BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF045O15

Length=581
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHI85710.1|  stress-induced protein 5                                310   2e-104   Capsicum annuum
gb|ABH08753.1|  ubiquitin                                               310   9e-104   Arabidopsis thaliana [mouse-ear cress]
gb|ABH08755.1|  ubiquitin                                               310   1e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AAM78180.1|  putative polyubiquitin                                  309   1e-103   Gossypium herbaceum [Arabian cotton]
gb|ACJ85643.1|  unknown                                                 310   1e-103   Medicago truncatula
gb|AAM64530.1|  ubiquitin homolog                                       310   1e-103   Arabidopsis thaliana [mouse-ear cress]
gb|ACZ69386.1|  polyubiquitin UBQ14                                     308   1e-103   Cucumis sativus [cucumbers]
ref|NP_567286.1|  ubiquitin 11                                          310   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007693173.1|  hypothetical protein COCMIDRAFT_109160             308   1e-103   Bipolaris oryzae ATCC 44560
gb|AAZ32851.1|  pentameric polyubiquitin                                308   2e-103   Medicago sativa [alfalfa]
gb|AFP44113.1|  ubiquitin                                               308   2e-103   Lycoris longituba
gb|AFJ04519.1|  ubiquitin                                               307   2e-103   Vernicia fordii [tung oil tree]
sp|P0CG83.1|UBIQP_HORVU  RecName: Full=Polyubiquitin; Contains: R...    307   2e-103   Hordeum vulgare [barley]
gb|AFC36452.1|  ubiquitin                                               308   2e-103   Anoectochilus roxburghii
gb|ACJ85618.1|  unknown                                                 309   2e-103   Medicago truncatula
pir||PS0380  ubiquitin precursor - rice (fragment)                      307   3e-103   Oryza sativa [red rice]
gb|ABR25718.1|  polyubiquitin containing 7 ubiquitin monomers           307   3e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_003626479.1|  Ubiquitin-like protein                             310   4e-103   
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             308   6e-103   Brachypodium distachyon [annual false brome]
gb|AAB36546.1|  polyubiquitin                                           307   7e-103   Phaseolus vulgaris [French bean]
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    309   7e-103   
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             311   7e-103   
gb|AGV54749.1|  ubiquitin 11                                            309   7e-103   Phaseolus vulgaris [French bean]
gb|EEC81189.1|  hypothetical protein OsI_24195                          308   8e-103   Oryza sativa Indica Group [Indian rice]
dbj|BAC57955.1|  polyubiquitin                                          308   8e-103   Tripolium pannonicum [sea starwort]
gb|AIZ74335.1|  polyubiquitin 3                                         308   8e-103   Pinus massoniana [Chinese red pine]
gb|ABH08754.1|  ubiquitin                                               307   8e-103   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190681.1|  ubiquitin 11                                       305   9e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             308   9e-103   Elaeis guineensis
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           310   9e-103   Nicotiana tomentosiformis
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      310   9e-103   Brassica rapa
gb|ACT82769.1|  polyubiquitin                                           306   9e-103   Nicotiana tabacum [American tobacco]
ref|XP_002317213.1|  polyubiquitin family protein                       308   9e-103   Populus trichocarpa [western balsam poplar]
gb|AAF31707.1|AF221858_1  polyubiquitin                                 307   1e-102   Euphorbia esula [wolf's milk]
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                307   1e-102   Erythranthe guttata [common monkey flower]
gb|ABD96088.1|  polyubiquitin                                           309   1e-102   Malus domestica [apple tree]
gb|AET06143.1|  ubiquitin                                               307   1e-102   Papaver somniferum
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   307   1e-102   Camelina sativa [gold-of-pleasure]
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    307   1e-102   
gb|ABK94002.1|  unknown                                                 310   1e-102   Populus trichocarpa [western balsam poplar]
gb|KJB62484.1|  hypothetical protein B456_009G418900                    307   1e-102   Gossypium raimondii
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      307   1e-102   Setaria italica
gb|KJB36627.1|  hypothetical protein B456_006G167800                    307   1e-102   Gossypium raimondii
emb|CAA48140.1|  ubiquitin                                              310   1e-102   Antirrhinum majus [garden snapdragon]
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             307   1e-102   
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             308   1e-102   
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   307   1e-102   Citrus sinensis [apfelsine]
gb|ABR25697.1|  polyubiquitin containing 7 ubiquitin monomers           306   1e-102   Oryza sativa Indica Group [Indian rice]
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   307   1e-102   Citrus sinensis [apfelsine]
gb|KJB81823.1|  hypothetical protein B456_013G163500                    310   1e-102   Gossypium raimondii
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      310   1e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             308   1e-102   Brachypodium distachyon [annual false brome]
ref|NP_849292.1|  polyubiquitin 14                                      310   1e-102   Arabidopsis thaliana [mouse-ear cress]
gb|EPS72031.1|  polyubiquitin                                           309   1e-102   Genlisea aurea
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             307   1e-102   Citrus clementina [clementine]
emb|CAH59739.1|  polyubiquitin                                          307   1e-102   Plantago major [cart-track plant]
gb|AAP31578.1|  ubiquitin                                               307   1e-102   Hevea brasiliensis [jebe]
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      310   2e-102   Camelina sativa [gold-of-pleasure]
gb|AAR32784.1|  polyubiquitin                                           307   2e-102   Clusia minor [cupey de monte]
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      310   2e-102   Camelina sativa [gold-of-pleasure]
gb|AAO43307.1|  putative polyubiquitin                                  308   2e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AEZ49160.1|  polyubiquitin                                           308   2e-102   Wolffia australiana
emb|CBY46745.1|  polyubiquitin 10 protein                               310   2e-102   Lepidium appelianum [hairy whitetop]
tpg|DAA44273.1|  TPA: Ubiquitin fusion protein                          306   2e-102   
gb|AFK41706.1|  unknown                                                 306   2e-102   Medicago truncatula
gb|AAL25813.1|  polyubiquitin                                           303   3e-102   Prunus avium [gean]
gb|AFY06654.1|  polyubiquitin                                           308   3e-102   Carica papaya [mamon]
gb|AES89866.2|  polyubiquitin 3                                         309   3e-102   Medicago truncatula
emb|CAI51312.2|  polyubiquitin                                          303   3e-102   Capsicum chinense [bonnet pepper]
gb|AAC35858.1|  polyubiquitin                                           308   3e-102   Capsicum chinense [bonnet pepper]
gb|AFK43392.1|  unknown                                                 306   3e-102   Medicago truncatula
ref|XP_003627152.1|  Ubiquitin                                          307   4e-102   
ref|XP_004976899.1|  PREDICTED: polyubiquitin 3-like                    303   4e-102   Setaria italica
ref|XP_003590494.1|  Ubiquitin                                          309   4e-102   
ref|XP_004497490.1|  PREDICTED: polyubiquitin 4-like                    303   4e-102   Cicer arietinum [garbanzo]
gb|KJB69254.1|  hypothetical protein B456_011G016600                    303   4e-102   Gossypium raimondii
gb|ABY60454.1|  putative polyubiquitin                                  308   5e-102   Adonis aestivalis var. palaestina
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             306   5e-102   
gb|AES89865.2|  polyubiquitin 3                                         308   5e-102   Medicago truncatula
ref|XP_006495477.1|  PREDICTED: polyubiquitin 3-like                    303   5e-102   Citrus sinensis [apfelsine]
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          306   5e-102   Sorghum bicolor [broomcorn]
gb|AAQ84316.1|  fiber polyubiquitin                                     306   5e-102   Gossypium barbadense [Egyptian cotton]
ref|XP_010931828.1|  PREDICTED: polyubiquitin                           303   5e-102   
ref|XP_004501591.1|  PREDICTED: polyubiquitin 4-like                    303   6e-102   Cicer arietinum [garbanzo]
ref|XP_009758989.1|  PREDICTED: polyubiquitin                           303   6e-102   Nicotiana sylvestris
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             308   6e-102   
emb|CAC94926.1|  putative ubiquitin                                     306   6e-102   Pleurotus sp. 'Florida' [Florida oyster mushroom]
gb|ABF06579.2|  polyubiquitin                                           303   6e-102   Gladiolus grandiflorus
emb|CBI22349.3|  unnamed protein product                                308   6e-102   Vitis vinifera
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             305   6e-102   Citrus clementina [clementine]
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    305   6e-102   Candida albicans
ref|XP_719867.1|  hypothetical protein CaO19.6771                       305   7e-102   Candida albicans SC5314
gb|AAK68824.1|  Unknown protein                                         305   7e-102   Arabidopsis thaliana [mouse-ear cress]
gb|ACA58351.1|  ubiquitin-like protein                                  304   7e-102   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_008246113.1|  PREDICTED: polyubiquitin                           302   7e-102   Prunus mume [ume]
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  305   7e-102   Piloderma croceum F 1598
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   305   8e-102   Piloderma croceum F 1598
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   305   8e-102   Brassica rapa
gb|KIR83632.1|  polyubiquitin                                           305   8e-102   Cryptococcus gattii VGIV IND107
ref|XP_007014924.1|  Polyubiquitin 3                                    308   8e-102   Theobroma cacao [chocolate]
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                310   9e-102   
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 305   9e-102   Dacryopinax primogenitus
ref|XP_006685644.1|  ubiquitin                                          305   9e-102   Yamadazyma tenuis ATCC 10573
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                308   9e-102   Erythranthe guttata [common monkey flower]
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  305   9e-102   Hypholoma sublateritium FD-334 SS-4
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             308   9e-102   
ref|XP_011110054.1|  hypothetical protein H072_4094                     305   9e-102   
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            306   9e-102   Phaseolus vulgaris [French bean]
emb|CAH59740.1|  polyubiquitin                                          308   9e-102   Plantago major [cart-track plant]
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             308   9e-102   
ref|XP_007339454.1|  ubiquitin                                          308   9e-102   
ref|XP_007512209.1|  polyubiquitin                                      310   9e-102   Bathycoccus prasinos
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           308   9e-102   Brassica rapa
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  305   9e-102   Paxillus rubicundulus Ve08.2h10
ref|XP_009420214.1|  PREDICTED: polyubiquitin                           302   1e-101   
emb|CDP08569.1|  unnamed protein product                                308   1e-101   Coffea canephora [robusta coffee]
prf||1604470A  poly-ubiquitin                                           306   1e-101   Zea mays [maize]
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           308   1e-101   Nelumbo nucifera [Indian lotus]
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          308   1e-101   Sorghum bicolor [broomcorn]
dbj|BAJ85978.1|  predicted protein                                      308   1e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             308   1e-101   
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             308   1e-101   Citrus clementina [clementine]
gb|AAO42469.1|  putative polyubiquitin                                  307   1e-101   Arabidopsis lyrata [lyrate rockcress]
ref|NP_851029.1|  polyubiquitin 3                                       308   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|ABI84246.1|  polyubiquitin 10                                        303   1e-101   Arachis hypogaea [goober]
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      308   1e-101   
gb|KJB62487.1|  hypothetical protein B456_009G418900                    308   1e-101   Gossypium raimondii
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    308   1e-101   Linum usitatissimum
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         308   1e-101   Jatropha curcas
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           308   1e-101   Fragaria vesca subsp. vesca
ref|XP_001830230.1|  ubiquitin                                          308   1e-101   Coprinopsis cinerea okayama7#130
gb|AFK46460.1|  unknown                                                 302   1e-101   Medicago truncatula
gb|AFW66439.1|  putative ubiquitin family protein                       307   1e-101   
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      308   1e-101   Oryza brachyantha
gb|ACD31680.1|  ubiquitin                                               307   1e-101   Gossypium hirsutum [American cotton]
ref|XP_003082269.1|  polyubiquitin (ISS)                                307   1e-101   
ref|XP_007154494.1|  hypothetical protein PHAVU_003G1236001g            303   1e-101   Phaseolus vulgaris [French bean]
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      310   1e-101   Nelumbo nucifera [Indian lotus]
emb|CBY46746.1|  polyubiquitin 10 protein                               310   1e-101   Lepidium campestre [bastard cress]
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      307   1e-101   Citrus sinensis [apfelsine]
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             307   1e-101   Citrus clementina [clementine]
gb|AAO43308.1|  putative polyubiquitin                                  305   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             307   1e-101   
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             307   1e-101   
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      307   1e-101   Glycine max [soybeans]
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    308   1e-101   Phoenix dactylifera
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    310   1e-101   Nicotiana sylvestris
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         307   1e-101   Jatropha curcas
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             307   1e-101   Citrus clementina [clementine]
gb|AAB95250.1|  ubiquitin                                               307   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ82816.1|  ubiquitin monomer protein                               301   1e-101   Morus mongolica [Mongolian mulberry]
gb|AAL09741.1|  AT4g05320/C17L7_240                                     310   1e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CAA40323.1|  polyubiquitin protein                                  308   1e-101   Helianthus annuus
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  305   1e-101   Pisolithus microcarpus 441
ref|NP_849300.4|  polyubiquitin 10                                      310   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010938173.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    305   1e-101   
gb|KJB13592.1|  hypothetical protein B456_002G083000                    310   2e-101   Gossypium raimondii
emb|CDP05795.1|  unnamed protein product                                310   2e-101   Coffea canephora [robusta coffee]
gb|AAB68045.1|  polyubiquitin                                           310   2e-101   Fragaria x ananassa
gb|AAF04147.1|  ubiquitin precursor                                     310   2e-101   Hevea brasiliensis [jebe]
ref|XP_003619702.1|  Ubiquitin-like protein                             305   2e-101   
gb|AAB36545.1|  ubiquitin-like protein                                  311   2e-101   Phaseolus vulgaris [French bean]
gb|KJB81825.1|  hypothetical protein B456_013G163500                    310   2e-101   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      310   2e-101   Nicotiana sylvestris
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                310   2e-101   Pyrus x bretschneideri [bai li]
ref|XP_010069740.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    304   2e-101   Eucalyptus grandis [rose gum]
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      308   2e-101   Brachypodium distachyon [annual false brome]
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        310   2e-101   
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           307   2e-101   Elaeis guineensis
dbj|GAC94856.1|  ubiquitin                                              304   2e-101   Pseudozyma hubeiensis SY62
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      309   2e-101   Nicotiana tomentosiformis
dbj|GAC77607.1|  ubiquitin and ubiquitin-like proteins                  304   2e-101   Moesziomyces antarcticus T-34
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   306   2e-101   Amanita muscaria Koide BX008
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         308   2e-101   
gb|EWZ40370.1|  ubiquitin C                                             304   2e-101   Fusarium oxysporum Fo47
emb|CAA54603.1|  pentameric polyubiquitin                               308   2e-101   Nicotiana tabacum [American tobacco]
gb|KJB14874.1|  hypothetical protein B456_002G147600                    308   3e-101   Gossypium raimondii
gb|AFW66442.1|  putative ubiquitin family protein                       303   3e-101   
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             304   3e-101   Selaginella moellendorffii
ref|XP_008809849.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    301   3e-101   Phoenix dactylifera
gb|AEW46688.1|  polyubiquitin                                           303   3e-101   Ulva linza
gb|KDB11907.1|  ubiquitin                                               306   3e-101   Ustilaginoidea virens
dbj|BAF00213.1|  polyubiquitin 4 UBQ4                                   308   3e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CDP08567.1|  unnamed protein product                                308   3e-101   Coffea canephora [robusta coffee]
ref|XP_011390959.1|  putative polyubiquitin                             303   3e-101   Ustilago maydis 521
gb|AFW66438.1|  putative ubiquitin family protein                       308   3e-101   
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                306   3e-101   Serpula lacrymans var. lacrymans S7.3
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     303   3e-101   Rhodotorula toruloides
ref|XP_009412006.1|  PREDICTED: polyubiquitin 11-like                   304   3e-101   
ref|NP_001148453.1|  LOC100282068                                       309   3e-101   Zea mays [maize]
dbj|BAL61087.1|  polyubiquitin                                          303   3e-101   Dianthus caryophyllus [carnation]
emb|CEF99839.1|  Ubiquitin conserved site                               308   3e-101   Ostreococcus tauri
ref|XP_001731772.1|  hypothetical protein MGL_1040                      301   4e-101   Malassezia globosa CBS 7966
ref|XP_001783045.1|  predicted protein                                  303   4e-101   
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            306   4e-101   Phaseolus vulgaris [French bean]
prf||1101405A  ubiquitin precursor                                      302   4e-101   Saccharomyces cerevisiae [brewer's yeast]
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                307   4e-101   
gb|KJB62485.1|  hypothetical protein B456_009G418900                    306   4e-101   Gossypium raimondii
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      306   4e-101   Populus euphratica
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             306   4e-101   Capsella rubella
gb|KEH31155.1|  polyubiquitin 3                                         309   4e-101   Medicago truncatula
ref|XP_006372519.1|  polyubiquitin family protein                       306   4e-101   Populus trichocarpa [western balsam poplar]
emb|CCK72367.1|  hypothetical protein KNAG_0J02880                      300   4e-101   Kazachstania naganishii CBS 8797
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             303   5e-101   
gb|EGA57707.1|  Ubi4p                                                   304   5e-101   Saccharomyces cerevisiae FostersB
gb|AAO43309.1|  putative polyubiquitin                                  304   5e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  303   5e-101   Naumovozyma dairenensis CBS 421
ref|XP_002389222.1|  hypothetical protein MPER_11681                    300   5e-101   
ref|XP_002957068.1|  polyubiquitin                                      300   5e-101   Volvox carteri f. nagariensis
gb|AAM63271.1|  unknown                                                 300   5e-101   Arabidopsis thaliana [mouse-ear cress]
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   306   6e-101   Sphaerobolus stellatus SS14
gb|KDP23292.1|  hypothetical protein JCGZ_23125                         300   6e-101   Jatropha curcas
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           310   6e-101   Eucalyptus grandis [rose gum]
emb|CCT70325.1|  UBI4-Ubiquitin                                         305   6e-101   Fusarium fujikuroi IMI 58289
gb|AIY27743.1|  polyubiquitin Ubi10                                     306   6e-101   Betula luminifera [liang ye hua]
ref|XP_002447145.1|  hypothetical protein SORBIDRAFT_06g029360          300   7e-101   Sorghum bicolor [broomcorn]
emb|CEP60563.1|  LALA0S01e13784g1_1                                     303   7e-101   Lachancea lanzarotensis
gb|KIY53974.1|  polyubiquitin                                           305   7e-101   Fistulina hepatica ATCC 64428
ref|XP_003030030.1|  polyubiquitin                                      305   7e-101   Schizophyllum commune H4-8
gb|KIY45417.1|  ubiquitin                                               305   7e-101   Fistulina hepatica ATCC 64428
emb|CCL99875.1|  predicted protein                                      306   7e-101   Fibroporia radiculosa
ref|XP_006381473.1|  polyubiquitin family protein                       305   7e-101   
gb|AHC00631.1|  polyubiquitin                                           306   8e-101   Ganoderma lucidum
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             310   8e-101   Phaseolus vulgaris [French bean]
ref|XP_001701379.1|  bi-ubiquitin, major isoform                        300   8e-101   Chlamydomonas reinhardtii
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    305   8e-101   Populus euphratica
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 305   8e-101   Scleroderma citrinum Foug A
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                310   8e-101   
ref|XP_001828882.1|  ubiquitin C                                        305   8e-101   Coprinopsis cinerea okayama7#130
ref|XP_001931824.1|  ubiquitin                                          303   9e-101   Pyrenophora tritici-repentis Pt-1C-BFP
gb|EPX74297.1|  ubiquitin                                               303   9e-101   Schizosaccharomyces octosporus yFS286
gb|ADD52202.1|  ubiquitin                                               308   9e-101   Catharanthus roseus [chatas]
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              303   9e-101   Pseudocercospora fijiensis CIRAD86
ref|XP_007763327.1|  polyubiquitin                                      305   9e-101   Coniophora puteana RWD-64-598 SS2
ref|XP_002419618.1|  ubiquitin, putative                                305   9e-101   Candida dubliniensis CD36
ref|XP_001555417.1|  polyubiquitin                                      305   9e-101   Botrytis cinerea B05.10
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             305   9e-101   Exserohilum turcica Et28A
gb|KIR63773.1|  polyubiquitin                                           305   9e-101   Cryptococcus gattii CA1873
ref|XP_002872109.1|  predicted protein                                  308   9e-101   
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                308   9e-101   
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         308   1e-100   Elaeis guineensis
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                308   1e-100   Erythranthe guttata [common monkey flower]
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      308   1e-100   Nelumbo nucifera [Indian lotus]
gb|AGV54228.1|  polyubiquitin-like protein                              308   1e-100   Phaseolus vulgaris [French bean]
ref|XP_001598085.1|  polyubiquitin                                      305   1e-100   Sclerotinia sclerotiorum 1980 UF-70
gb|KFX48439.1|  Polyubiquitin                                           302   1e-100   Talaromyces marneffei PM1
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  305   1e-100   Botryobasidium botryosum FD-172 SS1
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             308   1e-100   Eutrema salsugineum [saltwater cress]
gb|EFN76024.1|  Ubiquitin                                               302   1e-100   Harpegnathos saltator
gb|EKV18932.1|  hypothetical protein PDIP_25190                         302   1e-100   Penicillium digitatum Pd1
gb|ACS68205.1|  ubiquitin 10.2                                          308   1e-100   Brassica napus [oilseed rape]
gb|KJB81824.1|  hypothetical protein B456_013G163500                    308   1e-100   Gossypium raimondii
ref|XP_007864655.1|  ubiquitin                                          308   1e-100   Gloeophyllum trabeum ATCC 11539
gb|ADP05114.1|  polyubiquitin 10                                        302   1e-100   Aponogeton madagascariensis [laceleaf]
gb|KJB62486.1|  hypothetical protein B456_009G418900                    308   1e-100   Gossypium raimondii
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    308   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             308   1e-100   
ref|NP_001105376.1|  polyubiquitin                                      308   1e-100   
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    302   1e-100   Parastagonospora nodorum SN15
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                308   1e-100   Erythranthe guttata [common monkey flower]
ref|NP_568397.1|  ubiquitin 4                                           308   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001174480.1|  Os05g0504766                                       308   1e-100   
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      308   1e-100   Nelumbo nucifera [Indian lotus]
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    308   1e-100   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             308   1e-100   Capsella rubella
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      308   1e-100   Tarenaya hassleriana [spider flower]
ref|XP_002891806.1|  predicted protein                                  308   1e-100   
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         307   1e-100   Nicotiana tomentosiformis
gb|AAQ07453.1|  ubiquitin                                               307   1e-100   Musa acuminata AAA Group [Cavendish banana]
gb|AGZ15412.1|  fiber polyubiquitin                                     302   1e-100   Phaseolus vulgaris [French bean]
gb|KIR29996.1|  polyubiquitin                                           305   1e-100   Cryptococcus gattii VGII LA55
gb|ABU40645.1|  polyubiquitin                                           307   1e-100   Triticum aestivum [Canadian hard winter wheat]
ref|XP_005644220.1|  polyubiquitin                                      305   1e-100   Coccomyxa subellipsoidea C-169
ref|NP_849299.4|  polyubiquitin 10                                      310   1e-100   Arabidopsis thaliana [mouse-ear cress]
gb|KJB62483.1|  hypothetical protein B456_009G418900                    307   1e-100   Gossypium raimondii
ref|XP_001420612.1|  predicted protein                                  307   1e-100   Ostreococcus lucimarinus CCE9901
gb|KJB13590.1|  hypothetical protein B456_002G083000                    310   1e-100   Gossypium raimondii
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      307   1e-100   Nicotiana tomentosiformis
ref|XP_002508175.1|  ubiquitin                                          307   1e-100   Micromonas commoda
ref|XP_002953480.1|  polyubiquitin                                      305   1e-100   
emb|CAD27944.1|  polyubiquitin-like                                     301   1e-100   
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   310   2e-100   
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    307   2e-100   
ref|NP_001053957.1|  Os04g0628100                                       308   2e-100   
gb|KJB81827.1|  hypothetical protein B456_013G163500                    310   2e-100   
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           310   2e-100   
gb|AAY86773.1|  polyubiquitin                                           307   2e-100   
gb|AAB95252.1|  ubiquitin                                               307   2e-100   
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    307   2e-100   
gb|AAX40652.1|  polyubiquitin                                           307   2e-100   
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    307   2e-100   
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  306   2e-100   
emb|CAA25706.1|  unnamed protein product                                300   2e-100   
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    310   2e-100   
ref|XP_007366816.1|  polyubiquitin                                      305   2e-100   
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             307   2e-100   
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         307   2e-100   
emb|CAB81074.1|  polyubiquitin (ubq10)                                  310   2e-100   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    307   2e-100   
gb|EMS65864.1|  Polyubiquitin                                           308   2e-100   
emb|CCA70326.1|  related to UBI4-Ubiquitin                              301   2e-100   
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                310   2e-100   
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    310   2e-100   
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             308   2e-100   
dbj|GAK65396.1|  ubiquitin                                              305   2e-100   
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      307   3e-100   
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      308   3e-100   
ref|XP_001755431.1|  predicted protein                                  301   3e-100   
gb|AAZ42330.1|  ubiquitin protein 1                                     299   3e-100   
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   301   3e-100   
emb|CCF48657.1|  probable polyubiquitin                                 301   3e-100   
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    309   3e-100   
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   301   3e-100   
gb|EWZ87538.1|  ubiquitin C                                             298   3e-100   
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             304   3e-100   
ref|XP_001755307.1|  predicted protein                                  304   3e-100   
emb|CAI83757.1|  Polyubiqutin 4                                         299   3e-100   
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  301   3e-100   
gb|EZF98642.1|  polyubiquitin                                           301   3e-100   
gb|KIY97324.1|  ubiquitin C                                             300   3e-100   
gb|EHN01342.1|  Ubi4p                                                   298   3e-100   
ref|XP_003052575.1|  predicted protein                                  304   3e-100   
ref|XP_001764949.1|  predicted protein                                  304   3e-100   
gb|EJW80596.1|  polyubiquitin                                           300   4e-100   
ref|XP_007873662.1|  hypothetical protein PNEG_01699                    298   4e-100   
ref|XP_003648495.1|  hypothetical protein Ecym_8408                     298   4e-100   
ref|XP_010480024.1|  PREDICTED: polyubiquitin-like                      304   4e-100   
gb|AAO43306.1|  putative polyubiquitin                                  304   4e-100   
gb|AIS71924.1|  polyubiquitin                                           301   4e-100   
ref|XP_002551324.1|  ubiquitin                                          303   4e-100   
gb|AAO43305.1|  putative polyubiquitin                                  304   4e-100   
emb|CCG34086.1|  Polyubiquitin                                          303   4e-100   
gb|EMS24129.1|  ubiquitin C                                             301   4e-100   
gb|AAA49129.1|  ubiquitin polyprotein (heat shock related)              298   4e-100   
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          309   5e-100   
ref|XP_003687789.1|  hypothetical protein TPHA_0K02250                  298   5e-100   
dbj|GAA27344.2|  polyubiquitin-A                                        303   5e-100   
emb|CAL30085.1|  polyubiquitin                                          298   5e-100   
gb|ACB87916.1|  polyubiquitin 1                                         300   5e-100   
gb|AAL91103.1|  ubiquitin                                               301   5e-100   
gb|EIE85715.1|  polyubiquitin                                           300   6e-100   
ref|XP_001777816.1|  predicted protein                                  306   6e-100   
ref|XP_006407638.1|  hypothetical protein EUTSA_v10022008mg             300   6e-100   
gb|AGM32540.1|  polyubiquitin-B-like isoform                            301   6e-100   
gb|ACJ85658.1|  unknown                                                 300   6e-100   
gb|ACX46987.1|  ubiquitin                                               308   7e-100   
ref|XP_002839703.1|  hypothetical protein                               303   7e-100   
ref|XP_002955196.1|  polyubiquitin                                      300   7e-100   
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                305   7e-100   
ref|XP_007049060.1|  Polyubiquitin 10                                   308   7e-100   
dbj|BAK61751.1|  ubiquitin                                              300   7e-100   
gb|KIW56414.1|  polyubiquitin                                           303   7e-100   
dbj|BAK61744.1|  ubiquitin                                              300   7e-100   
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           308   7e-100   
dbj|BAP70433.1|  Ubiquitin                                              303   7e-100   
ref|XP_002494205.1|  Ubiquitin                                          303   8e-100   
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             305   8e-100   
gb|EIE88012.1|  polyubiquitin                                           300   8e-100   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     303   8e-100   
ref|XP_001210780.1|  ubiquitin                                          303   9e-100   
gb|AAA82978.1|  polyubiquitin                                           305   9e-100   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          300   9e-100   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    300   9e-100   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         303   9e-100   
gb|AAV65292.1|  polyubiquitin                                           303   9e-100   
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      308   9e-100   
ref|XP_008816966.1|  polyubiquitin                                      303   9e-100   
ref|NP_564675.1|  ubiquitin-like                                        300   9e-100   
ref|XP_004156525.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    299   9e-100   
ref|XP_001227036.1|  polyubiquitin                                      303   9e-100   
gb|AFR98116.1|  polyubiquitin                                           305   9e-100   
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  306   9e-100   
gb|EEH07231.1|  ubiquitin                                               303   9e-100   
gb|EMS60894.1|  Polyubiquitin                                           308   1e-99    
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 305   1e-99    
gb|EJU00136.1|  ubiquitin                                               305   1e-99    
ref|XP_003619701.1|  Ubiquitin-like protein                             302   1e-99    
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          308   1e-99    
ref|XP_003608276.1|  Ubiquitin                                          310   1e-99    
gb|EUC59758.1|  polyubiquitin                                           305   1e-99    
gb|AEZ66647.1|  putative beta-1,6-glucanase                             305   1e-99    
gb|AES89856.2|  polyubiquitin 3                                         300   1e-99    
gb|KEZ40313.1|  Polyubiquitin                                           303   1e-99    
dbj|GAA55031.1|  ubiquitin C                                            300   1e-99    
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  305   1e-99    
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             305   1e-99    
ref|XP_003196661.1|  ATP-dependent protein binding protein              305   1e-99    
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     300   1e-99    
gb|KHJ77263.1|  ubiquitin family protein                                298   1e-99    
gb|AAO43310.1|  putative polyubiquitin                                  300   1e-99    
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  305   1e-99    
ref|XP_001880135.1|  ubiquitin                                          305   1e-99    
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           308   1e-99    
ref|XP_005850582.1|  hypothetical protein CHLNCDRAFT_48528              300   1e-99    
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  305   1e-99    
ref|XP_010756991.1|  polyubiquitin                                      303   1e-99    
emb|CAA26488.1|  unnamed protein product                                297   1e-99    
ref|XP_005056764.1|  PREDICTED: polyubiquitin-C-like isoform X2         300   1e-99    
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    308   1e-99    
gb|ETN78467.1|  ubiquitin family protein                                300   1e-99    
ref|XP_004341200.1|  polyubiquitin, putative                            300   1e-99    
gb|EEH20847.2|  polyubiquitin                                           303   1e-99    
dbj|BAK02501.1|  predicted protein                                      308   1e-99    
gb|ABD32351.2|  Ubiquitin                                               310   1e-99    
ref|XP_009983603.1|  PREDICTED: polyubiquitin isoform X14               298   1e-99    
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    305   1e-99    
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           308   1e-99    
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                307   1e-99    
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    305   1e-99    
gb|KDR10312.1|  Ubiquitin                                               300   1e-99    
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      307   1e-99    
ref|XP_003607659.1|  Ubiquitin                                          301   1e-99    
gb|KIY97628.1|  ubiquitin C                                             302   1e-99    
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         302   1e-99    
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        300   1e-99    
ref|XP_002888365.1|  polyubiquitin                                      307   1e-99    
gb|AAC16012.1|  polyubiquitin                                           307   1e-99    
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  302   1e-99    
gb|AAB95251.1|  ubiquitin                                               307   1e-99    
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         307   1e-99    
ref|NP_001045980.1|  Os02g0161900                                       307   1e-99    
dbj|BAK03691.1|  predicted protein                                      307   1e-99    
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           307   1e-99    
ref|XP_751791.1|  polyubiquitin UbiD/Ubi4                               303   1e-99    
gb|ERG83124.1|  polyubiquitin-a                                         296   1e-99    
gb|EEQ88150.1|  ubiquitin                                               302   1e-99    
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          300   1e-99    
emb|CAI83758.1|  Polyubiqutin 5                                         299   1e-99    
emb|CAA40324.1|  hexaubiquitin protein                                  307   1e-99    
dbj|BAC56534.1|  similar to polyubiquitin                               297   1e-99    
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          310   1e-99    
ref|XP_003627151.1|  Ubiquitin                                          310   1e-99    
dbj|BAJ91912.1|  predicted protein                                      307   1e-99    
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             307   2e-99    
ref|XP_659604.1|  hypothetical protein AN2000.2                         303   2e-99    
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           307   2e-99    
dbj|BAA76889.1|  ubiquitin                                              296   2e-99    
gb|AAY33920.2|  polyubiquitin                                           305   2e-99    
gb|EGE85556.1|  hypothetical protein BDDG_08501                         303   2e-99    
gb|AAD03343.1|  ubiquitin                                               307   2e-99    
sp|P62972.2|UBIQP_XENLA  RecName: Full=Polyubiquitin; Contains: R...    297   2e-99    
gb|AGT38457.1|  polyubiquitin                                           308   2e-99    
gb|AAA30720.1|  polyubiquitin                                           297   2e-99    
emb|CAA52290.1|  polyubiquitin                                          305   2e-99    
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      307   2e-99    
gb|ACN40936.1|  unknown                                                 307   2e-99    
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             307   2e-99    
gb|ADO60140.1|  ubiquitin                                               299   2e-99    
gb|KDN44728.1|  polyubiquitin                                           299   2e-99    
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           310   2e-99    
tpd|FAA00317.1|  TPA: polyubiquitin                                     302   2e-99    
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    302   2e-99    
ref|XP_007808982.1|  ubiquitin                                          303   2e-99    
ref|XP_002791169.1|  ubiquitin                                          302   2e-99    
gb|AIS40894.1|  polyubiquitin                                           307   2e-99    
gb|ABF66639.1|  ubiquitin                                               302   2e-99    
ref|XP_002888394.1|  hexaubiquitin protein                              308   2e-99    
dbj|BAK61738.1|  ubiquitin                                              297   2e-99    
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  301   2e-99    
ref|XP_009099257.1|  PREDICTED: polyubiquitin                           298   2e-99    
emb|CBY16339.1|  unnamed protein product                                297   2e-99    
gb|AFK47245.1|  unknown                                                 299   2e-99    
ref|XP_005831810.1|  ubiquitin                                          299   3e-99    
ref|XP_003607670.1|  Ubiquitin                                          309   3e-99    
ref|XP_002723083.2|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    300   3e-99    
gb|AFW70219.1|  polyubiquitin-like protein                              308   3e-99    
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    303   3e-99    
emb|CCO30833.1|  Polyubiquitin                                          305   3e-99    
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    308   3e-99    
dbj|BAH70616.1|  ACYPI007765                                            296   3e-99    
gb|EWS74283.1|  polyubiquitin                                           298   3e-99    
emb|CAA60629.1|  unnamed protein product                                296   3e-99    
ref|XP_001246797.1|  polyubiquitin                                      301   3e-99    
ref|XP_004946726.1|  PREDICTED: polyubiquitin-C-like isoform X8         299   3e-99    
ref|XP_002171731.1|  ubiquitin                                          304   3e-99    
ref|XP_004946727.1|  PREDICTED: polyubiquitin-C-like isoform X9         298   3e-99    
ref|XP_004365491.1|  polyubiquitin 5                                    298   3e-99    
sp|P23324.2|UBIQP_EUPEU  RecName: Full=Polyubiquitin; Contains: R...    298   3e-99    
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             304   3e-99    
gb|AAA31133.1|  poly-ubiquitin precursor                                299   3e-99    
dbj|BAH71116.1|  ACYPI006410                                            296   3e-99    
gb|KFP50091.1|  Polyubiquitin-B                                         297   3e-99    
gb|ADD24466.1|  Ubiquitin                                               298   4e-99    
dbj|GAA87419.1|  polyubiquitin                                          301   4e-99    
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                309   4e-99    
ref|XP_001538486.1|  polyubiquitin                                      301   4e-99    
gb|AAL91109.1|  ubiquitin                                               301   4e-99    
ref|XP_004934049.1|  PREDICTED: polyubiquitin-A-like                    296   4e-99    
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      306   4e-99    
gb|AAV84266.1|  ubiquitin                                               297   4e-99    
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             304   4e-99    
gb|KFP74355.1|  Polyubiquitin                                           296   4e-99    
dbj|BAL61084.1|  polyubiqutin                                           303   4e-99    
ref|XP_002842034.1|  hypothetical protein                               301   4e-99    
ref|XP_011175038.1|  PREDICTED: polyubiquitin                           295   4e-99    
gb|AAO43304.1|  putative polyubiquitin                                  301   4e-99    
ref|XP_011504237.1|  PREDICTED: polyubiquitin                           295   5e-99    
ref|XP_009171122.1|  hypothetical protein T265_07359                    295   5e-99    
ref|XP_005056765.1|  PREDICTED: polyubiquitin-C-like isoform X3         295   5e-99    
gb|EJW05300.1|  polyubiquitin                                           295   5e-99    



>gb|AHI85710.1| stress-induced protein 5, partial [Capsicum annuum]
Length=169

 Score =   310 bits (793),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  15   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  74

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  75   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  134

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  135  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  169


 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/93 (99%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = -3

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  1    IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  60

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  93



>gb|ABH08753.1| ubiquitin [Arabidopsis thaliana]
Length=219

 Score =   310 bits (793),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  65   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  124

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  125  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  184

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  185  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  219


 Score =   283 bits (724),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  543  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  364
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  363  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  184
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  183  TLADYNIQKESTLHLVLRLRGGF  115
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143



>gb|ABH08755.1| ubiquitin [Arabidopsis thaliana]
Length=221

 Score =   310 bits (793),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  67   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  126

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  127  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  186

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  187  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  221


 Score =   287 bits (735),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = -3

Query  549  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  370
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  1    TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  60

Query  369  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  190
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  61   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  120

Query  189  GRTLADYNIQKESTLHLVLRLRGGF  115
            GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  GRTLADYNIQKESTLHLVLRLRGGM  145



>gb|AAM78180.1| putative polyubiquitin [Gossypium herbaceum]
 gb|AAM78181.1| putative polyubiquitin [Gossypium raimondii]
 gb|AAM78182.1| putative polyubiquitin [Gossypium barbadense]
 gb|AAM78183.1| putative polyubiquitin, partial [Gossypium barbadense]
 gb|AAM78184.1| putative polyubiquitin [Gossypioides kirkii]
Length=204

 Score =   309 bits (791),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  50   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  109

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  110  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  169

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  170  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  204


 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/128 (99%), Positives = 127/128 (99%), Gaps = 0/128 (0%)
 Frame = -3

Query  498  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  319
            VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  1    VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  60

Query  318  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  139
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  138  VLRLRGGF  115
            VLRLRGG 
Sbjct  121  VLRLRGGM  128



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   310 bits (794),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   301 bits (771),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   310 bits (794),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   300 bits (768),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ACZ69386.1| polyubiquitin UBQ14 [Cucumis sativus]
Length=197

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  43   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  102

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  103  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  162

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  163  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  197


 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/121 (99%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = -3

Query  477  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  298
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  1    KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  60

Query  297  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  61   VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  120

Query  117  F  115
             
Sbjct  121  M  121



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   310 bits (793),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   303 bits (775),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007693173.1| hypothetical protein COCMIDRAFT_109160, partial [Bipolaris oryzae 
ATCC 44560]
 gb|EUC40302.1| hypothetical protein COCMIDRAFT_109160, partial [Bipolaris oryzae 
ATCC 44560]
Length=175

 Score =   308 bits (788),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  21   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  80

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  81   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  140

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  141  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  174


 Score =   198 bits (503),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/99 (99%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = -3

Query  411  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  232
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  1    TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  60

Query  231  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  99



>gb|AAZ32851.1| pentameric polyubiquitin [Medicago sativa]
Length=189

 Score =   308 bits (789),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  21   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  80

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  81   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  140

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  141  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  175


 Score =   198 bits (503),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/99 (99%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = -3

Query  411  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  232
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  1    TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  60

Query  231  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  99


 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/93 (100%), Positives = 93/93 (100%), Gaps = 0/93 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  97   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  156

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  301
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  157  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  189



>gb|AFP44113.1| ubiquitin, partial [Lycoris longituba]
Length=187

 Score =   308 bits (788),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  2    GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  61

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  62   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  121

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  122  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  156


 Score =   215 bits (548),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/110 (99%), Positives = 109/110 (99%), Gaps = 0/110 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  78   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  137

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  250
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIDNVKAKIQD
Sbjct  138  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDTIDNVKAKIQD  187


 Score =   160 bits (406),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -3

Query  354  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  175
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  174  DYNIQKESTLHLVLRLRGGF  115
            DYNIQKESTLHLVLRLRGG 
Sbjct  61   DYNIQKESTLHLVLRLRGGM  80



>gb|AFJ04519.1| ubiquitin, partial [Vernicia fordii]
Length=176

 Score =   307 bits (787),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  22   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  81

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  82   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  141

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  142  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  175


 Score =   200 bits (508),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/100 (99%), Positives = 99/100 (99%), Gaps = 0/100 (0%)
 Frame = -3

Query  414  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  235
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  1    RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  60

Query  234  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  100



>sp|P0CG83.1|UBIQP_HORVU RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Hordeum vulgare]
 emb|CAA27751.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=171

 Score =   307 bits (787),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  17   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  76

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  77   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  136

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  137  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  170


 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -3

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  95



>gb|AFC36452.1| ubiquitin, partial [Anoectochilus roxburghii]
Length=214

 Score =   308 bits (790),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  30   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  89

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  90   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  149

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  150  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  184


 Score =   216 bits (550),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/108 (99%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = -3

Query  438  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  259
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  1    AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  60

Query  258  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  108


 Score =   214 bits (545),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/109 (99%), Positives = 109/109 (100%), Gaps = 0/109 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  106  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  165

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  253
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI+
Sbjct  166  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIR  214



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   309 bits (791),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGY  229


 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>pir||PS0380 ubiquitin precursor - rice (fragment)
 dbj|BAA02241.1| poly-ubiquitin [Oryza sativa Japonica Group]
Length=189

 Score =   307 bits (787),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  35   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  94

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  95   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  154

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  155  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  189


 Score =   225 bits (573),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  453  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  274
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  273  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  113



>gb|ABR25718.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=178

 Score =   307 bits (786),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  24   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  83

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  84   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  143

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  144  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  177


 Score =   204 bits (518),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = -3

Query  420  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  241
            DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
Sbjct  1    DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  60

Query  240  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  102



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   310 bits (795),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  123  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  182

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  183  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  242

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  243  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  277


 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  108

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  201



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   308 bits (790),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*IP*CPN  94
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGALMQWCLN  236


 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAB36546.1| polyubiquitin [Phaseolus vulgaris]
Length=215

 Score =   307 bits (787),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  121  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  180

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  181  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  215


 Score =   276 bits (707),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -3

Query  531  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  352
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  351  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  172
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  171  YNIQKESTLHLVLRLRGGF  115
            YNIQKESTLHLVLRLRGG 
Sbjct  121  YNIQKESTLHLVLRLRGGM  139



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   309 bits (791),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   304 bits (779),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  259
            YNIQKESTLHLVLRLRGGMQIFVKT TGKTITLE ESSDTIDNVKAK
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKAK  257



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   311 bits (796),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   306 bits (784),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  244
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK+
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   309 bits (792),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  115  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  174

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  175  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  234

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  235  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  269


 Score =   302 bits (773),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  41   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  100

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  101  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  160

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  161  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  193



>gb|EEC81189.1| hypothetical protein OsI_24195 [Oryza sativa Indica Group]
Length=223

 Score =   308 bits (788),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  69   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  128

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  129  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  188

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  189  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  222


 Score =   277 bits (709),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  534  TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  355
            T EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL
Sbjct  8    TCEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  67

Query  354  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  175
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  68   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  127

Query  174  DYNIQKESTLHLVLRLRGGF  115
            DYNIQKESTLHLVLRLRGG 
Sbjct  128  DYNIQKESTLHLVLRLRGGM  147



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   308 bits (788),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229


 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   308 bits (789),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  64   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  123

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  124  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  183

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  184  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  218


 Score =   281 bits (719),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = -3

Query  540  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  361
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  360  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  181
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  180  LADYNIQKESTLHLVLRLRGGF  115
            LADYNIQKESTLHLVLRLRGG 
Sbjct  121  LADYNIQKESTLHLVLRLRGGM  142


 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/105 (99%), Positives = 105/105 (100%), Gaps = 0/105 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  140  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  199

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  265
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  200  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  244



>gb|ABH08754.1| ubiquitin [Arabidopsis thaliana]
Length=220

 Score =   307 bits (787),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  65   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  124

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  125  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  184

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  185  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  218


 Score =   283 bits (725),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  543  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  364
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  363  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  184
            LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  120

Query  183  TLADYNIQKESTLHLVLRLRGGF  115
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  TLADYNIQKESTLHLVLRLRGGM  143



>ref|NP_001190681.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_003626480.1| Ubiquitin-like protein [Medicago truncatula]
 ref|XP_008345057.1| PREDICTED: polyubiquitin [Malus domestica]
 ref|XP_009358112.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358113.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009345196.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009345209.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 gb|AAR83856.1| hexameric polyubiquitin 6PU11 [Capsicum annuum]
 emb|CAN77120.1| hypothetical protein VITISV_031666 [Vitis vinifera]
 gb|ACJ85770.1| unknown [Medicago truncatula]
 gb|AEE82471.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFK33927.1| unknown [Medicago truncatula]
 gb|AFK34391.1| unknown [Lotus japonicus]
 gb|AFP43342.1| polyubiquitin [Arabidopsis thaliana]
 gb|EPS65462.1| hypothetical protein M569_09314 [Genlisea aurea]
 gb|AHW29561.1| polyubiquitin [Picrorhiza kurrooa]
 emb|CDY46367.1| BnaA09g19810D [Brassica napus]
Length=153

 Score =   305 bits (780),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  153


 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGG 
Sbjct  135  YNIQKESTLHLVLRLRGGF  153



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   308 bits (788),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   310 bits (795),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   305 bits (780),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDERTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLED RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   310 bits (795),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ACT82769.1| polyubiquitin [Nicotiana tabacum]
Length=188

 Score =   306 bits (784),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  21   GGLQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  80

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  81   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  140

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  141  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  175


 Score =   194 bits (493),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = -3

Query  411  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  232
            TL DYNIQKESTLHLVLRLRGG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  1    TLPDYNIQKESTLHLVLRLRGGLQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  60

Query  231  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  99


 Score =   184 bits (466),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  97   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  156

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  304
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  157  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  188



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   308 bits (788),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  229


 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAF31707.1|AF221858_1 polyubiquitin [Euphorbia esula]
Length=215

 Score =   307 bits (786),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  121  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  180

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  181  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  214


 Score =   276 bits (707),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/139 (99%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -3

Query  531  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  352
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  351  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  172
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  120

Query  171  YNIQKESTLHLVLRLRGGF  115
            YNIQKESTLHLVLRLRGG 
Sbjct  121  YNIQKESTLHLVLRLRGGM  139



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   307 bits (787),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGG+
Sbjct  211  YNIQKESTLHLVLRLRGGV  229



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   309 bits (791),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  116  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  175

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  176  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  235

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  236  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   306 bits (785),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  40   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  99

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  100  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  159

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  160  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  194


 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/118 (99%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = -3

Query  468  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  289
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  288  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  118



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   307 bits (787),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   307 bits (787),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   307 bits (787),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (771),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   310 bits (794),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   307 bits (787),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (773),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   307 bits (787),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   307 bits (787),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   310 bits (793),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  142  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  201

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  202  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  261

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  262  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  296


 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  66   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  125

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  126  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  185

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  186  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  220


 Score =   286 bits (731),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = -3

Query  546  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  367
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  366  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  187
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  186  RTLADYNIQKESTLHLVLRLRGGF  115
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGM  144



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   307 bits (787),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   304 bits (778),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%), Gaps = 0/103 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  271
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   307 bits (787),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABR25697.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=201

 Score =   306 bits (784),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  47   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  166

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  167  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  200


 Score =   248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = -3

Query  489  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  310
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  1    KIQDKEGIPPDQQRLIFAGKQLEDGRTLXDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  60

Query  309  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  130
            ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
Sbjct  61   ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  120

Query  129  LRGGF  115
            LRGG 
Sbjct  121  LRGGM  125



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   307 bits (787),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (776),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   310 bits (794),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   310 bits (794),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  99   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  158

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  159  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  218

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*IP*CPN  94
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  +  C N
Sbjct  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGALMQWCLN  260


 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  25   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  84

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  85   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  144

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  145  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  177


 Score =   155 bits (392),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -3

Query  363  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  184
            L  R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  19   LECRKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  78

Query  183  TLADYNIQKESTLHLVLRLRGGF  115
            TLADYNIQKESTLHLVLRLRGG 
Sbjct  79   TLADYNIQKESTLHLVLRLRGGM  101



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   310 bits (794),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   309 bits (791),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  120  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  179

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  180  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  239

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  240  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  274


 Score =   306 bits (784),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  44   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  103

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  104  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  163

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  164  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  198


 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/122 (99%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -3

Query  480  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  301
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  300  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  121
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  120  GF  115
            G 
Sbjct  121  GM  122



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   307 bits (786),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   307 bits (787),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229


 Score =   303 bits (775),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (403),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/82 (96%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIF  334
            YNIQKESTLHLVLRLRGG+  F
Sbjct  211  YNIQKESTLHLVLRLRGGLTGF  232



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   307 bits (786),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   310 bits (793),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   305 bits (780),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR IFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAR32784.1| polyubiquitin [Clusia minor]
Length=223

 Score =   307 bits (786),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  27   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  86

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  87   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  146

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  147  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  181


 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/105 (99%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = -3

Query  429  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  250
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  1    QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  60

Query  249  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  105


 Score =   193 bits (491),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 104/116 (90%), Gaps = 1/116 (1%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  103  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  162

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL-EVESSDTIDNVKAKIQDKEGIP  235
            YNIQKESTLHLVLRLRGGMQIFVKTLTGK      V +   +  VKAKIQDKEGIP
Sbjct  163  YNIQKESTLHLVLRLRGGMQIFVKTLTGKDHHFWXVRTPIPLIMVKAKIQDKEGIP  218



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   310 bits (793),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG QLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   308 bits (788),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  19   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  78

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  79   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  138

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  139  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   307 bits (787),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  95   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  154

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  155  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  214

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  215  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  248


 Score =   194 bits (494),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/97 (99%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  405  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  226
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  225  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  97



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   308 bits (790),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  95   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  154

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  155  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  214

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  215  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  249


 Score =   304 bits (778),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/111 (99%), Positives = 110/111 (99%), Gaps = 0/111 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  171  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  230

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  247
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV SSDTIDNVKAKIQDK
Sbjct  231  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVKAKIQDK  281


 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = -3

Query  360  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  181
            RL+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  16   RLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  75

Query  180  LADYNIQKESTLHLVLRLRGGF  115
            LADYNIQKESTLHLVLRLRGG 
Sbjct  76   LADYNIQKESTLHLVLRLRGGM  97



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   310 bits (793),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  154  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  213

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  214  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  273

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  274  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score =   307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  2    GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  61

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  62   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  121

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  122  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  156


 Score =   307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  78   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  137

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  138  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  197

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  198  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  232


 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -3

Query  354  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  175
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  174  DYNIQKESTLHLVLRLRGGF  115
            DYNIQKESTLHLVLRLRGG 
Sbjct  61   DYNIQKESTLHLVLRLRGGM  80



>tpg|DAA44273.1| TPA: Ubiquitin fusion protein [Zea mays]
Length=205

 Score =   306 bits (783),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF*IP  106
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG   P
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGIIEP  156


 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGG+
Sbjct  135  YNIQKESTLHLVLRLRGGI  153



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   306 bits (785),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   302 bits (774),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAL25813.1| polyubiquitin, partial [Prunus avium]
Length=154

 Score =   303 bits (777),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  576  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  397
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  1    GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  60

Query  396  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  217
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG PPDQQRL
Sbjct  61   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTPPDQQRL  120

Query  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            IFAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGF
Sbjct  121  IFAGKQLEDGRTLADYNIQEESTLHLVLRLRGGF  154


 Score =   154 bits (390),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG PPDQQRLIFAGKQLEDGRTLAD
Sbjct  76   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTPPDQQRLIFAGKQLEDGRTLAD  135

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQ+ESTLHLVLRLRGG 
Sbjct  136  YNIQEESTLHLVLRLRGGF  154



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   308 bits (788),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  110  GGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  169

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  170  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  229

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  230  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  264


 Score =   305 bits (781),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  34   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  93

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQR
Sbjct  94   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQR  153

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  154  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  188


 Score =   194 bits (493),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/101 (97%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = -3

Query  417  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  238
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  237  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  112



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   309 bits (792),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGY  305


 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAI51312.2| polyubiquitin [Capsicum chinense]
Length=153

 Score =   303 bits (777),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLR RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRFRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  153


 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGG 
Sbjct  135  YNIQKESTLHLVLRLRGGF  153



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   308 bits (788),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  111  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  170

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQR
Sbjct  171  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQR  230

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  231  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  265


 Score =   307 bits (786),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  35   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  94

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  95   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  154

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  155  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  189


 Score =   225 bits (573),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  453  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  274
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  273  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  113



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   306 bits (785),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   307 bits (787),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   223 bits (568),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 120/155 (77%), Gaps = 35/155 (23%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT                            
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT----------------------------  242

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
                   LEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  243  -------LEDGRTLADYNIQKESTLHLVLRLRGGF  270



>ref|XP_004976899.1| PREDICTED: polyubiquitin 3-like [Setaria italica]
Length=153

 Score =   303 bits (776),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  153


 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGG+
Sbjct  135  YNIQKESTLHLVLRLRGGL  153



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   309 bits (791),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_004497490.1| PREDICTED: polyubiquitin 4-like [Cicer arietinum]
Length=154

 Score =   303 bits (776),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGG  346
            YNIQKESTLHLVLRLRGG
Sbjct  135  YNIQKESTLHLVLRLRGG  152



>gb|KJB69254.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=162

 Score =   303 bits (777),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/85 (100%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKT  325
            YNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKT  159



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   308 bits (788),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  10   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  69

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  70   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  129

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  130  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  164


 Score =   308 bits (788),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  86   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  145

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  146  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  205

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  206  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  240


 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/120 (100%), Positives = 120/120 (100%), Gaps = 0/120 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  162  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  221

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  222  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  281


 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/88 (99%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = -3

Query  378  TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  199
            TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  1    TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  60

Query  198  LEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   LEDGRTLADYNIQKESTLHLVLRLRGGM  88



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   306 bits (783),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   303 bits (776),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   308 bits (788),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/94 (100%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  298
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  244



>ref|XP_006495477.1| PREDICTED: polyubiquitin 3-like, partial [Citrus sinensis]
Length=164

 Score =   303 bits (777),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   181 bits (458),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/90 (100%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKT  310
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKT  164



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   306 bits (783),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 153/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   306 bits (783),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTL LVLRLRGGF
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLPLVLRLRGGF  229


 Score =   301 bits (770),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010931828.1| PREDICTED: polyubiquitin [Elaeis guineensis]
 gb|AFW66446.1| ubiquitin2 [Zea mays]
 gb|AFW70220.1| polyubiquitin-like protein [Zea mays]
Length=153

 Score =   303 bits (775),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGG  346
            YNIQKESTLHLVLRLRGG
Sbjct  135  YNIQKESTLHLVLRLRGG  152



>ref|XP_004501591.1| PREDICTED: polyubiquitin 4-like [Cicer arietinum]
Length=152

 Score =   303 bits (775),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGG  346
            YNIQKESTLHLVLRLRGG
Sbjct  135  YNIQKESTLHLVLRLRGG  152



>ref|XP_009758989.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
Length=154

 Score =   303 bits (775),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGG  346
            YNIQKESTLHLVLRLRGG
Sbjct  135  YNIQKESTLHLVLRLRGG  152



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   308 bits (789),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (777),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKES  151
            LIFAGKQLEDGRTLADYNIQKE+
Sbjct  271  LIFAGKQLEDGRTLADYNIQKEN  293



>emb|CAC94926.1| putative ubiquitin [Pleurotus sp. 'Florida']
Length=243

 Score =   306 bits (784),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  56   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  115

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  116  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  175

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  176  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  210


 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/134 (98%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = -3

Query  516  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  337
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  60

Query  336  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  157
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  120

Query  156  ESTLHLVLRLRGGF  115
            ESTLHLVLRLRGG 
Sbjct  121  ESTLHLVLRLRGGM  134


 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  132  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  191

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  259
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA+
Sbjct  192  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAR  238



>gb|ABF06579.2| polyubiquitin, partial [Gladiolus grandiflorus]
Length=162

 Score =   303 bits (776),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   177 bits (449),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTG  316
            YNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTG  162



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   308 bits (789),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  102  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  161

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  162  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  221

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  222  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  256


 Score =   303 bits (777),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  28   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  87

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  88   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  147

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  148  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  180


 Score =   224 bits (570),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/114 (99%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  178  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  237

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  238
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+
Sbjct  238  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   305 bits (782),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/154 (99%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRNLADYNIQKESTLHLVLRLRGG  228


 Score =   303 bits (775),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>sp|P0CG73.1|UBI1P_CANAX RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Candida albicans]
 gb|AAA84868.1| ubiquitin precursor [Candida albicans]
Length=229

 Score =   305 bits (782),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229


 Score =   296 bits (757),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLR RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRSRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   305 bits (782),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229


 Score =   298 bits (763),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   305 bits (782),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   302 bits (774),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ACA58351.1| ubiquitin-like protein [Sandersonia aurantiaca]
Length=189

 Score =   304 bits (778),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   228 bits (582),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  235
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189



>ref|XP_008246113.1| PREDICTED: polyubiquitin [Prunus mume]
Length=153

 Score =   302 bits (774),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  153


 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGG+
Sbjct  135  YNIQKESTLHLVLRLRGGI  153



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   305 bits (782),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   305 bits (782),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   157 bits (398),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGG+
Sbjct  211  YNIQKESTLHLVLRLRGGV  229



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   305 bits (781),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229


 Score =   300 bits (767),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKE+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIR83632.1| polyubiquitin, partial [Cryptococcus gattii IND107]
Length=218

 Score =   305 bits (780),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  64   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  123

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  124  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  183

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  184  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  217


 Score =   279 bits (714),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = -3

Query  540  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  361
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVL
Sbjct  1    TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  60

Query  360  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  181
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  180  LADYNIQKESTLHLVLRLRGGF  115
            L+DYNIQKESTLHLVLRLRGG 
Sbjct  121  LSDYNIQKESTLHLVLRLRGGM  142



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   308 bits (788),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010324327.1| PREDICTED: polyubiquitin isoform X2 [Solanum lycopersicum]
Length=381

 Score =   310 bits (795),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   305 bits (781),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   305 bits (781),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   308 bits (788),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGG+
Sbjct  287  YNIQKESTLHLVLRLRGGV  305



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   305 bits (781),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   308 bits (789),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  121
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303


 Score =   303 bits (777),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   305 bits (781),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   301 bits (770),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   306 bits (785),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   236 bits (601),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 119/119 (100%), Gaps = 0/119 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  223
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  269



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   308 bits (788),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   308 bits (788),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   308 bits (788),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   310 bits (793),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  126  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  185

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  186  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  245

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  246  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  280


 Score =   309 bits (792),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  202  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  261

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  262  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  321

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  322  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  355


 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 152/204 (75%), Gaps = 51/204 (25%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  469
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  468  --------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  367
                                      IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  366  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  187
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  186  RTLADYNIQKESTLHLVLRLRGGF  115
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGM  204



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   308 bits (788),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   305 bits (781),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (767),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_009420214.1| PREDICTED: polyubiquitin [Musa acuminata subsp. malaccensis]
Length=153

 Score =   302 bits (774),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   157 bits (398),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGG  346
            YNIQKESTLHLVLRLRGG
Sbjct  135  YNIQKESTLHLVLRLRGG  152



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>prf||1604470A poly-ubiquitin
Length=272

 Score =   306 bits (785),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  42   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  101

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  102  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  161

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  162  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  196


 Score =   306 bits (784),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  118  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  177

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  178  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  237

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  238  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  271


 Score =   239 bits (610),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = -3

Query  471  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  292
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  291  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  120



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305


 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAO42469.1| putative polyubiquitin [Arabidopsis lyrata]
Length=289

 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  66   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  125

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  126  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  185

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  186  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  220


 Score =   285 bits (730),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = -3

Query  546  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  367
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  366  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  187
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  186  RTLADYNIQKESTLHLVLRLRGGF  115
            RTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGM  144


 Score =   283 bits (723),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 146/154 (95%), Gaps = 8/154 (5%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  142  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  201

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS+        IQDKEGIPPDQQR
Sbjct  202  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSE--------IQDKEGIPPDQQR  253

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  254  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  287



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABI84246.1| polyubiquitin 10 [Arachis hypogaea]
Length=192

 Score =   303 bits (777),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   235 bits (600),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/118 (100%), Positives = 118/118 (100%), Gaps = 0/118 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  226
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  192



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  157  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  216

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  217  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  276

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  277  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  310


 Score =   303 bits (777),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  83   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  142

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  143  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  202

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  203  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  235


 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 135/159 (85%), Gaps = 6/159 (4%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA---  403
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  402  ---DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  232
               + +  +          R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  61   FARNAHTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  120

Query  231  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  159



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   306 bits (785),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  116  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  175

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  176  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  235

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  236  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  270


 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  40   GGMQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  99

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  100  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  159

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  160  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  194


 Score =   237 bits (604),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/118 (98%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = -3

Query  468  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  289
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  288  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  118


 Score =   224 bits (572),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/114 (100%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  192  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  251

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  238
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  252  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   308 bits (789),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   308 bits (789),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (777),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   164 bits (416),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 81/82 (99%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIF  334
            YNIQKESTLHLVLRLRGGMQI 
Sbjct  287  YNIQKESTLHLVLRLRGGMQIL  308



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_001830230.1| ubiquitin [Coprinopsis cinerea okayama7#130]
 gb|EAU91601.1| ubiquitin [Coprinopsis cinerea okayama7#130]
Length=305

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (764),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|AFK46460.1| unknown [Medicago truncatula]
Length=153

 Score =   302 bits (773),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKE TLHLVLRLRGGF
Sbjct  121  FAGKQLEDGRTLADYNIQKEFTLHLVLRLRGGF  153


 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKE TLHLVLRLRGG 
Sbjct  135  YNIQKEFTLHLVLRLRGGF  153



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (775),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 147/155 (95%), Gaps = 8/155 (5%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD        IQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD--------IQDKEGIPPDQQR  262

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  263  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGY  297



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   306 bits (783),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 153/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLDDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGF  305


 Score =   307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_003082269.1| polyubiquitin (ISS) [Ostreococcus tauri]
Length=288

 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  51   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  110

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  111  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  170

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  171  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  205


 Score =   261 bits (666),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/131 (100%), Positives = 131/131 (100%), Gaps = 0/131 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  127  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  186

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  187  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  246

Query  219  LIFAGKQLEDG  187
            LIFAGKQLEDG
Sbjct  247  LIFAGKQLEDG  257


 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/120 (98%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -3

Query  474  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  295
            +GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  10   DGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  69

Query  294  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  70   ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  129



>ref|XP_007154494.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26488.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=193

 Score =   303 bits (777),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   236 bits (601),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 119/119 (100%), Gaps = 0/119 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  223
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQ
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQ  193



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   310 bits (794),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   310 bits (794),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   305 bits (782),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  19   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  78

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQR
Sbjct  79   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQR  138

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  139  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   301 bits (772),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLAD
Sbjct  95   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLAD  154

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  155  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  214

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  215  LIFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/97 (99%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  405  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  226
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  225  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  97



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (775),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   306 bits (783),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   310 bits (794),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  223  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  282

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  283  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  342

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  343  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  377


 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  71   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  130

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  131  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  190

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  191  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  225


 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  147  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  206

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  207  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  266

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  267  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  301


 Score =   294 bits (752),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = -3

Query  561  VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  382
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  381  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  202
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  201  QLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            QLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGM  149



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (769),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGM  153



>gb|AAZ82816.1| ubiquitin monomer protein [Morus mongolica]
Length=152

 Score =   301 bits (772),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTLADYNIQKESTLHLV+RLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVIRLRGG  152


 Score =   157 bits (397),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGG  346
            YNIQKESTLHLV+RLRGG
Sbjct  135  YNIQKESTLHLVIRLRGG  152



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   310 bits (794),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGM  153



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   308 bits (790),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   308 bits (790),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   304 bits (778),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/108 (100%), Positives = 108/108 (100%), Gaps = 0/108 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  256
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  334



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   305 bits (781),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  93   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  152

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  153  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  212

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  213  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   305 bits (781),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  17   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  76

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  77   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  136

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  137  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  171


 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -3

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  95



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   310 bits (794),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010938173.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis 
guineensis]
Length=232

 Score =   305 bits (780),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQ  340
            YNIQKESTLHLVLRLRGG +
Sbjct  135  YNIQKESTLHLVLRLRGGAK  154



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/81 (96%), Positives = 80/81 (99%), Gaps = 0/81 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  303  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  362

Query  399  YNIQKESTLHLVLRLRGGMQI  337
            YNIQKESTLHLVLRLRGG ++
Sbjct  363  YNIQKESTLHLVLRLRGGFRM  383



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   305 bits (782),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (769),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AAF04147.1| ubiquitin precursor [Hevea brasiliensis]
Length=381

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   298 bits (764),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITL VESSDTIDNVKAKIQDKEGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLGVESSDTIDNVKAKIQDKEGIPPDQQRFI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  L     LAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGSSLRMVAPLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   286 bits (731),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITL VESSDTIDNVKAKIQDKEGIPPDQQR IFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLGVESSDTIDNVKAKIQDKEGIPPDQQRFIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAG  L     LADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGSSLRMVAPLADYNIQKESTLHLVLRLRGGM  229



>ref|XP_003619702.1| Ubiquitin-like protein [Medicago truncatula]
Length=245

 Score =   305 bits (781),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  52   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  111

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  112  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  171

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  172  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  204


 Score =   229 bits (584),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  126  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  185

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  235
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  186  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   311 bits (796),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  253  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  312

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  313  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  372

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  373  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  407


 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  101  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  160

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  161  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  221  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  255


 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  177  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  236

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  237  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  296

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  297  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  331


 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 119/138 (86%), Gaps = 3/138 (2%)
 Frame = -3

Query  528  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  349
            +V  S  ++ V A++ D +      Q   FA KQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  45   QVFVSHMVEGVDARLLDVQKGHKGAQ--CFA-KQLEDGRTLADYNIQKESTLHLVLRLRG  101

Query  348  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  169
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  102  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  161

Query  168  NIQKESTLHLVLRLRGGF  115
            NIQKESTLHLVLRLRGG 
Sbjct  162  NIQKESTLHLVLRLRGGM  179



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   306 bits (783),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   310 bits (795),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  247  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  306

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  307  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  366

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  367  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  401


 Score =   308 bits (788),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  95   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  154

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  155  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  214

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  215  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  249


 Score =   308 bits (788),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  171  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  230

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  231  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  290

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  291  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  325


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  576  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  397
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  20   SMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  79

Query  396  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  217
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  80   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173



>ref|XP_010069740.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus 
grandis]
Length=232

 Score =   304 bits (779),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQ  340
            YNIQKESTLHLVLRLRGG +
Sbjct  135  YNIQKESTLHLVLRLRGGAK  154



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  111  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  170

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  171  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  230

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  231  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  265


 Score =   308 bits (788),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  187  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  246

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  306

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  307  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  340


 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  37   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  96

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  97   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  156

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  157  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  189



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 153/154 (99%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (774),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>dbj|GAC94856.1| ubiquitin [Pseudozyma hubeiensis SY62]
Length=228

 Score =   304 bits (778),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQ  340
            YNIQKESTLHLVLRLRGG +
Sbjct  135  YNIQKESTLHLVLRLRGGAK  154



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   306 bits (784),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (762),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGM  153



>dbj|GAC77607.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAK66521.1| ubiquitin domain containing protein [Pseudozyma antarctica]
Length=228

 Score =   304 bits (778),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQ  340
            YNIQKESTLHLVLRLRGG +
Sbjct  135  YNIQKESTLHLVLRLRGGAK  154



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (782),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   308 bits (788),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  27   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  86

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  87   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  146

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  147  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  181


 Score =   308 bits (788),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  103  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  162

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  163  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  222

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  223  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  257


 Score =   307 bits (787),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  179  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  238

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  239  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  298

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  299  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  390  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  211
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  210  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  105



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   304 bits (778),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/154 (98%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (767),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (777),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  235
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   308 bits (789),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  40   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  99

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  100  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  159

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  160  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  194


 Score =   308 bits (789),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  116  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  175

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  176  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  235

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  236  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  270


 Score =   305 bits (782),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  192  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  251

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  252  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  311

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  121
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  312  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  344


 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 117/153 (76%), Gaps = 35/153 (23%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLE                                   DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  118



>gb|AFW66442.1| putative ubiquitin family protein, partial [Zea mays]
Length=216

 Score =   303 bits (777),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   283 bits (725),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/142 (100%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKE  154
            LIFAGKQLEDGRTLADYNIQKE
Sbjct  195  LIFAGKQLEDGRTLADYNIQKE  216



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   304 bits (778),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_008809849.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=153

 Score =   301 bits (770),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG PPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGXPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   160 bits (406),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGGM
Sbjct  135  YNIQKESTLHLVLRLRGGM  153



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   303 bits (777),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   303 bits (777),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  124
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  226



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   306 bits (785),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>dbj|BAF00213.1| polyubiquitin 4 UBQ4 [Arabidopsis thaliana]
Length=351

 Score =   308 bits (789),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  196  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  255

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  256  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  315

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  316  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349


 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   287 bits (734),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 154/200 (77%), Gaps = 45/200 (23%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YN---------------------------------------------IQKESTLHLVLRL  355
            YN                                             IQKESTLHLVLRL
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQKESTLHLVLRL  194

Query  354  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  175
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  195  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  254

Query  174  DYNIQKESTLHLVLRLRGGF  115
            DYNIQKESTLHLVLRLRGG 
Sbjct  255  DYNIQKESTLHLVLRLRGGM  274



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   308 bits (790),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  128  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  187

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  188  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  247

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  248  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  282


 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  54   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  113

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  114  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  173

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  174  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  206


 Score =   280 bits (715),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  204  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  263

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  264  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  323

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNI   +   L  + R  F
Sbjct  324  LIFAGKQLEDGRTLADYNITPLTMSRLRSKTRRAF  358



>ref|XP_011390959.1| putative polyubiquitin [Ustilago maydis 521]
 gb|KIS67457.1| putative polyubiquitin [Ustilago maydis 521]
Length=228

 Score =   303 bits (777),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQ  340
            YNIQKESTLHLVLRLRGG +
Sbjct  135  YNIQKESTLHLVLRLRGGAK  154



>gb|AFW66438.1| putative ubiquitin family protein, partial [Zea mays]
 gb|AFW66447.1| ubiquitin2, partial [Zea mays]
Length=349

 Score =   308 bits (789),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  196  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  255

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  256  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  315

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  316  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349


 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   286 bits (733),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 154/200 (77%), Gaps = 45/200 (23%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YN---------------------------------------------IQKESTLHLVLRL  355
            YN                                             IQKESTLHLVLRL
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQKESTLHLVLRL  194

Query  354  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  175
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  195  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  254

Query  174  DYNIQKESTLHLVLRLRGGF  115
            DYNIQKESTLHLVLRLRGG 
Sbjct  255  DYNIQKESTLHLVLRLRGGM  274



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   306 bits (785),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVL  133
            LIFAGKQLEDGRTL+DYNIQKESTLHLV 
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVF  299



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   303 bits (777),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/154 (98%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YN+QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  228


 Score =   300 bits (769),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGM  153



>ref|XP_009412006.1| PREDICTED: polyubiquitin 11-like [Musa acuminata subsp. malaccensis]
Length=231

 Score =   304 bits (778),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  62

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  63   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  122

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  123  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  155


 Score =   275 bits (703),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  77   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  136

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV             QQR
Sbjct  137  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVXXXXXXXXXXXXXQQR  196

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  230



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   309 bits (791),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGY  381


 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   303 bits (777),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   308 bits (788),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  109  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  168

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  169  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  228

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  229  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  263


 Score =   307 bits (787),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  185  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  244

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  245  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  304

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  305  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  187



>ref|XP_001731772.1| hypothetical protein MGL_1040 [Malassezia globosa CBS 7966]
 gb|EDP44558.1| hypothetical protein MGL_1040 [Malassezia globosa CBS 7966]
Length=154

 Score =   301 bits (770),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   157 bits (398),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGG+
Sbjct  135  YNIQKESTLHLVLRLRGGV  153



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   303 bits (777),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228


 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305


 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>prf||1101405A ubiquitin precursor
Length=191

 Score =   302 bits (773),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  37   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  96

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  97   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  156

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  157  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  190


 Score =   226 bits (575),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = -3

Query  459  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  280
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  1    DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  60

Query  279  IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            IDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  61   IDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  115



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   307 bits (787),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  33   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  92

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  93   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  152

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  153  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  187


 Score =   307 bits (787),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  109  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  168

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  169  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  228

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  229  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  263


 Score =   307 bits (787),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  185  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  244

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  245  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  304

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  305  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -3

Query  354  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  175
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  91

Query  174  DYNIQKESTLHLVLRLRGGF  115
            DYNIQKESTLHLVLRLRGG 
Sbjct  92   DYNIQKESTLHLVLRLRGGM  111



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_011038259.1| PREDICTED: polyubiquitin-like [Populus euphratica]
 ref|XP_011038263.1| PREDICTED: polyubiquitin-like [Populus euphratica]
Length=305

 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLE+GRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEEGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLE+GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   306 bits (783),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 153/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   309 bits (791),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (775),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_006372519.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP50316.1| polyubiquitin family protein [Populus trichocarpa]
Length=305

 Score =   306 bits (784),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>emb|CCK72367.1| hypothetical protein KNAG_0J02880 [Kazachstania naganishii CBS 
8797]
 gb|KGR16822.1| polyubiquitin [Candida albicans P37037]
Length=153

 Score =   300 bits (769),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  153


 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGG 
Sbjct  135  YNIQKESTLHLVLRLRGGF  153



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   303 bits (777),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   300 bits (769),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 150/151 (99%), Positives = 150/151 (99%), Gaps = 0/151 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRL  127
            LIFAGKQLEDGRTLADYNIQKESTLHLVLR 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRF  225



>gb|EGA57707.1| Ubi4p [Saccharomyces cerevisiae FostersB]
Length=248

 Score =   304 bits (778),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   297 bits (760),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKXLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153


 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/98 (98%), Positives = 98/98 (100%), Gaps = 0/98 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  286
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  248



>gb|AAO43309.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   304 bits (778),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  19   GGMQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  78

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQR
Sbjct  79   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQR  138

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  139  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  173


 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLAD
Sbjct  95   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLAD  154

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ+R
Sbjct  155  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQKR  214

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG 
Sbjct  215  LIFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGGI  249


 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/97 (98%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -3

Query  405  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  226
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQ  60

Query  225  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  97



>ref|XP_003670049.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 ref|XP_003959063.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 ref|XP_004181533.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
 emb|CCD24806.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 emb|CCF59928.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 emb|CCH62014.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
Length=229

 Score =   303 bits (776),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (764),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_002389222.1| hypothetical protein MPER_11681 [Moniliophthora perniciosa FA553]
 gb|EEB90152.1| hypothetical protein MPER_11681 [Moniliophthora perniciosa FA553]
Length=153

 Score =   300 bits (769),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  152


 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGG  346
            YNIQKESTLHLVLRLRGG
Sbjct  135  YNIQKESTLHLVLRLRGG  152



>ref|XP_002957068.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ41870.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=153

 Score =   300 bits (769),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  153


 Score =   157 bits (398),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGG+
Sbjct  135  YNIQKESTLHLVLRLRGGL  153



>gb|AAM63271.1| unknown [Arabidopsis thaliana]
Length=154

 Score =   300 bits (769),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGG  346
            YNIQKESTLHLVLRLRGG
Sbjct  135  YNIQKESTLHLVLRLRGG  152



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   306 bits (783),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   306 bits (783),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305


 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KDP23292.1| hypothetical protein JCGZ_23125 [Jatropha curcas]
Length=153

 Score =   300 bits (768),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRT ADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTHADYNIQKESTLHLVLRLRGGI  153


 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT AD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTHAD  134

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGG+
Sbjct  135  YNIQKESTLHLVLRLRGGI  153



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   310 bits (793),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  271  GGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  330

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  331  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  390

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  391  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  425


 Score =   308 bits (788),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  119  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  178

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  179  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  238

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  239  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  273


 Score =   307 bits (787),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  195  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  254

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQR
Sbjct  255  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQR  314

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  315  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  349


 Score =   303 bits (775),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  45   MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  104

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  105  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  164

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  165  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  197


 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 6/98 (6%)
 Frame = -3

Query  408  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  229
            L+ +++ K S+L      R  MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPD
Sbjct  30   LSPFDLSKFSSL------RVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPD  83

Query  228  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  84   QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  121



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   305 bits (780),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  51   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  110

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  111  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  170

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  171  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  205


 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  127  GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  186

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  187  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  246

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  247  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  280


 Score =   239 bits (609),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 128/153 (84%), Gaps = 24/153 (16%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDN                        LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDN------------------------LEDGRTLSDYN  36

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  37   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  96

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  129



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   306 bits (785),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  73   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  132

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQR
Sbjct  133  YNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQR  192

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  193  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  227


 Score =   306 bits (785),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  149  GGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  208

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  209  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  268

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  269  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  303


 Score =   276 bits (706),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 144/153 (94%), Gaps = 2/153 (1%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  151


 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/106 (100%), Positives = 106/106 (100%), Gaps = 0/106 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  225  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  284

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  262
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  285  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  330



>ref|XP_002447145.1| hypothetical protein SORBIDRAFT_06g029360 [Sorghum bicolor]
 gb|EES11473.1| hypothetical protein SORBIDRAFT_06g029360 [Sorghum bicolor]
Length=153

 Score =   300 bits (768),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL+DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGK+ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKSITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   157 bits (396),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGK+ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKSITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGG  346
            YNIQKESTLHLVLRLRGG
Sbjct  135  YNIQKESTLHLVLRLRGG  152



>emb|CEP60563.1| LALA0S01e13784g1_1 [Lachancea lanzarotensis]
Length=229

 Score =   303 bits (775),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI  229


 Score =   298 bits (764),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   305 bits (782),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (777),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DY+IQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLSDYSIQKESTLHLVLRLRGGL  305


 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_003030030.1| polyubiquitin [Schizophyllum commune H4-8]
 ref|XP_006678580.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 ref|XP_007396817.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|AAB94630.1| polyubiquitin [Schizophyllum commune]
 gb|EFI95127.1| polyubiquitin [Schizophyllum commune H4-8]
 gb|EGF80702.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 gb|EKM54116.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EPT04446.1| hypothetical protein FOMPIDRAFT_1021745 [Fomitopsis pinicola 
FP-58527 SS1]
 gb|KDQ24213.1| hypothetical protein PLEOSDRAFT_1058300 [Pleurotus ostreatus 
PC15]
 gb|KDQ28506.1| hypothetical protein PLEOSDRAFT_1089714 [Pleurotus ostreatus 
PC15]
 gb|KDQ53556.1| hypothetical protein JAAARDRAFT_72512 [Jaapia argillacea MUCL 
33604]
 gb|KIK09182.1| hypothetical protein K443DRAFT_671672 [Laccaria amethystina LaAM-08-1]
 gb|KIK44225.1| hypothetical protein CY34DRAFT_648259 [Suillus luteus UH-Slu-Lm8-n1]
 gb|KIM51102.1| hypothetical protein SCLCIDRAFT_144015 [Scleroderma citrinum 
Foug A]
 gb|KIN98337.1| hypothetical protein M404DRAFT_856969 [Pisolithus tinctorius 
Marx 270]
 gb|KIN98894.1| hypothetical protein M404DRAFT_966612 [Pisolithus tinctorius 
Marx 270]
Length=305

 Score =   305 bits (782),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305


 Score =   305 bits (782),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   305 bits (782),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   306 bits (783),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  158  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  217

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  218  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  277

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  278  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312


 Score =   306 bits (783),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  82   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  141

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  142  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  201

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  202  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  236


 Score =   301 bits (771),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  8    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  67

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  68   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  127

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  128  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  160



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   305 bits (782),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 153/154 (99%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   306 bits (783),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  165  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  224

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  225  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  284

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  285  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  319


 Score =   306 bits (783),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  89   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  148

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  149  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  208

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  209  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  243


 Score =   301 bits (771),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  576  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  397
             MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  14   SMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  73

Query  396  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  217
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  74   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  133

Query  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  134  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  167



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   310 bits (793),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  275  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  334

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  335  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  394

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  395  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  429


 Score =   307 bits (786),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  123  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  182

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  183  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  242

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  243  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  277


 Score =   307 bits (786),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  199  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  258

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  259  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  318

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  319  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  353


 Score =   302 bits (774),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  49   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  108

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  109  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  201



>ref|XP_001701379.1| bi-ubiquitin, major isoform [Chlamydomonas reinhardtii]
 gb|EDO97495.1| bi-ubiquitin, major isoform [Chlamydomonas reinhardtii]
Length=153

 Score =   300 bits (767),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152


 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/78 (99%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGG  346
            YNIQKESTLHLVLRLRGG
Sbjct  135  YNIQKESTLHLVLRLRGG  152



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   305 bits (782),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 153/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLE+GRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGM  153



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   305 bits (782),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_010324326.1| PREDICTED: polyubiquitin isoform X1 [Solanum lycopersicum]
Length=457

 Score =   310 bits (795),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  303  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  362

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  363  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  422

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  423  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457


 Score =   308 bits (789),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  381


 Score =   303 bits (777),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   305 bits (782),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_001931824.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003305664.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 ref|XP_003854274.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 ref|XP_007275950.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 ref|XP_007376605.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 ref|XP_007674454.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 ref|XP_007741026.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 ref|XP_009261437.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 ref|XP_009650785.1| ubiquitin [Verticillium dahliae VdLs.17]
 ref|XP_011319955.1| ubiquitin [Fusarium graminearum PH-1]
 gb|EDU40929.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ86204.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 gb|EGP89250.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 gb|EGW31827.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 gb|EGY14431.1| ubiquitin [Verticillium dahliae VdLs.17]
 gb|EHK44351.1| hypothetical protein TRIATDRAFT_300588 [Trichoderma atroviride 
IMI 206040]
 gb|EJT46666.1| hypothetical protein A1Q1_04737 [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKJ69797.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 gb|ELA35078.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 gb|EMC98317.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 gb|EME45125.1| hypothetical protein DOTSEDRAFT_70987 [Dothistroma septosporum 
NZE10]
 gb|ENH81500.1| ubiquitin [Colletotrichum orbiculare MAFF 240422]
 gb|ESU14530.1| ubiquitin [Fusarium graminearum PH-1]
 emb|CDK27817.1| unnamed protein product [Kuraishia capsulata CBS 1993]
 gb|EXJ73926.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 gb|EYB28525.1| hypothetical protein FG05_08768 [Fusarium graminearum]
 gb|KEQ58801.1| ubiquitin [Aureobasidium melanogenum CBS 110374]
 gb|KEQ70291.1| ubiquitin [Aureobasidium pullulans var. namibiae CBS 147.97]
 gb|KEQ87814.1| ubiquitin [Aureobasidium pullulans EXF-150]
 gb|KER00813.1| hypothetical protein AUEXF2481DRAFT_25097 [Aureobasidium subglaciale 
EXF-2481]
 emb|CEF77191.1| unnamed protein product [Fusarium graminearum]
 gb|KIV95571.1| polyubiquitin [Exophiala mesophila]
 gb|KIW22916.1| polyubiquitin [Cladophialophora immunda]
 gb|KIW83318.1| polyubiquitin [Fonsecaea pedrosoi CBS 271.37]
 gb|KIW87781.1| polyubiquitin [Cladophialophora bantiana CBS 173.52]
 gb|KIX98997.1| polyubiquitin [Fonsecaea multimorphosa CBS 102226]
Length=229

 Score =   303 bits (775),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (763),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|EPX74297.1| ubiquitin [Schizosaccharomyces octosporus yFS286]
Length=230

 Score =   303 bits (775),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (763),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   308 bits (789),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LI AGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Sbjct  347  LILAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381


 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
             NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  CNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   296 bits (757),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGM  153



>ref|XP_007924320.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EHN05782.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EME83800.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EWH17145.1| Ubi4p [Saccharomyces cerevisiae P283]
Length=229

 Score =   303 bits (775),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228


 Score =   298 bits (763),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_007763327.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86558.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EUC62408.1| polyubiquitin [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KDQ12738.1| hypothetical protein BOTBODRAFT_34195 [Botryobasidium botryosum 
FD-172 SS1]
 gb|KEP53373.1| polyubiquitin [Rhizoctonia solani 123E]
 gb|KIJ12827.1| hypothetical protein PAXINDRAFT_82237 [Paxillus involutus ATCC 
200175]
 gb|KIK47355.1| hypothetical protein CY34DRAFT_799527 [Suillus luteus UH-Slu-Lm8-n1]
Length=305

 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_002419618.1| ubiquitin, putative [Candida dubliniensis CD36]
 sp|P0CG74.1|UBI4P_CANAX RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Candida albicans]
 emb|CAA90901.1| polyubiquitin [Candida albicans]
 emb|CAX43214.1| ubiquitin, putative [Candida dubliniensis CD36]
 gb|KGU10731.1| polyubiquitin [Candida albicans L26]
Length=305

 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 151/155 (97%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305


 Score =   303 bits (775),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (763),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|KIR63773.1| polyubiquitin [Cryptococcus gattii CA1873]
 gb|KIR98208.1| polyubiquitin [Cryptococcus gattii 2001/935-1]
Length=305

 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   308 bits (789),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  76   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  135

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  136  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  230


 Score =   308 bits (789),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  152  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  211

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  212  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  271

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  306


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  228  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  287

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+PPDQQR
Sbjct  288  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPPDQQR  347

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  348  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  381


 Score =   299 bits (765),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  154



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   308 bits (789),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  77   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  136

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  137  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  196

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  231


 Score =   308 bits (789),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  153  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  212

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  213  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  272

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  307


 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  229  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  288

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  289  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  348

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382


 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  62

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  63   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  122

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  123  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  155



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   308 bits (789),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   308 bits (789),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/154 (100%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380


 Score =   303 bits (776),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153


 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/79 (99%), Positives = 79/79 (100%), Gaps = 0/79 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  303  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  362

Query  399  YNIQKESTLHLVLRLRGGM  343
            YNIQKESTLHLVLRLRGG+
Sbjct  363  YNIQKESTLHLVLRLRGGV  381



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   307 bits (786),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381


 Score =   303 bits (776),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   298 bits (762),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGM  153



>ref|XP_001598085.1| polyubiquitin [Sclerotinia sclerotiorum 1980]
 gb|EDN90771.1| polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
Length=305

 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   303 bits (777),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLLDYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (769),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|KFX48439.1| Polyubiquitin [Talaromyces marneffei PM1]
Length=218

 Score =   302 bits (773),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  64   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  123

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  124  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  183

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  184  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  217


 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 141/153 (92%), Gaps = 11/153 (7%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLE           +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLE-----------SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  49

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  50   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  109

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  110  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  142



>gb|KDQ20365.1| hypothetical protein BOTBODRAFT_123907 [Botryobasidium botryosum 
FD-172 SS1]
Length=305

 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229


 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  271  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304


 Score =   300 bits (769),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  286

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  287  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  347  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381


 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229


 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/155 (99%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  210

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  211  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  270

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  271  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  305


 Score =   303 bits (776),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|EFN76024.1| Ubiquitin [Harpegnathos saltator]
Length=229

 Score =   302 bits (774),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 155/155 (100%), Gaps = 0/155 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  75   GGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  134

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQR
Sbjct  135  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQR  194

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGF
Sbjct  195  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229


 Score =   292 bits (748),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 144/153 (94%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = -3

Query  573  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  394
            MQIFV+TL GKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVRTLAGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  393  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  213  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  153



>gb|EKV18932.1| hypothetical protein PDIP_25190 [Penicillium digitatum Pd1]
Length=233

 Score =   302 bits (774),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = -3

Query  579  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  400
            GGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+D
Sbjct  79   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD  138

Query  399  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQR
Sbjct  139  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR  198

Query  219  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  118
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  199  LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  232


 Score =   283 bits (724),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -3

Query  567  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  388
            I +  +TGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQ
Sbjct  7    IPLSLVTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  66

Query  387  KESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  208
            KESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFA
Sbjct  67   KESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFA  126

Query  207  GKQLEDGRTLADYNIQKESTLHLVLRLRGGF  115
            GKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  127  GKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220