BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF045M18

Length=666
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAR83865.1|  elongation factor 1-alpha                               290   2e-96   Capsicum annuum
dbj|BAH20400.1|  AT1G07940                                              288   4e-95   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307730.1|  hypothetical protein CARUB_v100096370mg            287   7e-95   
gb|ACF81592.1|  unknown                                                 287   8e-95   Zea mays [maize]
dbj|BAO57272.1|  elongation factor 1-alpha                              295   1e-94   Ipomoea nil [qian niu]
gb|ABW74483.1|  elongation factor                                       285   3e-94   Paeonia suffruticosa [moutan peony]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-93   Nicotiana tomentosiformis
gb|AAT72900.1|  elongation factor 1A SMV resistance-related protein     284   1e-93   Glycine max [soybeans]
gb|AAQ90154.1|  putative translation elongation factor protein          287   2e-93   Solanum tuberosum [potatoes]
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               292   3e-93   Nicotiana tomentosiformis
gb|KJB73626.1|  hypothetical protein B456_011G2412002                   282   9e-93   Gossypium raimondii
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               291   1e-92   Nicotiana sylvestris
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    291   1e-92   Nicotiana tabacum [American tobacco]
dbj|BAA34348.1|  elongation factor-1 alpha                              290   1e-92   Nicotiana paniculata
gb|AFW76429.1|  putative translation elongation factor Tu family ...    285   1e-92   
ref|NP_001234035.1|  elongation factor 1-alpha                          290   1e-92   Solanum lycopersicum
gb|AAN77897.1|  elongation factor 1 alpha                               290   1e-92   Stevia rebaudiana
dbj|BAF75826.1|  hypothetical protein                                   281   2e-92   Malus domestica [apple tree]
ref|XP_006304901.1|  hypothetical protein CARUB_v100092941mg            286   2e-92   
gb|AHE76183.1|  elongation factor 1-alpha                               290   2e-92   Chrysanthemum indicum
gb|ABB02622.1|  elongation factor 1-alpha-like protein                  288   2e-92   Solanum tuberosum [potatoes]
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               290   3e-92   Nicotiana tomentosiformis
ref|NP_001275420.1|  elongation factor 1-alpha-like protein             288   3e-92   Solanum tuberosum [potatoes]
ref|XP_007015467.1|  GTP binding Elongation factor Tu family prot...    286   4e-92   
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          289   4e-92   Solanum lycopersicum
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          289   4e-92   Nicotiana sylvestris
gb|EEE58429.1|  hypothetical protein OsJ_09630                          288   4e-92   Oryza sativa Japonica Group [Japonica rice]
gb|AGH55661.1|  elongation factor 1-alpha                               285   4e-92   Atropa belladonna [deadly nightshade]
gb|AIX10769.1|  elongation factor 1 alpha                               289   4e-92   Panax notoginseng [san-qi]
emb|CDX70032.1|  BnaA10g23810D                                          286   4e-92   
dbj|BAF75825.1|  hypothetical protein                                   280   4e-92   Malus domestica [apple tree]
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          289   5e-92   Nicotiana sylvestris
ref|XP_009773066.1|  PREDICTED: elongation factor 1-alpha               278   5e-92   Nicotiana sylvestris
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             289   6e-92   Solanum tuberosum [potatoes]
dbj|BAC23049.1|  Elongation factor 1-alpha                              289   6e-92   Solanum tuberosum [potatoes]
gb|ABV26710.1|  elongation factor 1 alpha                               289   6e-92   Gerbera hybrid cultivar
dbj|BAL14665.1|  elongation factor 1-alpha                              289   6e-92   Chrysanthemum seticuspe f. boreale
gb|ABB86283.1|  elongation factor-1 alpha-like                          289   6e-92   Solanum tuberosum [potatoes]
dbj|BAN42602.1|  putative elongation factor 1-alpha                     280   6e-92   Pyrus pyrifolia var. culta [Asian pear]
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          288   7e-92   Oryza brachyantha
ref|NP_001049145.1|  Os03g0177400                                       288   7e-92   
ref|NP_001275481.1|  elongation factor 1-alpha-like                     288   7e-92   Solanum tuberosum [potatoes]
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          288   7e-92   Solanum tuberosum [potatoes]
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          288   8e-92   Tarenaya hassleriana [spider flower]
dbj|BAA23658.1|  EF-1 alpha                                             288   8e-92   Oryza sativa [red rice]
gb|KJB53395.1|  hypothetical protein B456_009G4199001                   283   8e-92   Gossypium raimondii
gb|AAC15413.1|  translation elongation factor-1 alpha                   288   8e-92   Oryza sativa Japonica Group [Japonica rice]
gb|AGZ15393.1|  elongation factor 1-alpha                               283   8e-92   Phaseolus vulgaris [French bean]
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          288   8e-92   Oryza sativa Japonica Group [Japonica rice]
dbj|BAN42601.1|  putative elongation factor 1-alpha                     280   9e-92   Pyrus pyrifolia var. culta [Asian pear]
gb|KHG20498.1|  Elongation factor 1-alpha                               288   1e-91   Gossypium arboreum [tree cotton]
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               288   1e-91   Tarenaya hassleriana [spider flower]
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    288   1e-91   
gb|KJB53396.1|  hypothetical protein B456_009G4199001                   284   1e-91   Gossypium raimondii
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               288   1e-91   Tarenaya hassleriana [spider flower]
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             288   2e-91   Eutrema salsugineum [saltwater cress]
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          287   2e-91   Solanum tuberosum [potatoes]
gb|AID52924.1|  elongation factor 1-alpha                               287   2e-91   Carthamus tinctorius
emb|CAL25349.1|  elongation factor 1 alpha                              278   2e-91   Platanus x hispanica [London plane tree]
gb|AGT16628.1|  elongation factor 1 alpha                               285   3e-91   Saccharum hybrid cultivar R570
gb|AGT16893.1|  elongation factor 1-alpha                               287   3e-91   Saccharum hybrid cultivar R570
emb|CDY22710.1|  BnaC08g43440D                                          286   3e-91   Brassica napus [oilseed rape]
emb|CDY61938.1|  BnaCnng38780D                                          286   3e-91   Brassica napus [oilseed rape]
gb|KJB09231.1|  hypothetical protein B456_001G130700                    287   3e-91   Gossypium raimondii
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          287   3e-91   Tarenaya hassleriana [spider flower]
emb|CAA65453.1|  elongation factor                                      280   4e-91   Narcissus pseudonarcissus
gb|KDP29082.1|  hypothetical protein JCGZ_16471                         280   4e-91   Jatropha curcas
dbj|BAH56641.1|  elongation factor 1a                                   284   4e-91   Nelumbo nucifera [Indian lotus]
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          286   4e-91   Tarenaya hassleriana [spider flower]
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             286   4e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    286   4e-91   Theobroma cacao [chocolate]
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          286   4e-91   Sesamum indicum [beniseed]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        286   4e-91   Brassica rapa
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             286   4e-91   Capsella rubella
ref|NP_200847.1|  elongation factor 1-alpha 4                           286   5e-91   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02151.1|  elongation factor 1-alpha                              286   5e-91   Arabidopsis thaliana [mouse-ear cress]
emb|CAA34456.1|  elongation factor 1-alpha                              286   5e-91   Arabidopsis thaliana [mouse-ear cress]
emb|CAA06245.1|  elongation factor 1-alpha (EF1-a)                      282   5e-91   Cicer arietinum [garbanzo]
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        286   5e-91   Brassica rapa
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    286   5e-91   Arabidopsis thaliana [mouse-ear cress]
gb|AAL57653.1|  At1g07930/T6D22_3                                       286   5e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             286   5e-91   Brassica rapa
gb|AAK82537.1|  At1g07930/T6D22_3                                       286   6e-91   Arabidopsis thaliana [mouse-ear cress]
gb|AGH32502.1|  translation elongation factor-1 alpha                   286   6e-91   Stylosanthes guianensis [stylo]
ref|NP_001152668.1|  LOC100286309                                       286   7e-91   Zea mays [maize]
emb|CAD60652.1|  elongation factor                                      286   7e-91   Solanum tuberosum [potatoes]
gb|ACR38047.1|  unknown                                                 286   7e-91   Zea mays [maize]
ref|XP_002518072.1|  elongation factor 1-alpha, putative                281   7e-91   Ricinus communis
emb|CDX93604.1|  BnaA06g04440D                                          286   7e-91   
ref|XP_008465824.1|  PREDICTED: elongation factor 1-alpha-like          280   7e-91   Cucumis melo [Oriental melon]
gb|KHG26926.1|  Elongation factor 1-alpha                               286   7e-91   Gossypium arboreum [tree cotton]
gb|AAL79775.1|  elongation factor 1 alpha                               286   8e-91   Saccharum hybrid cultivar CP72-2086
gb|ABU63160.1|  elongation factor                                       286   9e-91   Saccharum officinarum [noble cane]
ref|XP_002539209.1|  elongation factor 1-alpha, putative                281   9e-91   Ricinus communis
gb|AFC88830.1|  putative elongation factor 1-alpha                      286   9e-91   Miscanthus sinensis
gb|AGJ50595.1|  EF1alpha                                                286   1e-90   Pericallis cruenta
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               286   1e-90   Fragaria vesca subsp. vesca
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     285   1e-90   Saccharum hybrid cultivar CP65-357
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          285   1e-90   Nelumbo nucifera [Indian lotus]
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    285   1e-90   Setaria italica
gb|AGZ90153.1|  elongation factor 1-alpha                               278   1e-90   Litsea cubeba [may chang]
emb|CDX95108.1|  BnaC05g05630D                                          286   1e-90   
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          285   2e-90   
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          285   2e-90   Tarenaya hassleriana [spider flower]
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               285   2e-90   Elaeis guineensis
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    285   2e-90   Eucalyptus grandis [rose gum]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    285   2e-90   
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               285   2e-90   Elaeis guineensis
ref|WP_033581549.1|  elongation factor 1-alpha                          275   2e-90   
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    285   2e-90   Theobroma cacao [chocolate]
gb|ABA12225.1|  translation elongation factor 1A-9                      285   2e-90   Gossypium hirsutum [American cotton]
gb|ABA12218.1|  translation elongation factor 1A-2                      285   2e-90   Gossypium hirsutum [American cotton]
ref|XP_008783723.1|  PREDICTED: elongation factor 1-alpha isoform X2    280   2e-90   
emb|CAL07988.1|  translation elongation factor 1 alpha                  278   2e-90   Platanus x hispanica [London plane tree]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    285   2e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          285   2e-90   Zea mays [maize]
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    285   2e-90   Daucus carota [carrots]
gb|ABA12220.1|  translation elongation factor 1A-4                      285   3e-90   Gossypium hirsutum [American cotton]
gb|ABA12217.1|  translation elongation factor 1A-1                      285   3e-90   Gossypium hirsutum [American cotton]
gb|KHG23927.1|  Elongation factor 1-alpha                               285   3e-90   Gossypium arboreum [tree cotton]
ref|NP_001105587.1|  elongation factor 1-alpha                          284   3e-90   Zea mays [maize]
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          284   3e-90   Elaeis guineensis
ref|NP_001288407.1|  elongation factor 1-alpha-like                     284   3e-90   Zea mays [maize]
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   284   3e-90   Lilium longiflorum [Easter lily]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         284   3e-90   
ref|NP_001237425.1|  elongation factor-1A                               284   3e-90   
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    284   3e-90   Eucalyptus grandis [rose gum]
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  284   3e-90   Citrus sinensis [apfelsine]
gb|ACG34498.1|  elongation factor 1-alpha                               284   3e-90   Zea mays [maize]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          284   3e-90   Setaria italica
gb|KHN18669.1|  Elongation factor 1-alpha                               284   4e-90   Glycine soja [wild soybean]
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             284   4e-90   Citrus clementina [clementine]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    284   4e-90   Zea mays [maize]
gb|AEN79476.1|  elongation factor 1-alpha                               284   4e-90   Ziziphus jujuba [Chinese jujube]
dbj|BAH19898.1|  AT1G07930                                              284   4e-90   Arabidopsis thaliana [mouse-ear cress]
gb|ACS68200.1|  elongation factor 1 alpha                               284   4e-90   Brassica napus [oilseed rape]
gb|ABA12221.1|  translation elongation factor 1A-5                      284   4e-90   Gossypium hirsutum [American cotton]
gb|KGN47308.1|  hypothetical protein Csa_6G290890                       279   5e-90   
emb|CDY58828.1|  BnaAnng15460D                                          287   5e-90   Brassica napus [oilseed rape]
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             284   5e-90   Phaseolus vulgaris [French bean]
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        284   5e-90   Brassica rapa
dbj|BAC66180.1|  elongation factor 1A                                   284   5e-90   Avicennia marina
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               284   6e-90   Pyrus x bretschneideri [bai li]
gb|ADC68236.1|  elongation factor 1-alpha                               276   6e-90   Dendrobium nobile
gb|AAX54511.1|  elongation factor 1 alpha                               283   6e-90   Actinidia deliciosa [Chinese gooseberry]
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    283   6e-90   Glycine max [soybeans]
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          283   6e-90   Cicer arietinum [garbanzo]
gb|AFY06644.1|  elongation factor 1-alpha                               280   6e-90   Carica papaya [mamon]
emb|CAN71914.1|  hypothetical protein VITISV_026485                     276   6e-90   Vitis vinifera
gb|ABS10822.1|  elongation factor 1-alpha                               275   7e-90   Phaseolus vulgaris [French bean]
gb|ABA12222.1|  translation elongation factor 1A-6                      283   7e-90   Gossypium hirsutum [American cotton]
ref|NP_001105933.1|  elongation factor alpha2                           283   7e-90   
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    283   7e-90   Sesamum indicum [beniseed]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               283   7e-90   Phoenix dactylifera
gb|AGY80449.1|  elongation factor 1-alpha                               283   7e-90   Dendrocalamus latiflorus [sweet bamboo]
ref|NP_001288465.1|  elongation factor 1-alpha-like                     283   7e-90   Zea mays [maize]
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               283   8e-90   Sesamum indicum [beniseed]
ref|NP_001105617.1|  elongation factor alpha3                           283   8e-90   Zea mays [maize]
gb|AFW77593.1|  putative translation elongation factor Tu family ...    283   8e-90   
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         282   9e-90   Jatropha curcas
gb|ACG31866.1|  elongation factor 1-alpha                               283   1e-89   Zea mays [maize]
emb|CAJ38380.1|  translation elongation factor 1 alpha                  276   1e-89   Plantago major [cart-track plant]
gb|ADI24333.1|  elongation factor 1-alpha                               283   1e-89   Miscanthus sinensis
ref|XP_002528020.1|  elongation factor 1-alpha, putative                280   1e-89   
gb|KHG01531.1|  Elongation factor 1-alpha                               283   1e-89   Gossypium arboreum [tree cotton]
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    283   1e-89   Glycine max [soybeans]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          283   1e-89   Eucalyptus grandis [rose gum]
gb|KHG27341.1|  Elongation factor 1-alpha                               283   1e-89   Gossypium arboreum [tree cotton]
gb|AAL32631.1|  putative elongation factor 1-a                          283   2e-89   Arabidopsis thaliana [mouse-ear cress]
gb|KGN61480.1|  hypothetical protein Csa_2G139820                       278   2e-89   
gb|KEH43533.1|  GTP-binding elongation factor Tu family protein         279   2e-89   Medicago truncatula
gb|KHG24249.1|  Elongation factor 1-alpha                               281   2e-89   Gossypium arboreum [tree cotton]
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     282   2e-89   Glycine max [soybeans]
gb|AAF63516.1|AF242732_1  translation elongation factor 1a              282   2e-89   Capsicum annuum
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          282   2e-89   Eucalyptus grandis [rose gum]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          282   2e-89   Pyrus x bretschneideri [bai li]
ref|XP_002518073.1|  elongation factor 1-alpha, putative                282   2e-89   Ricinus communis
gb|KHN42761.1|  Elongation factor 1-alpha                               282   3e-89   Glycine soja [wild soybean]
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    282   3e-89   Zea mays [maize]
gb|ABA12219.1|  translation elongation factor 1A-3                      282   3e-89   Gossypium hirsutum [American cotton]
gb|KHG28979.1|  Elongation factor 1-alpha                               282   3e-89   Gossypium arboreum [tree cotton]
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               282   3e-89   Malus domestica [apple tree]
gb|KHN14872.1|  Elongation factor 1-alpha                               281   3e-89   Glycine soja [wild soybean]
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          281   3e-89   Phoenix dactylifera
gb|KJB48746.1|  hypothetical protein B456_008G084000                    280   3e-89   Gossypium raimondii
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          282   3e-89   
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             281   3e-89   Citrus clementina [clementine]
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          281   3e-89   Eucalyptus grandis [rose gum]
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          281   4e-89   Phoenix dactylifera
gb|KDP29084.1|  hypothetical protein JCGZ_16473                         280   4e-89   Jatropha curcas
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          281   4e-89   Fragaria vesca subsp. vesca
gb|ABA12223.1|  translation elongation factor 1A-7                      281   4e-89   Gossypium hirsutum [American cotton]
gb|KJB76528.1|  hypothetical protein B456_012G093800                    281   4e-89   Gossypium raimondii
gb|AIZ68131.1|  translation elongation factor 1-alpha                   281   4e-89   Ornithogalum longebracteatum [sea-onion]
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   281   5e-89   Lilium longiflorum [Easter lily]
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               281   5e-89   Cucumis melo [Oriental melon]
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               281   5e-89   Eucalyptus grandis [rose gum]
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               281   6e-89   Prunus mume [ume]
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             281   6e-89   Prunus persica
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          281   6e-89   Phoenix dactylifera
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    281   6e-89   
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    281   6e-89   Populus euphratica
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          281   6e-89   Malus domestica [apple tree]
gb|AEQ75495.1|  elongation factor 1-alpha                               281   7e-89   Rosa multiflora [Japanese rose]
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          281   7e-89   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB48747.1|  hypothetical protein B456_008G084000                    280   7e-89   Gossypium raimondii
ref|NP_001290506.1|  elongation factor 1-alpha                          281   7e-89   Elaeis guineensis
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          281   7e-89   Populus euphratica
ref|XP_011031786.1|  PREDICTED: elongation factor 1-alpha-like          277   7e-89   Populus euphratica
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    281   7e-89   Vicia faba [broad bean]
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    281   7e-89   Populus euphratica
gb|AAL69396.1|  elongation factor 1-alpha                               281   7e-89   Elaeis oleifera
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               281   8e-89   Cucumis melo [Oriental melon]
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    281   8e-89   Theobroma cacao [chocolate]
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          281   8e-89   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAM13874.1|  elongation factor 1 alpha                              281   8e-89   Symplocarpus renifolius
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          280   9e-89   Elaeis guineensis
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          280   9e-89   Elaeis guineensis
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         280   1e-88   Jatropha curcas
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          280   1e-88   Amborella trichopoda
gb|AEI29162.1|  EF1a-like protein                                       279   1e-88   Phalaenopsis hybrid cultivar
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         280   1e-88   Jatropha curcas
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          280   1e-88   Elaeis guineensis
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     280   1e-88   Glycine max [soybeans]
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          280   1e-88   
gb|AHB86963.1|  elongation factor 1-alpha                               280   1e-88   Sedum alfredii
ref|NP_001105565.1|  elongation factor alpha5                           280   1e-88   
gb|ABA12224.1|  translation elongation factor 1A-8                      280   1e-88   Gossypium hirsutum [American cotton]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   280   1e-88   Lilium longiflorum [Easter lily]
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    280   1e-88   
ref|XP_002528028.1|  elongation factor 1-alpha, putative                280   1e-88   
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               280   1e-88   Vitis vinifera
ref|XP_003604823.1|  Elongation factor 1-alpha                          280   1e-88   
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             280   1e-88   Phaseolus vulgaris [French bean]
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             280   1e-88   Prunus persica
ref|NP_001183947.1|  uncharacterized protein LOC100502553               278   2e-88   
gb|ABD66072.1|  elongation factor 1-alpha                               273   2e-88   Phoenix dactylifera
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             280   2e-88   Prunus persica
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               280   2e-88   Vitis vinifera
gb|AGC94754.1|  elongation factor 1 alpha                               280   2e-88   Euphorbia lathyris
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          280   2e-88   Cucumis sativus [cucumbers]
ref|NP_001105935.1|  elongation factor alpha8                           280   2e-88   
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         280   2e-88   Medicago truncatula
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         280   2e-88   Medicago truncatula
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             280   2e-88   Citrus clementina [clementine]
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    280   2e-88   
gb|AGV54713.1|  elongation factor 1-alpha                               280   2e-88   Phaseolus vulgaris [French bean]
gb|ACI96243.1|  elongation factor 1-alpha                               280   2e-88   Prunus persica
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          280   2e-88   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN51228.1|  Elongation factor 1-alpha                               278   2e-88   
gb|AAY56337.1|  elongation factor-1 alpha                               280   2e-88   Musa acuminata [banana]
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         280   2e-88   Medicago truncatula
ref|XP_003588821.1|  Elongation factor 1-alpha                          280   2e-88   
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  280   2e-88   Solanum tuberosum [potatoes]
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               280   2e-88   Prunus mume [ume]
gb|AFP44110.1|  elongation factor 1-alpha                               279   3e-88   Lycoris longituba
gb|AFJ04514.1|  elongation factor 1-alpha                               279   3e-88   Vernicia fordii [tung oil tree]
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               279   3e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          279   3e-88   Cicer arietinum [garbanzo]
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               279   3e-88   Fragaria vesca subsp. vesca
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        279   3e-88   Hevea brasiliensis [jebe]
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          279   3e-88   Cucumis sativus [cucumbers]
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        279   3e-88   Bruguiera sexangula
dbj|BAM13877.1|  elongation factor 1 alpha                              279   4e-88   Arum maculatum [cuckoo-pint]
gb|ADW83729.1|  elongation factor 1-alpha                               270   4e-88   Musa acuminata AAA Group [Cavendish banana]
gb|KGN51227.1|  hypothetical protein Csa_5G495940                       275   4e-88   
ref|XP_008782124.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    270   5e-88   
ref|NP_001151074.1|  elongation factor 1-alpha                          279   5e-88   
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        279   5e-88   Salsola komarovii
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          278   5e-88   Sorghum bicolor [broomcorn]
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               278   5e-88   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        278   6e-88   Hevea brasiliensis [jebe]
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          278   6e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          278   7e-88   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGI15328.1|  elongation factor 1                                     278   7e-88   Aegiceras corniculatum
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          278   8e-88   Pyrus x bretschneideri [bai li]
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             278   9e-88   
ref|NP_001280807.1|  elongation factor 1-alpha-like                     278   1e-87   Malus domestica [apple tree]
gb|KJB76560.1|  hypothetical protein B456_012G094600                    277   1e-87   Gossypium raimondii
ref|NP_001104938.1|  elongation factor 1 alpha                          278   1e-87   
gb|AIM48895.1|  elongation factor 1-alpha                               277   1e-87   
gb|ABR16818.1|  unknown                                                 268   1e-87   
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    278   1e-87   
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        278   1e-87   
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        278   1e-87   
gb|EPS66340.1|  elongation factor 1-alpha                               277   1e-87   
ref|XP_002312029.1|  ADR12-2 family protein                             278   1e-87   
gb|AAF99703.1|  elongation factor                                       277   1e-87   
gb|ABD66517.1|  EF-1 alpha                                              277   2e-87   
ref|XP_002311107.1|  ADR12-2 family protein                             277   2e-87   
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         277   2e-87   
gb|AAV92325.1|  translation elongation factor-1 alpha                   270   2e-87   
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             277   2e-87   
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          277   2e-87   
ref|XP_003591959.1|  Elongation factor 1-alpha                          280   2e-87   
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               277   3e-87   
gb|ABF00115.1|  elongation factor 1-alpha                               277   3e-87   
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          277   3e-87   
gb|AGD99674.1|  eukaryotic elongation factor 1A                         276   3e-87   
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          276   3e-87   
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          276   3e-87   
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          276   3e-87   
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             276   3e-87   
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                276   3e-87   
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               276   4e-87   
ref|XP_009917077.1|  PREDICTED: elongation factor 1-alpha 1             273   4e-87   
gb|ADK73624.1|  elongation factor 1 alpha                               271   4e-87   
ref|XP_002311106.1|  ADR12-2 family protein                             276   4e-87   
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             276   4e-87   
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             276   5e-87   
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    276   5e-87   
ref|XP_001763198.1|  predicted protein                                  273   6e-87   
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             276   7e-87   
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          275   8e-87   
gb|EPS66069.1|  elongation factor 1-alpha                               275   9e-87   
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    275   9e-87   
ref|XP_002892424.1|  T6D22.2                                            287   9e-87   
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          275   1e-86   
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    279   1e-86   
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          275   1e-86   
ref|NP_001105934.1|  elongation factor alpha7                           275   2e-86   
gb|AAF79822.1|AC026875_2  T6D22.2                                       286   2e-86   
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          275   2e-86   
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             275   2e-86   
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             275   2e-86   
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    274   2e-86   
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               274   2e-86   
ref|XP_003604587.1|  Elongation factor 1-alpha                          274   4e-86   
ref|NP_001104939.1|  elongation factor alpha6                           273   5e-86   
ref|XP_001766482.1|  predicted protein                                  273   5e-86   
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             273   6e-86   
ref|XP_010458012.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    263   7e-86   
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             273   8e-86   
ref|XP_006373866.1|  hypothetical protein POPTR_0016s08780g             271   1e-85   
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                273   1e-85   
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    272   1e-85   
gb|EMS52529.1|  Elongation factor 1-alpha                               272   1e-85   
ref|XP_001763201.1|  predicted protein                                  272   2e-85   
ref|XP_001753167.1|  predicted protein                                  272   2e-85   
ref|XP_001763194.1|  predicted protein                                  272   2e-85   
ref|XP_001753181.1|  predicted protein                                  272   2e-85   
emb|CAC27139.1|  translation elongation factor-1 alpha                  271   2e-85   
gb|EMS59091.1|  Elongation factor 1-alpha                               273   3e-85   
gb|ABK25072.1|  unknown                                                 271   3e-85   
gb|ACN41180.1|  unknown                                                 271   3e-85   
gb|ACN40081.1|  unknown                                                 271   3e-85   
gb|AAR82894.1|  elongation factor 1-alpha                               271   4e-85   
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    282   5e-85   
dbj|BAD95246.1|  translation elongation factor eEF-1 alpha chain        260   8e-85   
gb|AIZ74328.1|  translation elongation factor 1-alpha                   270   9e-85   
gb|KHG15275.1|  Elongation factor 1-alpha                               270   1e-84   
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 270   1e-84   
gb|AAC06383.1|  elongation factor 1 alpha                               259   1e-84   
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 270   1e-84   
gb|AGI78242.1|  elongation factor 1 alpha                               270   1e-84   
gb|ABK24265.1|  unknown                                                 270   2e-84   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    269   2e-84   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    269   2e-84   
gb|EMS49772.1|  Elongation factor 1-alpha                               269   2e-84   
gb|AER42621.1|  elongation factor 1 alpha                               269   3e-84   
gb|ACN40740.1|  unknown                                                 269   4e-84   
gb|AHA84124.1|  elongation factor 1-alpha                               268   4e-84   
gb|EMT12343.1|  Elongation factor 1-alpha                               268   5e-84   
gb|ABK24843.1|  unknown                                                 268   5e-84   
gb|EMS65134.1|  Elongation factor 1-alpha                               273   1e-83   
gb|AHZ58493.1|  translation elongation factor alpha                     267   1e-83   
ref|XP_001753059.1|  predicted protein                                  266   3e-83   
ref|XP_003618775.1|  Elongation factor 1-alpha                          277   4e-83   
gb|EMT09703.1|  Elongation factor 1-alpha                               273   4e-83   
gb|AGO97079.1|  elongation factor 1-alpha                               257   5e-83   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    278   6e-83   
gb|ABR17675.1|  unknown                                                 265   9e-83   
gb|AEE98364.1|  elongation factor 1-alpha                               265   1e-82   
gb|AGO97080.1|  elongation factor 1-alpha                               255   3e-82   
gb|ABQ81942.1|  elongation factor 1-alpha                               255   6e-82   
gb|ABQ81936.1|  elongation factor 1-alpha                               260   5e-81   
gb|AGO97078.1|  elongation factor 1-alpha                               252   5e-81   
gb|AHZ44777.1|  elongation factor 1 alpha                               249   8e-81   
dbj|BAK08744.1|  elongation factor 1-alpha                              260   1e-80   
dbj|BAK08818.1|  elongation factor 1-alpha                              259   1e-80   
dbj|BAK08819.1|  elongation factor 1-alpha                              258   5e-80   
gb|AFN42763.1|  elongation factor 1-alpha                               251   6e-80   
gb|KJB30602.1|  hypothetical protein B456_005G151200                    249   1e-78   
dbj|BAL41369.1|  elongation factor 1-alpha                              243   2e-78   
gb|AAO61852.1|  translation elongation factor-1 alpha                   252   2e-78   
gb|AAP80665.1|AF479046_1  elongation factor-1 alpha                     243   3e-78   
ref|XP_009387472.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    242   3e-77   
dbj|BAH23674.1|  elongation factor 1-alpha                              241   1e-76   
emb|CAA09041.1|  elongation factor 1-alpha                              238   1e-76   
gb|ABL10112.1|  translation elongation factor 1-alpha                   239   3e-76   
gb|ABE01407.1|  translation elongation factor 1a-1                      237   4e-76   
gb|ABE01408.1|  translation elongation factor 1a-2                      236   1e-75   
gb|ACO50109.1|  elongation factor 1 alpha                               240   4e-75   
gb|AJF94634.1|  elongation factor 1-alpha                               234   6e-75   
gb|KJB73628.1|  hypothetical protein B456_011G2414001                   234   1e-74   
gb|ACT36602.1|  elongation factor 1 alpha                               241   2e-74   
gb|AAV34150.1|  EF-1 alpha                                              236   2e-74   
ref|XP_011069517.1|  PREDICTED: elongation factor 1-alpha               232   3e-74   
gb|ACL97363.1|  elongation factor-1 alpha                               241   7e-74   
ref|XP_005650451.1|  translation elongation factor                      242   8e-74   
gb|ACO50110.1|  elongation factor 1 alpha                               241   1e-73   
emb|CEJ91279.1|  Putative Elongation factor 1-alpha                     239   8e-73   
emb|CEI96289.1|  Putative Elongation factor 1-alpha                     230   8e-73   
gb|AIM46989.1|  translation elongation factor 1-alpha                   239   1e-72   
gb|ACL97366.1|  elongation factor-1 alpha                               238   2e-72   
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     238   3e-72   
gb|KIO08245.1|  hypothetical protein M404DRAFT_997171                   238   3e-72   
gb|ABQ81935.1|  elongation factor 1-alpha                               237   5e-72   
gb|EPR59445.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         231   5e-72   
emb|CDH51884.1|  elongation factor 1-alpha                              231   6e-72   
gb|EPY25861.1|  elongation factor 1-alpha                               234   6e-72   
gb|EPY33803.1|  elongation factor 1-alpha                               234   6e-72   
gb|EKG07919.1|  elongation factor 1-alpha (ef-1-alpha), putative        229   8e-72   
ref|XP_007876992.1|  hypothetical protein PFL1_01298                    237   8e-72   
ref|XP_002392294.1|  hypothetical protein MPER_08150                    233   9e-72   
gb|ACO50115.1|  elongation factor 1 alpha                               236   9e-72   
gb|ESA10680.1|  hypothetical protein GLOINDRAFT_348113                  237   1e-71   
gb|ACN60128.1|  translation elongation factor 1-alpha                   227   1e-71   
gb|KIK43550.1|  hypothetical protein CY34DRAFT_699467                   236   1e-71   
gb|KFG40151.1|  elongation factor 1-alpha                               230   2e-71   
gb|ADB55729.1|  elongation factor 1-alpha                               238   2e-71   
sp|O42820.1|EF1A_SCHCO  RecName: Full=Elongation factor 1-alpha; ...    236   2e-71   
emb|CCW70819.1|  unnamed protein product                                229   2e-71   
ref|XP_003037261.1|  translation elongation factor 1a                   236   2e-71   
gb|KIK82926.1|  hypothetical protein PAXRUDRAFT_832117                  236   2e-71   
emb|CBY16376.1|  unnamed protein product                                229   2e-71   
gb|KDR85040.1|  hypothetical protein GALMADRAFT_233641                  236   3e-71   
gb|EKF27061.1|  elongation factor 1-alpha (ef-1-alpha), putative        227   3e-71   
gb|AJP77649.1|  elongation factor 1-alpha                               229   4e-71   
ref|XP_007861104.1|  translation elongation factor 1a                   235   5e-71   
gb|KFH03380.1|  elongation factor 1-alpha                               225   5e-71   
ref|XP_007314394.1|  hypothetical protein SERLADRAFT_458623             235   5e-71   
gb|KIJ68393.1|  hypothetical protein HYDPIDRAFT_185471                  235   5e-71   
gb|ADK90073.1|  elongation factor 1 alpha                               235   5e-71   
ref|XP_007762783.1|  translation elongation factor 1a                   235   5e-71   
gb|EPR56707.1|  elongation factor 1-alpha                               229   5e-71   
ref|XP_005941015.1|  PREDICTED: elongation factor 1-alpha-like          229   6e-71   
gb|EPR57682.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         230   6e-71   
gb|ADG23104.1|  elongation factor 1-alpha                               225   6e-71   
gb|KIK71054.1|  hypothetical protein GYMLUDRAFT_33174                   235   6e-71   
dbj|GAK62779.1|  elongation factor 1-alpha                              226   6e-71   
gb|AEG78376.1|  elongation factor 1 alpha                               228   6e-71   
gb|KIO18434.1|  hypothetical protein M407DRAFT_16247                    234   6e-71   
emb|CCX11704.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    230   7e-71   
gb|KDQ63704.1|  hypothetical protein JAAARDRAFT_29726                   235   7e-71   
emb|CDP93913.1|  Protein Bm5195, isoform h                              226   8e-71   
gb|KIM66163.1|  hypothetical protein SCLCIDRAFT_111138                  234   8e-71   
ref|XP_011125707.1|  hypothetical protein AOL_s00169g48                 234   8e-71   
ref|XP_003873869.1|  elongation factor 1-alpha                          227   8e-71   
emb|CCI49302.1|  unnamed protein product                                234   9e-71   
gb|EPY27955.1|  elongation factor 1-alpha                               234   1e-70   
gb|KIJ21706.1|  hypothetical protein PAXINDRAFT_65274                   234   1e-70   
emb|CCO27325.1|  elongation factor EF-1 alpha subunit                   231   1e-70   
ref|XP_007359855.1|  translation elongation factor 1a                   234   1e-70   
gb|ACL97367.1|  elongation factor-1 alpha                               233   1e-70   
gb|KIJ45278.1|  hypothetical protein M422DRAFT_30129                    234   1e-70   
ref|XP_006454380.1|  hypothetical protein AGABI2DRAFT_133083            234   2e-70   
ref|XP_001873214.1|  predicted protein                                  234   2e-70   
gb|AHC00621.1|  tranlation elongation factor                            234   2e-70   
gb|KDQ12968.1|  hypothetical protein BOTBODRAFT_34109                   234   2e-70   
gb|KIL70783.1|  hypothetical protein M378DRAFT_116001                   234   2e-70   
gb|KIK28513.1|  hypothetical protein PISMIDRAFT_673531                  234   2e-70   
gb|AAZ81003.1|  eukaryotic translation elongation factor 1 alpha 1      224   2e-70   
gb|AGW80518.1|  elongation factor 1-alpha 1                             224   2e-70   
gb|KIO31120.1|  hypothetical protein M407DRAFT_241866                   233   2e-70   
ref|XP_009547250.1|  hypothetical protein HETIRDRAFT_319829             233   2e-70   
gb|KFH65589.1|  elongation factor EF-1 alpha subunit                    229   2e-70   
ref|XP_008033061.1|  translation elongation factor                      233   2e-70   
emb|CCA22726.1|  PREDICTED: hypothetical protein                        233   2e-70   
gb|AAH12509.1|  EEF1A1 protein                                          224   2e-70   
gb|KIM48158.1|  hypothetical protein M413DRAFT_439881                   233   3e-70   
gb|EPT04282.1|  hypothetical protein FOMPIDRAFT_1021956                 233   3e-70   
gb|EDL77720.1|  rCG25445, isoform CRA_b                                 224   3e-70   
gb|AEK26871.1|  elongation factor 1-alpha                               223   3e-70   
gb|ETI46853.1|  elongation factor 1-alpha 1                             224   3e-70   
gb|AJP13557.1|  translation elongation factor-1 alpha                   223   3e-70   
gb|KHN88882.1|  Elongation factor 1-alpha                               233   3e-70   
gb|KDQ30740.1|  hypothetical protein PLEOSDRAFT_1070256                 233   3e-70   
gb|KJA29192.1|  hypothetical protein HYPSUDRAFT_61224                   233   3e-70   
ref|XP_007298247.1|  translation elongation factor                      233   3e-70   
ref|XP_001828758.1|  translation elongation factor 1 alpha              233   4e-70   
gb|ACF70735.1|  eukaryotic translation elongation factor 1              224   4e-70   
emb|CAI94748.1|  elongation factor                                      233   4e-70   
gb|KHJ95470.1|  putative translation elongation factor EF-1, subu...    230   5e-70   
ref|XP_009541702.1|  hypothetical protein HETIRDRAFT_413587             233   5e-70   
emb|CDH51795.1|  elongation factor 1-alpha                              232   5e-70   
ref|XP_822464.1|  elongation factor 1-alpha                             229   5e-70   
gb|KIK06947.1|  hypothetical protein K443DRAFT_673838                   232   5e-70   
ref|XP_007378612.1|  translation elongation factor 1a                   232   5e-70   
ref|XP_010730917.1|  PREDICTED: elongation factor 1-alpha 1             232   6e-70   
gb|EQB55271.1|  hypothetical protein CGLO_04815                         226   7e-70   
gb|ABB46371.1|  elongation factor-1 alpha                               224   7e-70   
gb|ELU43120.1|  elongation factor 1-alpha                               235   7e-70   
sp|P28295.1|EF1A_ABSGL  RecName: Full=Elongation factor 1-alpha; ...    232   8e-70   
gb|ADO51768.1|  elongation factor 1-alpha                               232   8e-70   
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha       231   8e-70   
dbj|BAH28836.1|  elongation factor 1-alpha                              232   9e-70   
ref|XP_001457388.1|  hypothetical protein                               223   9e-70   
ref|XP_007852813.1|  elongation factor 1-alpha                          232   9e-70   
gb|ESL10157.1|  hypothetical protein TRSC58_02114                       225   1e-69   



>gb|AAR83865.1| elongation factor 1-alpha [Capsicum annuum]
Length=167

 Score =   290 bits (743),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  13   DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  72

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  73   SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  132

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGV+KNVDKKDPTG
Sbjct  133  VRDMRQTVAVGVVKNVDKKDPTG  155



>dbj|BAH20400.1| AT1G07940 [Arabidopsis thaliana]
Length=186

 Score =   288 bits (736),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  31   DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  90

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  91   SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  150

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  151  VRDMRQTVAVGVIKSVDKKDPTG  173



>ref|XP_006307730.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
 gb|EOA40628.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
Length=188

 Score =   287 bits (735),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  33   DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  92

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  93   SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  152

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  153  VRDMRQTVAVGVIKSVDKKDPTG  175



>gb|ACF81592.1| unknown [Zea mays]
Length=184

 Score =   287 bits (734),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  31   DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  90

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFA
Sbjct  91   SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFA  150

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  151  VRDMRQTVAVGVIKSVEKKDPTG  173



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/143 (100%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVDKKDPTG  436



>gb|ABW74483.1| elongation factor [Paeonia suffruticosa]
Length=186

 Score =   285 bits (730),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  31   DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  90

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  91   SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  150

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMR+TVAVGVIK+VDKKDPTG
Sbjct  151  VRDMRRTVAVGVIKSVDKKDPTG  173



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVDKKDPTG  436



>gb|AAT72900.1| elongation factor 1A SMV resistance-related protein [Glycine 
max]
Length=193

 Score =   284 bits (727),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  40   DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHT  99

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  100  SHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  159

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  160  VRDMRQTVAVGVIKNVEKKDPTG  182



>gb|AAQ90154.1| putative translation elongation factor protein [Solanum tuberosum]
Length=287

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  133  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  192

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  193  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  252

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGV+KNVDKKDPTG
Sbjct  253  VRDMRQTVAVGVVKNVDKKDPTG  275



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   292 bits (747),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVDKKDPTG  436



>gb|KJB73626.1| hypothetical protein B456_011G2412002, partial [Gossypium raimondii]
Length=187

 Score =   282 bits (721),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  33   DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  92

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGRFA
Sbjct  93   SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFA  152

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  153  VRDMRQTVAVGVIKSVEKKDPTG  175



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVDKKDPTG  436



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVDKKDPTG  436



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA+SFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVDKKDPTG  436



>gb|AFW76429.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=293

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  140  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  199

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  200  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  259

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  260  VRDMRQTVAVGVIKSVEKKDPTG  282



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGV+KNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVVKNVDKKDPTG  436



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>dbj|BAF75826.1| hypothetical protein [Malus domestica]
Length=184

 Score =   281 bits (719),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVA KDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  31   DNVGFNVKNVAAKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  90

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  91   SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  150

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KK+PTG
Sbjct  151  VRDMRQTVAVGVIKSVEKKEPTG  173



>ref|XP_006304901.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
 gb|EOA37799.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
Length=325

 Score =   286 bits (731),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  170  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  229

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  230  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  289

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  290  VRDMRQTVAVGVIKSVDKKDPTG  312



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>gb|ABB02622.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  246  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  305

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  306  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  365

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGV+KNVDKKDPTG
Sbjct  366  VRDMRQTVAVGVVKNVDKKDPTG  388



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   290 bits (741),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA+SFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVDKKDPTG  436



>ref|NP_001275420.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABB16975.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  246  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  305

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  306  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  365

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGV+KNVDKKDPTG
Sbjct  366  VRDMRQTVAVGVVKNVDKKDPTG  388



>ref|XP_007015467.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33086.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
Length=348

 Score =   286 bits (732),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  193  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  252

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  253  SHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  312

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  313  VRDMRQTVAVGVIKNVEKKDPTG  335



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNVDKKDP+G
Sbjct  414  VRDMRQTVAVGVIKNVDKKDPSG  436



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVDKKDPTG  436



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score =   288 bits (738),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  274  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  333

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  334  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  393

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  VRDMRQTVAVGVIKNVEKKDPTG  416



>gb|AGH55661.1| elongation factor 1-alpha, partial [Atropa belladonna]
Length=333

 Score =   285 bits (730),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  181  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  240

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFA +LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  241  SHIAVKFAXILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  300

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  301  VRDMRQTVAVGVIKSVDKKDPTG  323



>gb|AIX10769.1| elongation factor 1 alpha [Panax notoginseng]
Length=449

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKAVDKKDPTG  436



>emb|CDX70032.1| BnaA10g23810D [Brassica napus]
Length=344

 Score =   286 bits (731),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  189  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  248

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  249  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  308

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  309  VRDMRQTVAVGVIKSVDKKDPTG  331



>dbj|BAF75825.1| hypothetical protein [Malus domestica]
Length=184

 Score =   280 bits (716),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK  A+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  31   DNVGFNVKNVAVKDLKRGFVASNSKDDPAKETANFTSQVIIMNHPGQIGNGYAPVLDCHT  90

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA
Sbjct  91   SHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  150

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  151  VRDMRQTVAVGVIKSVEKKDPSG  173



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   289 bits (739),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009773066.1| PREDICTED: elongation factor 1-alpha, partial [Nicotiana sylvestris]
Length=149

 Score =   278 bits (712),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/138 (96%), Positives = 138/138 (100%), Gaps = 0/138 (0%)
 Frame = -1

Query  651  NVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAV  472
            NVKNVAVKDLKRG+VASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAV
Sbjct  1    NVKNVAVKDLKRGFVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAV  60

Query  471  KFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMR  292
            KFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMR
Sbjct  61   KFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMR  120

Query  291  QTVAVGVIKNVDKKDPTG  238
            QTVAVGVIKNVDKKDPTG
Sbjct  121  QTVAVGVIKNVDKKDPTG  138



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  295  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  354

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  355  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  414

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGV+KNVDKKDPTG
Sbjct  415  VRDMRQTVAVGVVKNVDKKDPTG  437



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGV+KNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVVKNVDKKDPTG  436



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGV+KNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVVKNVDKKDPTG  436



>dbj|BAN42602.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   280 bits (717),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  48   DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  107

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPT+PMVVETFSEYPPLGRFA
Sbjct  108  SHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTRPMVVETFSEYPPLGRFA  167

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  168  VRDMRQTVAVGVIKSVEKKDPSG  190



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001275481.1| elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB16996.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGV+KNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVVKNVDKKDPTG  436



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGV+KNVDKKDPTG
Sbjct  414  VRDMRQTVAVGVVKNVDKKDPTG  436



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   288 bits (738),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   288 bits (738),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KJB53395.1| hypothetical protein B456_009G4199001 [Gossypium raimondii]
Length=300

 Score =   283 bits (725),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  147  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  206

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  207  SHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFA  266

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  267  VRDMRQTVAVGVIKSVEKKDPTG  289



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   288 bits (738),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AGZ15393.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=305

 Score =   283 bits (725),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  140  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  199

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  200  SHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  259

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  260  VRDMRQTVAVGVIKSVEKKDPTG  282



>gb|ABF94276.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94277.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=449

 Score =   288 bits (738),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  296  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  355

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  356  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  415

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  416  VRDMRQTVAVGVIKNVEKKDPTG  438



>dbj|BAN42601.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   280 bits (715),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIG GYAPVLDCHT
Sbjct  48   DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDCHT  107

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  108  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  167

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  168  VRDMRQTVAVGVIKSVEKKDPTG  190



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   288 bits (737),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   288 bits (737),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   288 bits (737),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KJB53396.1| hypothetical protein B456_009G4199001, partial [Gossypium raimondii]
Length=322

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  169  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  228

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  229  SHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFA  288

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  289  VRDMRQTVAVGVIKSVEKKDPTG  311



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPSG  436



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFQELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CAL25349.1| elongation factor 1 alpha [Platanus x acerifolia]
Length=199

 Score =   278 bits (712),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  46   DNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHT  105

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  106  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  165

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  166  VRDMRQTVAVGVIKSVEKKDPSG  188



>gb|AGT16628.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=399

 Score =   285 bits (730),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  246  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  305

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  306  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  365

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  366  VRDMRQTVAVGVIKSVEKKDPTG  388



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   287 bits (734),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDY22710.1| BnaC08g43440D [Brassica napus]
 emb|CDY22711.1| BnaC08g43450D [Brassica napus]
Length=427

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  272  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  331

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  332  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  391

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  392  VRDMRQTVAVGVIKSVDKKDPTG  414



>emb|CDY61938.1| BnaCnng38780D [Brassica napus]
 emb|CDY34479.1| BnaC04g13200D [Brassica napus]
 emb|CDY10804.1| BnaA05g11320D [Brassica napus]
 emb|CDY09211.1| BnaA02g06370D [Brassica napus]
Length=428

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  273  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  332

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  333  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  392

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  393  VRDMRQTVAVGVIKSVDKKDPTG  415



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   287 bits (734),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   287 bits (734),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>emb|CAA65453.1| elongation factor [Narcissus pseudonarcissus]
Length=242

 Score =   280 bits (715),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  89   DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHT  148

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAV+FAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPP+GRFA
Sbjct  149  SHIAVRFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPMGRFA  208

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  209  VRDMRQTVAVGVIKSVEKKDPTG  231



>gb|KDP29082.1| hypothetical protein JCGZ_16471 [Jatropha curcas]
Length=247

 Score =   280 bits (716),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  94   DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  153

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  154  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  213

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  214  VRDMRQTVAVGVIKSVEKKDPSG  236



>dbj|BAH56641.1| elongation factor 1a, partial [Nelumbo nucifera]
Length=355

 Score =   284 bits (726),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  213  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  272

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  273  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  332

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK VDKKDPTG
Sbjct  333  VRDMRQTVAVGVIKAVDKKDPTG  355



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   286 bits (733),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   286 bits (733),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   286 bits (733),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   286 bits (733),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNVDKK+P+G
Sbjct  414  VRDMRQTVAVGVIKNVDKKEPSG  436



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   286 bits (733),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   286 bits (733),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>dbj|BAF02151.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CAA06245.1| elongation factor 1-alpha (EF1-a) [Cicer arietinum]
Length=326

 Score =   282 bits (722),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  173  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  232

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  233  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFA  292

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  293  VRDMRQTVAVGVIKSVEKKDPTG  315



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAK82537.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   286 bits (732),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   286 bits (732),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPSG  436



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   286 bits (732),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CAD60652.1| elongation factor [Solanum tuberosum]
Length=447

 Score =   286 bits (732),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPSG  436



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   286 bits (732),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002518072.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44205.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   281 bits (718),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  140  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  199

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  200  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  259

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  260  VRDMRQTVAVGVIKSVEKKDPSG  282



>emb|CDX93604.1| BnaA06g04440D [Brassica napus]
Length=460

 Score =   286 bits (733),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  305  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  364

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  365  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  424

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  425  VRDMRQTVAVGVIKSVDKKDPTG  447



>ref|XP_008465824.1| PREDICTED: elongation factor 1-alpha-like [Cucumis melo]
Length=273

 Score =   280 bits (716),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  118  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  177

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  178  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  237

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK V+KKD +G
Sbjct  238  VRDMRQTVAVGVIKAVEKKDASG  260



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   286 bits (731),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL79775.1| elongation factor 1 alpha [Saccharum hybrid cultivar CP72-2086]
Length=441

 Score =   286 bits (731),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  288  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  347

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  348  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  407

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  408  VRDMRQTVAVGVIKSVEKKDPTG  430



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   286 bits (731),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002539209.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23174.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   281 bits (718),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  140  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  199

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  200  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  259

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  260  VRDMRQTVAVGVIKSVEKKDPSG  282



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   286 bits (731),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGJ50595.1| EF1alpha [Pericallis cruenta]
Length=449

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKD+KRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDIKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMMPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSK+DPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKEDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGZ90153.1| elongation factor 1-alpha, partial [Litsea cubeba]
Length=239

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  86   DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  145

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFS YPPLGRFA
Sbjct  146  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSAYPPLGRFA  205

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  206  VRDMRQTVAVGVIKSVEKKDPSG  228



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  315  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  374

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  375  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  434

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  435  VRDMRQTVAVGVIKSVDKKDPTG  457



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKD +G
Sbjct  414  VRDMRQTVAVGVIKSVDKKDASG  436



>ref|WP_033581549.1| elongation factor 1-alpha, partial [Dickeya zeae]
Length=147

 Score =   275 bits (702),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  8    DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  67

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  68   SHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  127

Query  306  VRDMRQTVAVGVIKNVDKKD  247
            VRDMRQTVAVGVIK+V+KKD
Sbjct  128  VRDMRQTVAVGVIKSVEKKD  147



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPM+VETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMLVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008783723.1| PREDICTED: elongation factor 1-alpha isoform X2 [Phoenix dactylifera]
Length=293

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  140  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  199

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFA
Sbjct  200  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFA  259

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  260  VRDMRQTVAVGVIKSVEKKDPSG  282



>emb|CAL07988.1| translation elongation factor 1 alpha [Platanus x acerifolia]
Length=236

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  83   DNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHT  142

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  143  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  202

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  203  VRDMRQTVAVGVIKSVEKKDPSG  225



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKN AVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNFAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKD+KRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDIKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>sp|P29521.1|EF1A1_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 emb|CAA42843.1| elongation factor 1A [Daucus carota]
Length=449

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNV+VKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVSVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VR MRQTVAVGVIK V+KKDPTG
Sbjct  414  VRVMRQTVAVGVIKAVEKKDPTG  436



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPSG  436



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNV+VKDLKRGYVASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVSVKDLKRGYVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPSG  436



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNV+VKDLKRGYVASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVSVKDLKRGYVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELE+EPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEREPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMV M PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVMMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASN KDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNPKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKDPTG  436



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KGN47308.1| hypothetical protein Csa_6G290890 [Cucumis sativus]
Length=295

 Score =   279 bits (713),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  140  DNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHT  199

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFA
Sbjct  200  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFA  259

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  260  VRDMRQTVAVGVIKSVEKKDPSG  282



>emb|CDY58828.1| BnaAnng15460D [Brassica napus]
Length=568

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  272  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  331

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  332  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  391

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKKDPTG
Sbjct  392  VRDMRQTVAVGVIKSVDKKDPTG  414



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   284 bits (726),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   284 bits (726),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+VDKK PTG
Sbjct  414  VRDMRQTVAVGVIKSVDKKHPTG  436



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score =   284 bits (726),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNV+VKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVSVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KK+P+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKEPSG  436



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   284 bits (726),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KK+PTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKEPTG  436



>gb|ADC68236.1| elongation factor 1-alpha [Dendrobium nobile]
Length=238

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  86   DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  145

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM+PT+PMVVETFS+YPPLGRFA
Sbjct  146  SHIAVKFAEIMTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTRPMVVETFSQYPPLGRFA  205

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  206  VRDMRQTVAVGVIKSVEKKDPTG  228



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   283 bits (725),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   283 bits (725),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   283 bits (725),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AFY06644.1| elongation factor 1-alpha, partial [Carica papaya]
Length=334

 Score =   280 bits (716),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  181  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  240

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFA
Sbjct  241  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFA  300

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDP+G
Sbjct  301  VRDMRQTVAVGVIKNVEKKDPSG  323



>emb|CAN71914.1| hypothetical protein VITISV_026485 [Vitis vinifera]
Length=226

 Score =   276 bits (706),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  73   DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHT  132

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+ TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  133  SHIAVKFAEITTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  192

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  193  VRDMRQTVAVGVIKSVEKKDPSG  215



>gb|ABS10822.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=201

 Score =   275 bits (703),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  58   DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  117

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  118  SHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFA  177

Query  306  VRDMRQTVAVGVIKNVDKKDP  244
            VRDMRQTVAVGVIK+V+KKDP
Sbjct  178  VRDMRQTVAVGVIKSVEKKDP  198



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   283 bits (725),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   283 bits (725),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   283 bits (725),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGLVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   283 bits (725),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   283 bits (725),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSAYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   283 bits (725),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   283 bits (725),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGLVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPSG  436



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   283 bits (725),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   283 bits (725),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDP29085.1| hypothetical protein JCGZ_16474 [Jatropha curcas]
Length=418

 Score =   282 bits (722),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  191  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  250

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  251  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  310

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  311  VRDMRQTVAVGVIKSVEKKDPSG  333



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKD+KRGYVASNS DDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDIKRGYVASNSXDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CAJ38380.1| translation elongation factor 1 alpha [Plantago major]
Length=249

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIG GYAPVLDCHT
Sbjct  94   DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDCHT  153

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  154  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  213

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KK+P+G
Sbjct  214  VRDMRQTVAVGVIKSVEKKEPSG  236



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002528020.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34338.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=348

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  193  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  252

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  253  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  312

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  313  VRDMRQTVAVGVIKSVEKKDPSG  335



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGLIKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVII+NHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIINHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AASF SQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAREAASFASQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL32631.1| putative elongation factor 1-a [Arabidopsis thaliana]
 gb|AAM47970.1| putative elongation factor 1-a [Arabidopsis thaliana]
Length=449

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTV V VIK+VDKKDPTG
Sbjct  414  VRDMRQTVTVSVIKSVDKKDPTG  436



>gb|KGN61480.1| hypothetical protein Csa_2G139820 [Cucumis sativus]
Length=330

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  177  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  236

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRS KELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFA
Sbjct  237  SHIAVKFAEILTKIDRRSAKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSTYPPLGRFA  296

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  297  VRDMRQTVAVGVIKSVEKKDPTG  319



>gb|KEH43533.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=347

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  193  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  252

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGRFA
Sbjct  253  SHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFA  312

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK V+KKDP+G
Sbjct  313  VRDMRQTVAVGVIKAVEKKDPSG  335



>gb|KHG24249.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=401

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  246  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  305

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  306  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  365

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  366  VRDMRQTVAVGVIKSVEKKDPSG  388



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAF63516.1|AF242732_1 translation elongation factor 1a [Capsicum annuum]
Length=447

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  293  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHT  352

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDR SGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+E PPLGRFA
Sbjct  353  SHIAVKFGEILTKIDRWSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAENPPLGRFA  412

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGV+KNVDKKDPTG
Sbjct  413  VRDMRQTVAVGVVKNVDKKDPTG  435



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+P+KPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPSKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KK+PTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKEPTG  436



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVAS SKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASGSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVK +ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKVSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KK+PTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKEPTG  436



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB48746.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=400

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDD AK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  246  DNVGFNVKNVAVKDLKRGFVASNSKDDLAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  305

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  306  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFA  365

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  366  VRDMRQTVAVGVIKSVEKKDPTG  388



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFS YPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSAYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDP29084.1| hypothetical protein JCGZ_16473 [Jatropha curcas]
Length=399

 Score =   280 bits (716),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  246  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  305

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  306  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  365

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  366  VRDMRQTVAVGVIKSVEKKDPSG  388



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGD+GMVKMLPTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDSGMVKMLPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPSG  436



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQ IIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQGIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   281 bits (719),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFNEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KK+PTG
Sbjct  414  VRDMRQTVAVGVIKNVEKKEPTG  436



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   281 bits (719),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSSYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   281 bits (719),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAATFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   281 bits (719),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   281 bits (719),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   281 bits (719),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   281 bits (719),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   281 bits (719),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   281 bits (719),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   281 bits (718),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   281 bits (718),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF++YPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB48747.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=427

 Score =   280 bits (717),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDD AK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  273  DNVGFNVKNVAVKDLKRGFVASNSKDDLAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  332

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  333  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFA  392

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  393  VRDMRQTVAVGVIKSVEKKDPTG  415



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   281 bits (718),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   281 bits (718),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011031786.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=340

 Score =   277 bits (709),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  185  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  244

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  245  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFA  304

Query  306  VRDMRQTVAVGVIKNVDKKDPT  241
            VRDMRQTVAVGVIK+V+KKD +
Sbjct  305  VRDMRQTVAVGVIKSVEKKDAS  326



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   281 bits (718),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   281 bits (718),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAL69396.1| elongation factor 1-alpha [Elaeis oleifera]
Length=447

 Score =   281 bits (718),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+F +QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFIAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   281 bits (718),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   281 bits (718),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
             HIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFA
Sbjct  354  CHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSAYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   281 bits (718),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSK+DP K AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKEDPTKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAM13874.1| elongation factor 1 alpha [Symplocarpus renifolius]
Length=447

 Score =   281 bits (718),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
             HIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  CHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   280 bits (717),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010939624.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010939625.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   280 bits (717),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+ELL+KIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEY PLGRFA
Sbjct  354  SHIAVKFSELLSKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYSPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AEI29162.1| EF1a-like protein [Phalaenopsis hybrid cultivar]
Length=398

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  245  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  304

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFA
Sbjct  305  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFA  364

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  365  VRDMRQTVAVGVIKSVEKKDPTG  387



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK A SFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAGSFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008385284.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_009338279.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIG GYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AHB86963.1| elongation factor 1-alpha [Sedum alfredii]
Length=447

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDL RG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLNRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            V DMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VLDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_003604823.1| Elongation factor 1-alpha [Medicago truncatula]
Length=448

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKGVEKKDPSG  436



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001183947.1| uncharacterized protein LOC100502553 [Zea mays]
 gb|ACF84684.1| unknown [Zea mays]
Length=399

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT+QVIIMNHPGQIGNGYAPVLDCHT
Sbjct  246  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTAQVIIMNHPGQIGNGYAPVLDCHT  305

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+ELLTKIDRRSGKELE  PKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  306  SHIAVKFSELLTKIDRRSGKELESAPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  365

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  366  VRDMRQTVAVGVIKSVEKKDPTG  388



>gb|ABD66072.1| elongation factor 1-alpha [Phoenix dactylifera]
Length=245

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  105  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  164

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LT+IDRRSGKELEKEPKFLK+GDAG VKM+PTKPMVVETFS+YPPLGRFA
Sbjct  165  SHIAVKFAEILTEIDRRSGKELEKEPKFLKSGDAGFVKMIPTKPMVVETFSQYPPLGRFA  224

Query  306  VRDMRQTVAVGVIKNVDKKDP  244
            VRDMRQTVAVGVIK+V+KKDP
Sbjct  225  VRDMRQTVAVGVIKSVEKKDP  245



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIG GYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGQGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEMLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+F SQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFISQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAEIMTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIKNV+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AGC94754.1| elongation factor 1 alpha [Euphorbia lathyris]
Length=447

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF+EYPPLGRFA
Sbjct  354  SHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFAEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_004149547.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001105935.1| elongation factor alpha8 [Zea mays]
 gb|AAF42982.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLK+GDAGMVKM+PTKPMVVETFS +PPLGRFA
Sbjct  354  SHIAVKFAELITKIDRRSGKELEKEPKFLKDGDAGMVKMIPTKPMVVETFSAFPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KEH43536.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKAVEKKDPSG  436



>gb|AES62210.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH43534.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKAVEKKDPSG  436



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004163381.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-alpha-like 
[Cucumis sativus]
Length=449

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFA
Sbjct  354  SHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AGV54713.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF EYPP GRFA
Sbjct  354  SHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFFEYPPFGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA
Sbjct  354  SHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT
Sbjct  294  DNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHT  353

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF+EY PLGRFA
Sbjct  354  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFAEYSPLGRFA  413

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDPTG
Sbjct  414  VRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KGN51228.1| Elongation factor 1-alpha [Cucumis sativus]
Length=402

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHT  487
            DNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIM HPGQIGNGYAPVLDCHT
Sbjct  247  DNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMKHPGQIGNGYAPVLDCHT  306

Query  486  SHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFA  307
            SHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFA
Sbjct  307  SHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFA  366

Query  306  VRDMRQTVAVGVIKNVDKKDPTG  238
            VRDMRQTVAVGVIK+V+KKDP+G
Sbjct  367  VRDMRQTVAVGVIKSVEKKDPSG  389



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960