Y+
Sbjct  483  SGQSIETLNMEEAYGLTLQRAVPLMVHPKPRLQPHQYS  520



>gb|EPS62116.1| hypothetical protein M569_12679, partial [Genlisea aurea]
Length=91

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG+S  +LNMEEAYGLTLQRA PL+LHP+PRLQ H+Y
Sbjct  53   NGKSATSLNMEEAYGLTLQRAEPLILHPRPRLQAHVY  89



>emb|CDP16533.1| unnamed protein product [Coffea canephora]
Length=452

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NGQ  E LNMEEAYGLTLQRA PLM+HP+PRL+PH Y
Sbjct  414  NGQVAEKLNMEEAYGLTLQRASPLMVHPRPRLKPHSY  450



>emb|CDP19009.1| unnamed protein product [Coffea canephora]
Length=511

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NGQ  E LNMEEAYGLTLQRA PLM+HPKPRL P++Y
Sbjct  475  NGQGAEKLNMEEAYGLTLQRASPLMVHPKPRLAPYIY  511



>gb|AFK73718.1| cytochrome P450 [Papaver somniferum]
Length=475

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            GQ +E LNM+EAYGLTLQRA PLM+HPKPRL+ H+Y+
Sbjct  435  GQVIEKLNMDEAYGLTLQRASPLMVHPKPRLEAHVYS  471



>emb|CDP19008.1| unnamed protein product [Coffea canephora]
 emb|CDP16354.1| unnamed protein product [Coffea canephora]
Length=511

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NGQ  E LNMEEAYGLTLQRA PLM+HPKPRL P++Y
Sbjct  475  NGQGAEKLNMEEAYGLTLQRASPLMVHPKPRLAPYIY  511



>gb|ACV74415.1| putative flavonoid-3'-hydroxylase [Camellia sinensis]
Length=518

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +GQS E LNM+EAYGLTLQRA PLM+HP PRL PH+Y
Sbjct  480  DGQSTEKLNMDEAYGLTLQRAAPLMVHPWPRLAPHVY  516



>gb|ADE80941.1| flavonoid 3'-hydroxylase [Epimedium sagittatum]
Length=514

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            GQ VE LNMEE+YGLTLQRA PL++HP+PRL PH+Y  N
Sbjct  474  GQMVEKLNMEESYGLTLQRAAPLVVHPRPRLAPHVYQTN  512



>ref|XP_011072866.1| PREDICTED: flavonoid 3'-monooxygenase [Sesamum indicum]
Length=511

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +GQ  ETL+MEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  473  DGQLAETLSMEEAYGLTLQRAEPLMVHPKPRLAPHVY  509



>gb|EYU36856.1| hypothetical protein MIMGU_mgv1a009393mg [Erythranthe guttata]
Length=343

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NGQ  ETLNMEEAYGLTLQR  PL +HPKPRL PHLY
Sbjct  304  NGQLPETLNMEEAYGLTLQRDEPLSVHPKPRLAPHLY  340



>gb|ADZ28515.1| flavonoid-3'-hydroxylase [Camellia nitidissima]
Length=518

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +GQS E L M+EAYGLTLQRA PLM+HP+PRL PH+Y
Sbjct  480  DGQSAEKLKMDEAYGLTLQRAAPLMVHPRPRLAPHVY  516



>gb|AAP88702.1| flavonoid 3'-hydroxylase [Arabidopsis thaliana]
Length=47

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
             G + E LNMEE+YGLTLQRAVPL++HPKPRL P++Y L 
Sbjct  6    GGVTPEKLNMEESYGLTLQRAVPLVVHPKPRLAPNVYGLG  45



>dbj|BAE71221.1| putative flavonoid 3'-hydroxylase [Trifolium pratense]
Length=510

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG S E LNM+EAYGLTLQRAVP++ HP+PRL PHLY
Sbjct  473  NGLSPEKLNMDEAYGLTLQRAVPILAHPRPRLSPHLY  509



>gb|KEH32010.1| flavonoid hydroxylase [Medicago truncatula]
Length=510

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG S E LNM+EAYGLTLQRAVP++ HP+PRL PHLY
Sbjct  473  NGVSPEKLNMDEAYGLTLQRAVPILAHPRPRLSPHLY  509



>ref|XP_010259651.1| PREDICTED: flavonoid 3'-monooxygenase [Nelumbo nucifera]
Length=513

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNMEEAYGLTLQRAVPL +HP+PRL PH+Y
Sbjct  474  GQMAEKLNMEEAYGLTLQRAVPLTVHPRPRLAPHVY  509



>gb|AAO47849.1| flavonoid 3'-hydroxylase [Glycine max]
Length=140

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  105  EKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  139



>gb|ADA85878.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  469  NGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|ABB29899.1| flavonoid 3'-hydroxylase [Osteospermum hybrid cultivar]
Length=514

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            NG   E LNMEEAYGLTLQRA PL++HPKPRL PH+Y  N
Sbjct  475  NGLKPEKLNMEEAYGLTLQRAAPLLVHPKPRLAPHVYGSN  514



>gb|ADA85883.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
 gb|AGX01487.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  469  NGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|ADA85882.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  469  NGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|ADA85881.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  469  NGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|ADA85879.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  469  NGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|ADM26615.1| flavonoid 3'-hydroxylase [Cynara cardunculus var. scolymus]
Length=512

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNMEEAYGLTLQRA PLM+HP PRL PHLY
Sbjct  473  NGLDPEKLNMEEAYGLTLQRAAPLMVHPSPRLAPHLY  509



>ref|XP_004508739.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=503

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            NG + E LNM EAYGLTLQR VPL++HP+PRL PHLY+
Sbjct  466  NGCNPEKLNMAEAYGLTLQREVPLLVHPRPRLSPHLYS  503



>gb|ABB53383.1| flavonoid-3'-hydroxylase [Antirrhinum majus]
Length=520

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +GQ  E+LNMEEAYGLTLQRA PL++HPKPRL PH+Y
Sbjct  482  DGQLPESLNMEEAYGLTLQRADPLVVHPKPRLAPHVY  518



>dbj|BAJ16330.1| flavonoid 3'-hydroxylase [Antirrhinum kelloggii]
Length=509

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +GQ  E LNMEEAYGLTLQRA PL+LHPKPRL PH+Y
Sbjct  471  DGQLPERLNMEEAYGLTLQRADPLVLHPKPRLAPHVY  507



>gb|ACN65826.1| flavonoid 3'-hydroxylase [Echinops bannaticus]
Length=508

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   + LNMEEAYGLTLQRA PLM+HP+PRL PH+Y
Sbjct  469  NGLDPDKLNMEEAYGLTLQRATPLMVHPRPRLAPHVY  505



>ref|XP_003598945.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
 gb|AES69196.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            NG +   +NM+E YGLTLQRAVPL++HPKPRL PH+Y+
Sbjct  476  NGLNAGKMNMDEGYGLTLQRAVPLLVHPKPRLSPHVYS  513



>gb|AAG49298.1|AF313488_1 putative flavonoid 3'-hydroxylase [Callistephus chinensis]
Length=518

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNMEEAYGLTLQRA PLM+HP+PRL PH+Y
Sbjct  479  NGLDPEKLNMEEAYGLTLQRAEPLMVHPRPRLSPHVY  515



>gb|AAO47857.1| flavonoid 3'-hydroxylase, partial [Glycine max]
Length=323

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  288  EKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  322



>dbj|BAF96945.1| flavonoid 3'-hydroxylase [Rhododendron x pulchrum]
Length=480

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            G+S E LNM+EAYGLTLQRA PLM+HP+PRL  HLY
Sbjct  443  GKSAEKLNMDEAYGLTLQRADPLMVHPRPRLAAHLY  478



>ref|XP_010258076.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
 ref|XP_010258077.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
Length=516

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            GQ+ E LNMEEAYGLTLQRAVPL++H +PRL PH+Y 
Sbjct  474  GQTPENLNMEEAYGLTLQRAVPLLVHTRPRLAPHVYC  510



>gb|AIY51698.1| flavonoid 3'-hydroxylase [Penstemon neomexicanus]
Length=517

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NGQ  E LNMEEAYGL L RA PLM+HPKPRL+PH+Y
Sbjct  479  NGQLPENLNMEEAYGLQLTRADPLMVHPKPRLEPHVY  515



>gb|ADA85880.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  474  EMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|AIY51699.1| flavonoid 3'-hydroxylase [Penstemon barbatus]
Length=517

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NGQ  E LNMEEAYGL L RA PLM+HPKPRL+PH+Y
Sbjct  479  NGQLPENLNMEEAYGLQLTRADPLMVHPKPRLEPHVY  515



>dbj|BAE72874.1| flavonoid 3'-hydroxylase [Verbena x hybrida]
Length=465

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG S + L+MEEAYGLTLQRA PL++HPKPRL PH+Y
Sbjct  421  NGLSAQQLSMEEAYGLTLQRAEPLVVHPKPRLAPHVY  457



>gb|KEH33153.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            NG +   +NM+E YGLTLQRAVPL +HPKPRL PH+Y+
Sbjct  476  NGLNAGKMNMDEGYGLTLQRAVPLSVHPKPRLSPHVYS  513



>gb|KHN17812.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=513

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  478  EKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  512



>gb|AGC29948.1| CYP75B65 [Sinopodophyllum hexandrum]
Length=510

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNM+EAYGLTLQRAVPL++HP+PRL PH Y
Sbjct  475  GQMPEKLNMDEAYGLTLQRAVPLVVHPQPRLAPHAY  510



>ref|NP_001237015.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAB83261.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47846.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47847.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAD97828.1| flavonoid 3'- hydroxylase [Glycine max]
 gb|ABW69385.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ABW69386.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ACN81827.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  478  EKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  512



>gb|ACR33790.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  478  EKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  512



>ref|XP_002871298.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47557.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
Length=514

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
             G + E LNMEE+YGLTLQRAVPLM+HPKPRL P++Y + 
Sbjct  473  GGITPEKLNMEESYGLTLQRAVPLMVHPKPRLAPNVYGIG  512



>emb|CBI15132.3| unnamed protein product [Vitis vinifera]
Length=451

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  351  GQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVF  386



>gb|ADB77825.1| flavonoid 3'-hydroxylase allele 1 [Dahlia pinnata]
Length=508

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G   E LNM EAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  469  SGLQAEKLNMTEAYGLTLQRAEPLMVHPKPRLAPHVY  505



>dbj|BAH89259.1| putative flavonoid 3'-hydroxylase [Diospyros kaki]
Length=416

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            G+  E LNM+EAYGLTLQRAVPLM+HP+PRL  H+Y
Sbjct  379  GEEPEKLNMDEAYGLTLQRAVPLMVHPRPRLAGHVY  414



>ref|NP_196416.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
 sp|Q9SD85.1|F3PH_ARATH RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B1; AltName: Full=Flavonoid 3'-hydroxylase; Short=AtF3'H; 
AltName: Full=Protein TRANSPARENT TESTA 7 [Arabidopsis 
thaliana]
 gb|AAF73253.1|AF155171_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16745.1|AF271650_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16746.1|AF271651_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 emb|CAB62611.1| flavonoid 3'-hydroxylase-like protein [Arabidopsis thaliana]
 gb|AAF60189.1| flavonoid 3'hydroxylase [Arabidopsis thaliana]
 gb|AED91232.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
Length=513

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
             G + E LNMEE+YGLTLQRAVPL++HPKPRL P++Y L 
Sbjct  472  GGVTPEKLNMEESYGLTLQRAVPLVVHPKPRLAPNVYGLG  511



>gb|ADB77826.1| flavonoid 3'-hydroxylase allele 2 [Dahlia pinnata]
Length=508

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G   E LNM EAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  469  SGLQAEKLNMTEAYGLTLQRAEPLMVHPKPRLAPHVY  505



>ref|XP_006399285.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
 gb|ESQ40738.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
Length=510

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
             G + E LNMEEAYG+TLQRAVPL++HPKPRL P +Y L 
Sbjct  469  GGITPEKLNMEEAYGITLQRAVPLVVHPKPRLAPGIYGLG  508



>dbj|BAJ16337.1| flavonoid 3' hydroxylase-like protein, partial [Torenia fournieri]
Length=121

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   + LNMEEAYGLTLQRA PL++HP+PRL  H+Y
Sbjct  85   NGLLAQNLNMEEAYGLTLQRAEPLLVHPRPRLATHVY  121



>gb|AAS91654.1| flavonoid 3'-hydroxylase [Triticum aestivum]
Length=134

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            +G + E L+MEEAYGLTLQRAVPLM+ P PRL P  YT+
Sbjct  96   DGMTPEKLDMEEAYGLTLQRAVPLMVQPVPRLLPSAYTM  134



>gb|ABC47161.1| flavonoid 3'-hydroxylase [Pilosella officinarum]
Length=512

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG     LNMEEAYGLTLQRA PLM+HP+PRL PH+Y
Sbjct  473  NGLEPRNLNMEEAYGLTLQRAQPLMVHPRPRLAPHVY  509



>ref|XP_004515962.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=507

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            NG + +T+NMEEAYGLTLQRAVPL +HPK RL  H+Y+
Sbjct  469  NGLNEKTMNMEEAYGLTLQRAVPLSVHPKRRLSQHVYS  506



>dbj|BAE47004.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  472  GQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVF  507



>ref|XP_002284151.1| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
 emb|CAN75347.1| hypothetical protein VITISV_002956 [Vitis vinifera]
Length=509

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  472  GQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVF  507



>gb|ACN65827.1| flavonoid 3'-hydroxylase [Centaurea cyanus]
Length=514

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNM+EAYGLTLQR VPLM+HP PRL P LY
Sbjct  475  NGLDSEKLNMKEAYGLTLQRDVPLMVHPSPRLAPELY  511



>emb|CAN62275.1| hypothetical protein VITISV_007552 [Vitis vinifera]
Length=471

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  434  GQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVF  469



>ref|XP_010491421.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
             G + E LNMEE YGLTLQRAVPL++HPKPRL P++Y L 
Sbjct  468  GGVTPEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYGLG  507



>ref|XP_010452770.1| PREDICTED: flavonoid 3'-monooxygenase [Camelina sativa]
Length=509

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
             G + E LNMEE YGLTLQRAVPL++HPKPRL P++Y L 
Sbjct  468  GGVTPEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYGLG  507



>ref|XP_010423152.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
             G + E LNMEE YGLTLQRAVPL++HPKPRL P++Y L 
Sbjct  468  GGVTPEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYGLG  507



>ref|XP_006287545.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
 gb|EOA20443.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
Length=509

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
             G + E LNMEE YGLTLQRAVPL++HPKPRL P++Y L
Sbjct  468  GGVTPEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYGL  506



>gb|AJO67972.1| flavonoid-3'-hydroxylase, partial [Prunus avium]
Length=209

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  168  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  204



>gb|ADK56126.1| putative flavonoid 3'-hydroxylase [Coreopsis grandiflora]
Length=512

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG     LNMEEAYGLTLQRA PL++HP+PRL PH+Y
Sbjct  473  NGLEPADLNMEEAYGLTLQRAAPLVVHPRPRLAPHVY  509



>gb|AJO67966.1| flavonoid-3'-hydroxylase, partial [Prunus avium]
Length=208

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  167  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  203



>gb|EMS55165.1| Flavonoid 3'-monooxygenase [Triticum urartu]
Length=207

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            +G + E L+MEEAYGLTLQRAVPLM+ P PRL P  YT+
Sbjct  169  DGMTPEKLDMEEAYGLTLQRAVPLMVQPVPRLLPSAYTM  207



>gb|ACM62746.1| flavonoid 3'-hydroxylase [Garcinia mangostana]
Length=507

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNM+EAYGLTLQRA PLM+HPKPRL P  Y
Sbjct  467  NGLIPEKLNMDEAYGLTLQRAAPLMVHPKPRLSPQAY  503



>ref|XP_008794133.1| PREDICTED: flavonoid 3'-monooxygenase-like [Phoenix dactylifera]
Length=510

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNMEEA+GLTLQRAVPL + PKPRL PH+Y
Sbjct  472  GQDPEKLNMEEAFGLTLQRAVPLAVCPKPRLAPHVY  507



>gb|AJD25177.1| cytochrome P450 CYP75B79 [Salvia miltiorrhiza]
Length=511

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG S + LNM+EAYGLTLQRA PL++HP PRL PH+Y
Sbjct  473  NGLSPQNLNMDEAYGLTLQRAQPLIVHPNPRLAPHVY  509



>gb|AGO03825.1| flavonoid 3`5`-hydroxylase [Cichorium intybus]
Length=514

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            E LNMEEAYGL L+RA PLM+HP+PRL PH+YT
Sbjct  480  ENLNMEEAYGLALRRAEPLMVHPRPRLSPHVYT  512



>gb|AGG18092.1| flavonoid 3'-hydroxylase, partial [Prunus armeniaca]
Length=264

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  223  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  259



>gb|AGG18103.1| flavonoid 3'-hydroxylase, partial [Prunus persica]
Length=264

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  223  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  259



>gb|ACO35757.1| flavonoid 3'-hydroxylase [Rudbeckia hirta]
Length=509

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNM EAYGLTLQR  PLM+HPKPRL PH+Y
Sbjct  470  NGLEPEKLNMNEAYGLTLQREEPLMVHPKPRLAPHVY  506



>gb|ABA64468.1| flavonoid 3'-hydroxylase [Gerbera hybrid cultivar]
Length=512

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + + LNMEEAYGLTLQRA PL++HP+PRL PH+Y
Sbjct  471  DGLNPKKLNMEEAYGLTLQRAAPLVVHPRPRLAPHVY  507



>ref|XP_010105826.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19303.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06425.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=508

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNM+EAYGLTLQRA PLM+HP+PRL  HLY
Sbjct  472  NGLLPEKLNMDEAYGLTLQRAAPLMVHPQPRLDQHLY  508



>gb|AHY35313.1| flavonoid 3'-hydroxylase 1 [Morus notabilis]
Length=508

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNM+EAYGLTLQRA PLM+HP+PRL  HLY
Sbjct  472  NGLLPEKLNMDEAYGLTLQRAAPLMVHPQPRLDQHLY  508



>gb|AIT52346.1| flavonoid 3'-monooxygenase 1 [Daucus carota]
Length=524

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +GQ    +NM+EAYGLTLQRAVPLM+HP PRL P  Y
Sbjct  486  DGQEAAKINMDEAYGLTLQRAVPLMVHPSPRLSPVAY  522



>dbj|BAB59005.1| flavonoid 3'-hydroxylase [Perilla frutescens var. crispa]
Length=523

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NGQ  + LNMEEAYG+TLQRA PL++HP+PRL  H+Y
Sbjct  483  NGQLAKDLNMEEAYGITLQRADPLVVHPRPRLARHVY  519



>gb|EMT05634.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=241

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            +G + E L+MEEAYGLTLQRAVPLM+ P PRL P  YT+
Sbjct  203  DGMTPEKLDMEEAYGLTLQRAVPLMVQPVPRLLPSAYTM  241



>gb|AES69199.2| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            NG + + +NM+E++GL +QRAVPL++HPKPRL PH+Y+
Sbjct  476  NGINAKDINMDESFGLGIQRAVPLLVHPKPRLLPHVYS  513



>gb|AIU98513.1| flavonoid 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E L MEEAYGLTLQRAVPL+LHP+PRL  H+Y
Sbjct  477  GQIPEKLEMEEAYGLTLQRAVPLVLHPQPRLSSHVY  512



>gb|AAO47851.1| flavonoid 3'-hydroxylase [Glycine max]
Length=325

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
            E LNM+EAYGLTLQ AVPL +HP+PRL PH+Y+++
Sbjct  290  EKLNMDEAYGLTLQPAVPLSVHPRPRLAPHVYSMS  324



>ref|NP_001267916.1| flavonoid 3' hydroxylase [Vitis vinifera]
 dbj|BAE47006.1| flavonoid 3'-hydroxylase [Vitis vinifera]
 gb|ABH06586.1| flavonoid 3' hydroxylase [Vitis vinifera]
Length=509

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  472  GQVAEKLNMDEAYGLTLQRAPPLMVHPRPRLSPQVF  507



>ref|XP_011011227.1| PREDICTED: flavonoid 3'-monooxygenase [Populus euphratica]
Length=521

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G   E LNM+EAYGLTLQRAVPLM+HP+PRL P  Y
Sbjct  481  DGLVPEKLNMDEAYGLTLQRAVPLMVHPRPRLSPKAY  517



>gb|AEN71546.1| flavanone 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E L MEEAYGLTLQRAVPL+LHP+PRL  H+Y
Sbjct  477  GQIPEKLEMEEAYGLTLQRAVPLVLHPQPRLSSHVY  512



>ref|XP_010936313.1| PREDICTED: flavonoid 3'-monooxygenase-like [Elaeis guineensis]
Length=508

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            GQ  E LNMEEA+GLTLQRA PL L PKPRL PH YT
Sbjct  470  GQVPEKLNMEEAFGLTLQRAEPLSLWPKPRLAPHAYT  506



>gb|AIY22748.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            NGQ  E LNMEEAYGLTLQRA PL++HP+PRL+  +Y +
Sbjct  477  NGQLPEKLNMEEAYGLTLQRADPLVVHPRPRLEAQVYGI  515



>dbj|BAJ17668.1| flavonoid 3' hydroxylase [Gynura bicolor]
Length=511

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNMEEAYGLTLQRA PLM+HP  RL PH+Y
Sbjct  472  NGLMPEKLNMEEAYGLTLQRAAPLMVHPMSRLAPHVY  508



>ref|XP_006665050.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=522

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            NG++ + LNMEEAYGLTLQRAVPLM+ P PRL P  Y L
Sbjct  484  NGETPDKLNMEEAYGLTLQRAVPLMVQPVPRLLPSAYGL  522



>gb|AIY22749.1| flavonoid 3'-hydroxylase [Iochroma cyaneum]
Length=515

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NGQ  E LNMEEAYGLTLQRA PL++HP+PRL+  +Y
Sbjct  476  NGQLPEKLNMEEAYGLTLQRADPLVVHPRPRLEAQVY  512



>gb|KCW83706.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=465

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G S E LNM+EA+GLTLQRA PL++HPKPRL  H+Y
Sbjct  425  DGVSPEKLNMDEAFGLTLQRAEPLLVHPKPRLASHVY  461



>gb|AIY22747.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NGQ  E LNMEEAYGLTLQRA PL++HP+PRL+  +Y
Sbjct  477  NGQLPEKLNMEEAYGLTLQRADPLVVHPRPRLEAQVY  513



>emb|CAI54278.1| flavonoid-3'-hydroxylase [Vitis vinifera]
Length=509

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNM+EAYGLTLQRA PLM+HP PRL P ++
Sbjct  472  GQVAEKLNMDEAYGLTLQRAAPLMVHPLPRLSPQVF  507



>ref|XP_003598948.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
Length=597

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            NG + + +NM+E++GL +QRAVPL++HPKPRL PH+Y+
Sbjct  476  NGINAKDINMDESFGLGIQRAVPLLVHPKPRLLPHVYS  513



>gb|KCW83705.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=478

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G S E LNM+EA+GLTLQRA PL++HPKPRL  H+Y
Sbjct  438  DGVSPEKLNMDEAFGLTLQRAEPLLVHPKPRLASHVY  474



>emb|CAN68303.1| hypothetical protein VITISV_041731 [Vitis vinifera]
Length=509

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNM+EAYGLTLQRA PLM+HP PRL P ++
Sbjct  472  GQVAEKLNMDEAYGLTLQRAAPLMVHPLPRLSPQVF  507



>dbj|BAE47005.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNM+EAYGLTLQRA PLM+HP PRL P ++
Sbjct  472  GQVAEKLNMDEAYGLTLQRAAPLMVHPLPRLSPQVF  507



>gb|ADZ54783.1| flavonoid 3'-monooxygenase [Prunus avium]
Length=510

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  469  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  505



>ref|XP_002514665.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF47771.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=461

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNMEEAYGLTLQR VPL++ P+PRL P++Y
Sbjct  420  NGLKAEELNMEEAYGLTLQRLVPLIVRPRPRLSPNVY  456



>gb|AEX07282.1| F3'H [Arachis hypogaea]
Length=517

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            G   E LNM+EAYGLTLQRA+PL +HPKPRL  H+Y+
Sbjct  478  GLKQEDLNMDEAYGLTLQRALPLSVHPKPRLSSHVYS  514



>ref|XP_008240031.1| PREDICTED: flavonoid 3'-monooxygenase [Prunus mume]
Length=510

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  469  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  505



>ref|XP_007209917.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
 gb|AFC62055.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|EMJ11116.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
Length=510

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  469  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  505



>gb|ACN38268.1| flavonoid 3' hydroxylase [Vitis amurensis]
Length=509

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNM+EAYGLTLQRA PLM++P+PRL P ++
Sbjct  472  GQVAEKLNMDEAYGLTLQRAAPLMVYPRPRLSPQVF  507



>ref|XP_006837147.1| hypothetical protein AMTR_s00110p00149730 [Amborella trichopoda]
 gb|ERN00001.1| hypothetical protein AMTR_s00110p00149730 [Amborella trichopoda]
Length=501

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            G++ E LNMEE YGLTLQR VPL++ PKPRL PH+Y 
Sbjct  461  GETPEKLNMEEVYGLTLQRKVPLVVKPKPRLAPHVYA  497



>ref|XP_010030579.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
Length=514

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G S E LNM+EA+GLTLQRA PL++HPKPRL  H+Y
Sbjct  474  DGVSPEKLNMDEAFGLTLQRAEPLLVHPKPRLASHVY  510



>gb|ACO35755.1| chalcone 3-hydroxylase [Cosmos sulphureus]
Length=512

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG + E LNM+EA+GLTLQ+A PLM+HP PRL PH+Y
Sbjct  473  NGLNPEKLNMDEAFGLTLQKAEPLMVHPMPRLAPHVY  509



>gb|AGL81348.1| flavanone 3' hydroxylase [Pyrus communis]
Length=511

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  470  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>gb|ACO35754.1| flavonoid 3'-hydroxylase [Dahlia pinnata]
Length=509

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNM EAYGLTLQR  PL++HPKPRL PH+Y
Sbjct  470  NGLKPEKLNMNEAYGLTLQREEPLVVHPKPRLAPHVY  506



>ref|XP_009338402.1| PREDICTED: flavonoid 3'-monooxygenase [Pyrus x bretschneideri]
Length=511

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  470  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>gb|ACN65825.1| flavonoid 3'-hydroxylase [Cichorium intybus]
Length=511

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG     LNMEEAYGLTLQRA PL++HP+PRL P++Y
Sbjct  473  NGLEPADLNMEEAYGLTLQRAAPLVVHPRPRLAPYVY  509



>gb|ACR14869.1| flavonoid 3' hydroxylase IIb [Malus domestica]
Length=511

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  470  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>gb|ACR14867.1| flavonoid 3' hydroxylase [Malus domestica]
Length=511

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  470  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>ref|XP_008393217.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=511

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  470  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>ref|XP_007138248.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
 gb|ESW10242.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
Length=506

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            NG + E LNM+EAYGLTLQRA PL +HP+PRL  H+Y+
Sbjct  468  NGLNPEKLNMDEAYGLTLQRAEPLSVHPRPRLASHVYS  505



>gb|ACO35756.1| flavonoid 3'-hydroxylase [Tagetes erecta]
Length=509

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNM EAYGLTLQR  PL++HPKPRL PH+Y
Sbjct  470  NGLKPEKLNMNEAYGLTLQREEPLVVHPKPRLAPHVY  506



>gb|AHA49900.1| flavonoid 3' hydroxylase [Malus hybrid cultivar]
Length=511

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  470  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>ref|XP_008374610.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
 gb|ACR14868.1| flavonoid 3' hydroxylase IIa [Malus domestica]
Length=511

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  470  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>dbj|BAF49324.1| flavonoid 3'-hydroxylase [Lobelia erinus]
Length=515

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +GQ  E LNMEE YGLTLQRA PL +HP+PRL  H+Y
Sbjct  477  DGQKPEELNMEEGYGLTLQRAKPLKVHPRPRLSEHVY  513



>dbj|BAO58432.1| flavonoid 3'-hydroxylase [Vaccinium ashei]
Length=517

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            G+  E LNM+EAYGLTLQRA PLM+HP+PR   H+Y
Sbjct  480  GKLAEKLNMDEAYGLTLQRAEPLMVHPRPRFGAHVY  515



>dbj|BAP94456.1| flavonoid 3'-hydroxylas [Eustoma exaltatum subsp. russellianum]
Length=519

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            NG S + L+MEEAYGLTLQRA PL++HPKPRL   +Y 
Sbjct  481  NGMSPDKLDMEEAYGLTLQRASPLIVHPKPRLASSMYV  518



>gb|AHY35314.1| flavonoid 3'-hydroxylase 2 [Morus notabilis]
Length=490

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNM+EAYGLTLQRA PLM+HP PRL  H+Y
Sbjct  450  NGLVPEKLNMDEAYGLTLQRASPLMVHPWPRLSEHVY  486



>ref|XP_003598947.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
 gb|AES69198.1| flavonoid hydroxylase [Medicago truncatula]
Length=286

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            NG + E  N +E YGLTLQR VPL +HPKPRL PH+++
Sbjct  246  NGLNAEKKNKDEGYGLTLQRIVPLSVHPKPRLSPHVFS  283



>ref|XP_008791304.1| PREDICTED: flavonoid 3'-monooxygenase-like [Phoenix dactylifera]
Length=517

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E L+MEEAYGLTLQRA PLM+HP PRL P  Y
Sbjct  480  GQITEKLDMEEAYGLTLQRATPLMVHPVPRLAPTAY  515



>ref|XP_002319761.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
 gb|EEE95684.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
Length=521

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G   E LNM+EAYGLTLQRA PLM+HP+PRL P +Y
Sbjct  481  DGLVPEKLNMDEAYGLTLQRADPLMVHPRPRLSPKVY  517



>ref|XP_009394321.1| PREDICTED: flavonoid 3'-monooxygenase [Musa acuminata subsp. 
malaccensis]
Length=520

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E L+MEEAYGLTLQRAVPLM+HP+PRL    Y
Sbjct  481  GQKPEKLDMEEAYGLTLQRAVPLMVHPRPRLTSAAY  516



>ref|XP_007037548.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
 gb|EOY22049.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
Length=507

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G   E LNMEEA+GLTLQRA PLM+HP+PRL P  Y
Sbjct  471  DGLMPEKLNMEEAFGLTLQRAAPLMVHPRPRLSPRAY  507



>ref|XP_010105825.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19304.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06424.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=517

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNM+EAYGLTLQRA PLM+HP PRL  H+Y
Sbjct  477  NGLVPEKLNMDEAYGLTLQRASPLMVHPWPRLSEHVY  513



>ref|XP_003574810.2| PREDICTED: flavonoid 3'-monooxygenase-like [Brachypodium distachyon]
Length=548

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            NG + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y +
Sbjct  506  NGMTPDKLDMEEAYGLTLQRAVPLMVQPVPRLLPSAYAV  544



>ref|XP_010030575.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83703.1| hypothetical protein EUGRSUZ_B00578 [Eucalyptus grandis]
Length=514

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
             G S E LNM+EAYGLTLQRA PL +HPKPRL  H+Y
Sbjct  474  GGVSPEKLNMDEAYGLTLQRAEPLSVHPKPRLASHVY  510



>gb|EYU23554.1| hypothetical protein MIMGU_mgv1a004224mg [Erythranthe guttata]
Length=538

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G+    LNMEEAYGLTLQRA PLM+HP+PRL P +Y
Sbjct  498  DGKLGHELNMEEAYGLTLQRAEPLMVHPRPRLAPRVY  534



>gb|KJB51032.1| hypothetical protein B456_008G198200 [Gossypium raimondii]
Length=510

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E L+MEEAYGLTLQRA PLM+HP+PRL  H Y
Sbjct  479  EKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>gb|ACY06905.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E L+MEEAYGLTLQRA PLM+HP+PRL  H Y
Sbjct  479  EKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>gb|ADP24158.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
 gb|ADP24159.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E L+MEEAYGLTLQRA PLM+HP+PRL  H Y
Sbjct  479  EKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>gb|KHG07922.1| Flavonoid 3',5'-hydroxylase [Gossypium arboreum]
Length=510

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E L+MEEAYGLTLQRA PLM+HP+PRL  H Y
Sbjct  479  EKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>gb|AFI71898.1| flavonoid 3'-hydroxylase [Paeonia lactiflora]
Length=507

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E L MEEAYGLTLQRAVPL+L+P+PRL  H+Y
Sbjct  472  GQIPEKLQMEEAYGLTLQRAVPLVLYPQPRLSSHVY  507



>ref|NP_001064338.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|AAM00948.1|AC021892_12 Putative flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
 gb|AAN04937.1| Putative chalcone flavonoid 3' - hydroxylase [Oryza sativa Japonica 
Group]
 gb|AAP52914.1| Flavonoid 3'-monooxygenase, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26252.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|EAY78007.1| hypothetical protein OsI_33047 [Oryza sativa Indica Group]
 gb|EAZ15637.1| hypothetical protein OsJ_31048 [Oryza sativa Japonica Group]
 dbj|BAG89180.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEK31169.1| flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
Length=526

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            NG + + LNMEEAYGLTLQRAVPLM+ P PRL P  Y +
Sbjct  488  NGATPDKLNMEEAYGLTLQRAVPLMVQPVPRLLPSAYGV  526



>gb|AJD25178.1| cytochrome P450 CYP75B80 [Salvia miltiorrhiza]
Length=514

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG S + L+MEEAYGLTLQRA PL+++P+PRL  H+Y
Sbjct  474  NGLSAQNLSMEEAYGLTLQRAEPLVVYPRPRLASHVY  510



>ref|NP_001141292.1| uncharacterized protein LOC100273383 [Zea mays]
 gb|ACF85998.1| unknown [Zea mays]
Length=457

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +G + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  419  DGMTADKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  456



>ref|XP_008678758.1| PREDICTED: flavonoid 3'-monooxygenase-like [Zea mays]
 gb|AFW62811.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=521

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +G + E L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  482  DGVTAEKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  519



>ref|XP_010030596.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83708.1| hypothetical protein EUGRSUZ_B00582 [Eucalyptus grandis]
Length=514

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNM+EAYGLTLQRA PL +HPKPRL  H Y
Sbjct  474  NGALPEKLNMDEAYGLTLQRAEPLSVHPKPRLAAHAY  510



>gb|KDP31334.1| hypothetical protein JCGZ_11710 [Jatropha curcas]
Length=511

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRL  320
            E LNMEEAYGLTLQRAVPLM+HPKPRL
Sbjct  476  EKLNMEEAYGLTLQRAVPLMVHPKPRL  502



>gb|AGO02167.1| flavonoid 3'-hydroxylase [Ampelopsis grossedentata]
Length=509

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +GQ  E LNM+EAYGLTLQRA PLM+HP+ RL P  +
Sbjct  471  DGQVPEKLNMDEAYGLTLQRAAPLMVHPRSRLSPQAF  507



>gb|AGT50323.1| flavonoid 3'-hydroxylase, partial [Meconopsis pseudohorridula]
Length=452

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  317
            GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  420  GQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  451



>gb|AFW72123.1| red aleurone1 [Zea mays]
Length=515

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +G + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  477  DGMTADKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  514



>gb|AGT50319.1| flavonoid 3'-hydroxylase, partial [Meconopsis quintuplinervia]
Length=454

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  317
            GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  422  GQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  453



>gb|AEE60887.1| flavonoid 3'-hydroxylase [Fragaria virginiana]
Length=512

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>ref|NP_001274347.1| uncharacterized protein LOC101314754 [Fragaria vesca]
 gb|AEE60884.1| flavonoid 3'-hydroxylase [Fragaria vesca]
 gb|AGT28740.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>gb|ACO35752.1| flavonoid 3'-hydroxylase [Cosmos sulphureus]
Length=508

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNM EA+GLTLQRA PL+++PKPRL PH+Y
Sbjct  469  NGVLPEKLNMNEAFGLTLQRAEPLIVYPKPRLAPHVY  505



>gb|AIB06740.1| flavanone 3'-hydroxylase [Mangifera indica]
Length=515

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G + E LNMEEAYGLTLQRA PL++HP+PRL P  Y
Sbjct  477  SGLTPEKLNMEEAYGLTLQRADPLIVHPRPRLTPKAY  513



>gb|AEE60885.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>gb|AEE60886.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>gb|AEE60883.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>gb|AAG49299.1|AF313489_1 flavonoid 3',5'-hydroxylase [Callistephus chinensis]
Length=510

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNM+EA+GL++QRA PL++HP+PRL PH+Y
Sbjct  471  NGIKPEKLNMDEAFGLSVQRAEPLVVHPRPRLPPHVY  507



>gb|AFW62812.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=944

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +G + E L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  905  DGVTAEKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  942



>gb|AEE60888.1| flavonoid 3'-hydroxylase [Fragaria chiloensis]
Length=512

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMVHPRTRLAPHAY  507



>gb|AJA79074.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|AJA79081.1| flavonoid 3' hydroxylase [Prunus persica]
Length=509

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPH  311
            +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH
Sbjct  474  DGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPH  508



>dbj|BAL63027.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=510

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMVHPRTRLAPHAY  507



>gb|ADG21952.1| flavonoid 3'-hydroxylase, partial [Morella rubra]
Length=64

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G   E LNM+EAYGLTLQRA  LM+HP+PRL P  Y
Sbjct  26   DGLLPEKLNMDEAYGLTLQRAAQLMVHPQPRLSPRTY  62



>gb|ABG54321.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=515

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +G + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  476  DGMTADKLDMEEAYGLTLQRAVPLMVRPTPRLLPSAYA  513



>ref|XP_002452385.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
 gb|EES05361.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
Length=517

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +G + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  478  DGMTADKLDMEEAYGLTLQRAVPLMVRPTPRLLPSAYA  515



>gb|AGT50324.1| flavonoid 3'-hydroxylase, partial [Papaver nudicaule]
Length=449

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  317
            GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  417  GQLIEKLNMDEAYGLTLQRASPLMVHPKLRLE  448



>gb|AGT50313.1| flavonoid 3'-hydroxylase, partial [Meconopsis lancifolia]
Length=476

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  317
            GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  444  GQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  475



>sp|Q9SBQ9.1|F3PH_PETHY RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B2; AltName: Full=Flavonoid 3'-hydroxylase [Petunia 
x hybrida]
 gb|AAD56282.1|AF155332_1 flavonoid 3'-hydroxylase [Petunia x hybrida]
Length=512

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +GQ  E LNMEEAYGLTLQRA PL++HP+PRL+   Y
Sbjct  474  SGQLPEMLNMEEAYGLTLQRADPLVVHPRPRLEAQAY  510



>gb|AGT50325.1| flavonoid 3'-hydroxylase, partial [Papaver radicatum]
Length=449

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  317
            GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  417  GQLIEKLNMDEAYGLTLQRASPLMVHPKLRLE  448



>ref|XP_006440736.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
 gb|ESR53976.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
Length=538

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
             G   E LNM+EAYGLTLQRA PL++HP+PRL P+ Y
Sbjct  500  GGLKPEKLNMDEAYGLTLQRAAPLVVHPRPRLSPNAY  536



>ref|XP_010695197.1| PREDICTED: flavonoid 3'-monooxygenase [Beta vulgaris subsp. vulgaris]
Length=512

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            +G   E LNMEEAYGLTLQR +PL +HP PRL  H Y L
Sbjct  474  DGLMSEKLNMEEAYGLTLQRKIPLAVHPLPRLSAHAYNL  512



>gb|AGT50311.1| flavonoid 3'-hydroxylase, partial [Meconopsis horridula]
Length=484

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  317
            GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  452  GQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  483



>gb|AGT50318.1| flavonoid 3'-hydroxylase, partial [Meconopsis punicea]
Length=485

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  317
            GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  453  GQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  484



>dbj|BAB87839.1| flavonoid 3'-hydroxalase [Torenia hybrid cultivar]
Length=457

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            +G   E L+MEE YGLTLQRA PL++HPKPRL   +Y +
Sbjct  419  DGLKPEKLDMEEGYGLTLQRASPLIVHPKPRLSAQVYCM  457



>ref|XP_009122411.1| PREDICTED: flavonoid 3'-monooxygenase [Brassica rapa]
Length=511

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
             G + E LNMEE YG+TLQRAVPL++HPKPRL    Y L 
Sbjct  470  GGVTPEKLNMEETYGITLQRAVPLVVHPKPRLDRSAYGLG  509



>gb|ABY89688.1| flavonoid 3` hydroxylase 2 protein [Brassica rapa subsp. oleifera]
Length=511

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
             G + E LNMEE YG+TLQRAVPL++HPKPRL    Y L 
Sbjct  470  GGVTPEKLNMEETYGITLQRAVPLVVHPKPRLDRSAYGLG  509



>ref|XP_010939156.1| PREDICTED: flavonoid 3'-monooxygenase-like [Elaeis guineensis]
Length=516

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E L+MEEAYGLTLQRA+PLM+HP PRL    Y
Sbjct  481  GQMAEKLDMEEAYGLTLQRAMPLMVHPVPRLASAAY  516



>ref|XP_002454110.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
 gb|EES07086.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
Length=517

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +G +   L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  478  DGMTANKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  515



>ref|XP_009771410.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Nicotiana sylvestris]
Length=515

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQS E LNME+A+GLTL RA PL++HP+PRL+   Y
Sbjct  478  GQSSEKLNMEDAFGLTLHRADPLVVHPRPRLEAQAY  513



>emb|CDX99037.1| BnaC09g47980D [Brassica napus]
Length=717

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
             G + E LNMEE YG+TLQRAVPL++HPKPRL    Y L 
Sbjct  676  GGVTPEKLNMEETYGITLQRAVPLVVHPKPRLDMSAYGLG  715



>gb|AAS48419.1| flavonoid 3'-hydroxylase [Allium cepa]
Length=510

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +GQS E L+MEEAYGL LQRAVPLM+ P PRL    Y
Sbjct  470  DGQSAEKLDMEEAYGLPLQRAVPLMVRPVPRLDEKAY  506



>gb|AFQ92056.1| flavonoid 3' hydroxylase [Pyrus pyrifolia]
Length=511

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG + + L M+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  470  NGLTPDKLIMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>ref|XP_004983036.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=515

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
             G   + L+MEEAYGLTLQRAVPLM+ P+PRL P  Y 
Sbjct  475  GGVDADKLDMEEAYGLTLQRAVPLMVRPEPRLLPSAYA  512



>dbj|BAD91808.1| flavonoid 3'-hydroxylase [Gentiana triflora]
Length=524

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            +G   E L+MEE YGLTLQRA PL++HPKPRL   +Y +
Sbjct  486  DGLKPEKLDMEEGYGLTLQRASPLIVHPKPRLSAQVYCM  524



>ref|XP_003525450.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=511

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            NG   + LNM+EAYGLTLQRAVPL +H  PRL  H+Y+
Sbjct  470  NGYDPKKLNMDEAYGLTLQRAVPLSIHTHPRLSQHVYS  507



>gb|KHN48734.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=506

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            NG   + LNM+EAYGLTLQRAVPL +H  PRL  H+Y+
Sbjct  465  NGYDPKKLNMDEAYGLTLQRAVPLSIHTHPRLSQHVYS  502



>gb|ABB43031.1| flavonoid 3'5'-hydroxylase [Osteospermum hybrid cultivar]
Length=508

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNMEE +G+++Q+A PLM+HP+PRL PH Y
Sbjct  471  NGLDPERLNMEEEFGISVQKAEPLMVHPRPRLAPHTY  507



>gb|ACO35753.1| flavonoid 3'-hydroxylase [Bidens aurea]
Length=512

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHL  308
            NG   E LNM EAYGLTLQRA PL++HPKPRL P +
Sbjct  473  NGVQPEKLNMNEAYGLTLQRAEPLIVHPKPRLAPDV  508



>gb|EMT22073.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=304

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
             GQ+ + LNMEEA+ L LQRAVPLM+HP PRL P  Y +
Sbjct  265  TGQTPDKLNMEEAFSLLLQRAVPLMVHPVPRLLPSAYEI  303



>gb|AGI16386.1| flavonoid 3' hydroxylase [Ribes nigrum]
Length=524

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNMEEAYGLTLQR  PLM+HP+ RL  ++Y
Sbjct  489  GQIAEKLNMEEAYGLTLQRHTPLMVHPRTRLSQNVY  524



>gb|AHB18038.1| flavonoid 3'-hydroxylase, partial [Anthurium andraeanum]
Length=292

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
             GQ+ E L+MEEA+GLTLQRAVPL   P PRL P  Y
Sbjct  251  EGQTPEKLDMEEAFGLTLQRAVPLQARPTPRLSPEAY  287



>gb|ABG54319.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +G +   L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  478  DGMTAYKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  515



>gb|AAG49301.1|AF313491_1 flavonoid 3'-hydroxylase [Matthiola incana]
Length=513

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
             G + E LNMEE YG+T+QRAVPL++HPKPRL  ++Y
Sbjct  472  GGVTPEKLNMEETYGITVQRAVPLIVHPKPRLALNVY  508



>ref|XP_006477655.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=516

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
             G   E L+M+EAYGLTLQRA PL++HP+PRL P+ Y
Sbjct  478  GGLKPEKLSMDEAYGLTLQRAAPLVVHPRPRLSPNAY  514



>dbj|BAN05297.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=514

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E LNM+EAYGLTLQR VPLM+HP  RL  H+Y
Sbjct  479  EKLNMDEAYGLTLQRKVPLMVHPTRRLSAHVY  510



>dbj|BAJ98136.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            GQ+   LNMEEA+ L LQRAVPLM+HP PRL P  Y +
Sbjct  489  GQTPGKLNMEEAFSLLLQRAVPLMVHPVPRLLPSAYQI  526



>ref|XP_002452380.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
 gb|EES05356.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
Length=517

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +G + + L+MEEAYGLTLQRAVPL + P PRL P  Y 
Sbjct  478  DGMTADKLDMEEAYGLTLQRAVPLKVRPAPRLLPSAYA  515



>gb|ABG54320.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +G + + L+MEEAYGLTLQRAVPL + P PRL P  Y 
Sbjct  478  DGMTADKLDMEEAYGLTLQRAVPLKVRPAPRLLPSAYA  515



>gb|AAV74194.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
 gb|AAV74195.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +G + + L+MEEAYGLTLQRAVPL + P PRL P  Y 
Sbjct  478  DGMTADKLDMEEAYGLTLQRAVPLKVRPAPRLLPSAYA  515



>ref|XP_006345132.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=514

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  E LNMEEA+GLTLQRA PL++HP PRL+  +Y
Sbjct  477  GQLPEKLNMEEAFGLTLQRADPLVVHPIPRLEAQVY  512



>gb|AAX19888.1| flavonoid-3',5'-hydroxylase [Pericallis cruenta]
Length=504

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG  +E LNMEE +G++LQR  PL++HP+PRL  H+Y
Sbjct  465  NGLELEKLNMEEVFGISLQRVQPLLVHPRPRLARHVY  501



>gb|EMS66050.1| Flavonoid 3'-monooxygenase [Triticum urartu]
Length=304

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            GQ+ + LNMEEA+ L LQRAVPLM HP PRL P  Y +
Sbjct  266  GQTPDKLNMEEAFSLLLQRAVPLMAHPVPRLLPSAYEI  303



>gb|AHZ08763.1| flavonoid 3'-monooxygenase [Nicotiana tabacum]
Length=515

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQS E LNMEEA+GLTLQRA PL++HP  RL+   Y
Sbjct  478  GQSSEKLNMEEAFGLTLQRADPLVVHPGLRLEAQAY  513



>ref|XP_009788494.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana sylvestris]
Length=514

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQS E LNMEEA+GLTLQRA PL++HP  RL+   Y
Sbjct  477  GQSSEKLNMEEAFGLTLQRADPLVVHPGLRLEAQAY  512



>gb|AIC73642.1| flavonoid 3'-hydroxylase [Anthurium andraeanum]
Length=511

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ+ E L+MEEA+GLTLQRAVPL   P PRL P  Y
Sbjct  471  GQTPEKLDMEEAFGLTLQRAVPLQARPTPRLSPEAY  506



>dbj|BAM28972.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E L+MEEAYGLTLQRAVPLM+ P PRL    Y
Sbjct  472  NGVVAEKLDMEEAYGLTLQRAVPLMVLPVPRLAKQAY  508



>dbj|BAM28971.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E L+MEEAYGLTLQRAVPLM+ P PRL    Y
Sbjct  472  NGVVAEKLDMEEAYGLTLQRAVPLMVLPVPRLAKQAY  508



>gb|AGT50309.1| flavonoid 3'-hydroxylase, partial [Meconopsis delavayi]
Length=476

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  317
            GQ +E LNM+EAYGLTLQRA  LM+HPK RL+
Sbjct  444  GQVIEKLNMDEAYGLTLQRASTLMVHPKLRLE  475



>ref|XP_006579509.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X2 [Glycine 
max]
Length=365

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   + LNM+E YG+TLQ+A+PL +HP PRL  H+Y
Sbjct  323  NGADPKRLNMDETYGITLQKALPLFVHPHPRLSQHVY  359



>ref|XP_003525448.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Glycine 
max]
Length=512

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   + LNM+E YG+TLQ+A+PL +HP PRL  H+Y
Sbjct  470  NGADPKRLNMDETYGITLQKALPLFVHPHPRLSQHVY  506



>gb|KHN48735.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=512

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   + LNM+E YG+TLQ+A+PL +HP PRL  H+Y
Sbjct  470  NGADPKRLNMDETYGITLQKALPLFVHPHPRLSQHVY  506



>ref|XP_007155244.1| hypothetical protein PHAVU_003G1855001g [Phaseolus vulgaris]
 gb|ESW27238.1| hypothetical protein PHAVU_003G1855001g [Phaseolus vulgaris]
Length=329

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPR  323
            NG   ++LNM+EAYGLTLQRAVPL +HP+PR
Sbjct  288  NGLDPKSLNMDEAYGLTLQRAVPLSVHPRPR  318



>ref|XP_007155243.1| hypothetical protein PHAVU_003G1855001g, partial [Phaseolus vulgaris]
 gb|ESW27237.1| hypothetical protein PHAVU_003G1855001g, partial [Phaseolus vulgaris]
Length=364

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPR  323
            NG   ++LNM+EAYGLTLQRAVPL +HP+PR
Sbjct  323  NGLDPKSLNMDEAYGLTLQRAVPLSVHPRPR  353



>ref|XP_007155245.1| hypothetical protein PHAVU_003G1855001g [Phaseolus vulgaris]
 gb|ESW27239.1| hypothetical protein PHAVU_003G1855001g [Phaseolus vulgaris]
Length=368

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPR  323
            NG   ++LNM+EAYGLTLQRAVPL +HP+PR
Sbjct  327  NGLDPKSLNMDEAYGLTLQRAVPLSVHPRPR  357



>gb|AAG49315.1|AF315465_1 flavonoid 3'-hydroxylase [Pelargonium x hortorum]
Length=511

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  + LNM+EAYGLTLQRA PL + P+PRL  HLY
Sbjct  476  GQIPQELNMDEAYGLTLQRASPLHVRPRPRLPSHLY  511



>gb|ABM46853.1| flavonoid 3'-hydroxylase [Ageratina adenophora]
Length=510

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E LNM+EAYGLTLQRA  L++HPKPRL P +Y
Sbjct  476  EKLNMDEAYGLTLQRAEQLIVHPKPRLAPGVY  507



>dbj|BAB87838.1| flavonoid 3'-hydroxylase [Torenia hybrid cultivar]
Length=512

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   + LNMEEAYGLTLQRA PL++HP+ RL  H+Y
Sbjct  476  NGLLPQNLNMEEAYGLTLQRAEPLLVHPRLRLATHVY  512



>ref|XP_002978324.1| hypothetical protein SELMODRAFT_108642 [Selaginella moellendorffii]
 gb|EFJ20310.1| hypothetical protein SELMODRAFT_108642 [Selaginella moellendorffii]
Length=150

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +GQ+++ L+M E++GLT+ +AVPL L P PRL+P +Y 
Sbjct  108  SGQTIDDLDMSESFGLTVPKAVPLKLVPSPRLEPQIYV  145



>ref|XP_003525447.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=513

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            NG   + LNM+E YG+TLQ+A+PL +HP PRL  H+Y+
Sbjct  472  NGTDPKRLNMDETYGITLQKAMPLSVHPHPRLSQHVYS  509



>ref|XP_002439914.1| hypothetical protein SORBIDRAFT_09g022480 [Sorghum bicolor]
 gb|EES18344.1| hypothetical protein SORBIDRAFT_09g022480 [Sorghum bicolor]
Length=535

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            GQ+ + LNMEEA+ L LQRAVPLM HP PRL P  Y +
Sbjct  497  GQTPDKLNMEEAFTLLLQRAVPLMAHPIPRLLPSAYEI  534



>gb|AHZ31753.1| flavonoid 3'-hydroxylase [Viola x wittrockiana]
Length=508

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  394  LNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            LNM+EAYGLTLQRA PL++HPKPRL    Y
Sbjct  475  LNMDEAYGLTLQRAAPLIVHPKPRLSTQAY  504



>ref|XP_002970157.1| hypothetical protein SELMODRAFT_93320 [Selaginella moellendorffii]
 gb|EFJ28287.1| hypothetical protein SELMODRAFT_93320 [Selaginella moellendorffii]
Length=150

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
             GQ+++ L+M E++GLT+ +AVPL L P PRL+P +Y 
Sbjct  108  GGQTIDDLDMSESFGLTVPKAVPLKLVPSPRLEPQIYV  145



>dbj|BAM28973.1| flavonoid 3'-hydroxylase, partial [Lilium hybrid division I]
Length=453

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRL  320
            NG   E L+MEEAYGLTLQRAVPLM+ P PRL
Sbjct  421  NGVVAEKLDMEEAYGLTLQRAVPLMVVPVPRL  452



>gb|AHI58943.1| flavonoid 3'-hydroxylase [Nicotiana tabacum]
Length=515

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQS E LNMEEA+GLTLQRA PL++HP  RL+   Y
Sbjct  478  GQSPEKLNMEEAFGLTLQRADPLVVHPCLRLEAQAY  513



>ref|XP_009597267.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana tomentosiformis]
Length=515

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQS E LNMEEA+GLTLQRA PL++HP  RL+   Y
Sbjct  478  GQSPEKLNMEEAFGLTLQRADPLVVHPCLRLEAQAY  513



>ref|XP_007037547.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY22048.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
Length=501

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPR  323
            +G   E LNMEEA+GLTLQRA PLM+HP+PR
Sbjct  471  DGLMPEKLNMEEAFGLTLQRAAPLMVHPRPR  501



>gb|ABB43030.1| flavonoid 3'5'-hydroxylase [Pericallis cruenta]
Length=504

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            NG   E LNMEE +G++LQR  PL++HP+PRL  H+Y
Sbjct  465  NGLEPEKLNMEEVFGISLQRVQPLLVHPRPRLARHVY  501



>gb|AGT28741.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=513

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 1/33 (3%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKP-RLQPHLY  305
            E LNM+EA+GLTLQRA PLM+HP+  RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMVHPRTGRLAPHAY  508



>ref|NP_001289844.1| flavonoid 3'-monooxygenase [Solanum lycopersicum]
 gb|ADK56284.1| putative flavonoid 3' hydroxylase CYP75B49 [Solanum lycopersicum]
Length=514

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            GQ  + LNMEEA+GLTLQRA PL++HP PRL+  ++
Sbjct  477  GQLPDKLNMEEAFGLTLQRADPLVVHPIPRLEAQVF  512



>gb|AGO03824.1| flavonoid 3`5`-hydroxylase [Echinops bannaticus]
Length=510

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            +G   E LNMEEA GL L R VPLM+HPKPRL  H Y
Sbjct  471  DGLDPEKLNMEEAPGLALHRVVPLMVHPKPRLAHHAY  507



>gb|AGG40645.1| flavanone 3'-hydroxylase [Narcissus tazetta]
Length=529

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  409  QSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            Q  E L+MEEAYG+TLQR VPLM+HP PRL    Y
Sbjct  491  QRAEELDMEEAYGVTLQREVPLMVHPIPRLAQKAY  525



>emb|CDX69984.1| BnaA10g23330D [Brassica napus]
Length=511

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
             G + E LNMEE YG+TLQRAVPL++HPK RL    Y L 
Sbjct  470  GGVTPEKLNMEETYGITLQRAVPLVVHPKLRLDMSAYGLG  509



>gb|ABY89687.1| flavonoid 3` hydroxylase 1 protein [Brassica rapa subsp. oleifera]
Length=511

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
             G + E LNMEE YG+TLQRAVPL++HPK RL    Y L 
Sbjct  470  GGVTPEKLNMEETYGITLQRAVPLVVHPKLRLDMSAYGLG  509



>gb|ABC58722.1| flavonoid 3'-hydroxylase [Brassica napus]
 gb|ABC58723.1| flavonoid 3'-hydroxylase [Brassica napus]
Length=511

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  296
             G + E LNMEE YG+TLQRAVPL++HPK RL    Y L 
Sbjct  470  GGVTPEKLNMEETYGITLQRAVPLVVHPKLRLDMSAYGLG  509



>ref|XP_010233685.1| PREDICTED: flavonoid 3'-monooxygenase-like [Brachypodium distachyon]
Length=562

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            +G + + L+MEEAYGLTLQRA+PL + P PRL P  Y +
Sbjct  524  DGMTPDKLDMEEAYGLTLQRAMPLFVQPVPRLLPSAYAM  562



>dbj|BAN62871.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=513

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -2

Query  400  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            E LNM+EAYGLTLQR VPLM+HP  RL   +Y
Sbjct  478  EKLNMDEAYGLTLQRKVPLMVHPTRRLSARVY  509



>ref|XP_003562884.1| PREDICTED: flavonoid 3'-monooxygenase-like [Brachypodium distachyon]
Length=522

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            GQ+ + LNMEEA  L L RAVPLM+HP PRL P  Y +
Sbjct  484  GQTPDELNMEEALSLLLLRAVPLMVHPAPRLLPSAYEI  521



>gb|AGO03826.1| flavonoid 3`5`-hydroxylase [Billardiera heterophylla]
Length=521

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  305
            G+  E +NMEE YG++LQR VPL++HPKPRL   +Y
Sbjct  479  GELPENMNMEEDYGISLQRTVPLVVHPKPRLDHEVY  514



>ref|XP_003577475.1| PREDICTED: flavonoid 3'-monooxygenase-like [Brachypodium distachyon]
Length=530

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            GQ+ + LNMEEA+ L LQRA+PLM+HP  RL P  Y +
Sbjct  492  GQTPDKLNMEEAFSLLLQRAMPLMVHPVRRLLPSAYEI  529



>gb|AII26679.1| flavonoid 3'-monooxygenase [Indosasa hispida]
Length=521

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            GQ+ + LNMEEA+ L LQRA PLM+HP PRL P  Y +
Sbjct  483  GQTPDKLNMEEAFTLLLQRAEPLMVHPVPRLLPSAYEI  520



>gb|AII26680.1| flavonoid 3'-hydroxylase [Indosasa hispida]
Length=521

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  412  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  299
            GQ+ + LNMEEA+ L LQRA PLM+HP PRL P  Y +
Sbjct  483  GQTPDKLNMEEAFTLLLQRAEPLMVHPVPRLLPSAYEI  520



>gb|AEF33624.1| flavonoid 3' hydroxylase [Zea mays]
Length=517

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  302
            +G + + L+MEEA GLTLQRAVPL + P PRL P  Y 
Sbjct  478  DGMTADKLDMEEACGLTLQRAVPLKVRPAPRLLPSAYA  515



>dbj|BAJ95115.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -2

Query  415  NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQP  314
            +G + + L+MEEAYGLTLQRAVPLM+ P PRL P
Sbjct  497  DGITPQKLDMEEAYGLTLQRAVPLMVQPVPRLLP  530



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562275868875