BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF045J07

Length=577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009607019.1|  PREDICTED: probable serine/threonine-protein...    105   2e-22   Nicotiana tomentosiformis
ref|XP_009772211.1|  PREDICTED: probable serine/threonine-protein...    103   6e-22   Nicotiana sylvestris
ref|XP_006359171.1|  PREDICTED: probable serine/threonine-protein...    102   1e-21   Solanum tuberosum [potatoes]
ref|XP_004229357.1|  PREDICTED: probable serine/threonine-protein...    102   1e-21   Solanum lycopersicum
emb|CDP07693.1|  unnamed protein product                                100   2e-21   Coffea canephora [robusta coffee]
ref|XP_010027725.1|  PREDICTED: AP2-associated protein kinase 1 i...  93.6    2e-18   Eucalyptus grandis [rose gum]
ref|XP_010027724.1|  PREDICTED: AP2-associated protein kinase 1 i...  93.6    2e-18   
ref|XP_011087152.1|  PREDICTED: probable serine/threonine-protein...  89.7    4e-17   Sesamum indicum [beniseed]
ref|XP_011087141.1|  PREDICTED: AP2-associated protein kinase 1 i...  89.4    4e-17   Sesamum indicum [beniseed]
ref|XP_011087144.1|  PREDICTED: AP2-associated protein kinase 1 i...  89.4    4e-17   Sesamum indicum [beniseed]
ref|XP_011087160.1|  PREDICTED: AP2-associated protein kinase 1 i...  89.0    5e-17   Sesamum indicum [beniseed]
ref|XP_010265881.1|  PREDICTED: probable serine/threonine-protein...  86.3    6e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010265879.1|  PREDICTED: probable serine/threonine-protein...  86.3    6e-16   Nelumbo nucifera [Indian lotus]
ref|XP_008231320.1|  PREDICTED: AP2-associated protein kinase 1 i...  84.3    3e-15   Prunus mume [ume]
ref|XP_008231319.1|  PREDICTED: AP2-associated protein kinase 1 i...  84.3    3e-15   Prunus mume [ume]
ref|XP_008231321.1|  PREDICTED: AP2-associated protein kinase 1 i...  84.3    3e-15   Prunus mume [ume]
ref|XP_010095876.1|  putative serine/threonine-protein kinase         83.6    4e-15   
ref|XP_002512151.1|  serine/threonine protein kinase, putative        82.4    1e-14   Ricinus communis
ref|XP_007220628.1|  hypothetical protein PRUPE_ppa002321mg           82.0    1e-14   
gb|ABK92707.1|  unknown                                               77.4    4e-14   Populus trichocarpa [western balsam poplar]
emb|CBI32192.3|  unnamed protein product                              77.4    2e-13   Vitis vinifera
ref|XP_010659600.1|  PREDICTED: probable serine/threonine-protein...  79.0    2e-13   Vitis vinifera
ref|XP_010659599.1|  PREDICTED: probable serine/threonine-protein...  79.0    2e-13   Vitis vinifera
ref|XP_010659601.1|  PREDICTED: probable serine/threonine-protein...  79.0    2e-13   Vitis vinifera
ref|XP_006369447.1|  hypothetical protein POPTR_0001s23520g           78.6    2e-13   
ref|XP_006482823.1|  PREDICTED: probable serine/threonine-protein...  78.2    3e-13   Citrus sinensis [apfelsine]
ref|XP_006482821.1|  PREDICTED: probable serine/threonine-protein...  78.2    3e-13   Citrus sinensis [apfelsine]
ref|XP_006439041.1|  hypothetical protein CICLE_v10030862mg           78.2    3e-13   Citrus clementina [clementine]
ref|XP_006439043.1|  hypothetical protein CICLE_v10030862mg           78.2    3e-13   Citrus clementina [clementine]
gb|KDO46085.1|  hypothetical protein CISIN_1g005558mg                 78.2    3e-13   Citrus sinensis [apfelsine]
ref|XP_006482824.1|  PREDICTED: probable serine/threonine-protein...  78.2    3e-13   Citrus sinensis [apfelsine]
ref|XP_006439040.1|  hypothetical protein CICLE_v10030862mg           78.2    3e-13   
gb|KDO46086.1|  hypothetical protein CISIN_1g005558mg                 78.2    3e-13   Citrus sinensis [apfelsine]
gb|KDO46087.1|  hypothetical protein CISIN_1g005558mg                 77.0    3e-13   Citrus sinensis [apfelsine]
gb|KDP20398.1|  hypothetical protein JCGZ_05281                       77.8    3e-13   Jatropha curcas
gb|EYU27100.1|  hypothetical protein MIMGU_mgv1a022935mg              75.9    1e-12   Erythranthe guttata [common monkey flower]
emb|CAN62110.1|  hypothetical protein VITISV_038734                   75.5    3e-12   Vitis vinifera
ref|XP_004306499.1|  PREDICTED: AP2-associated protein kinase 1 i...  74.7    4e-12   Fragaria vesca subsp. vesca
ref|XP_011468799.1|  PREDICTED: AP2-associated protein kinase 1 i...  74.7    4e-12   Fragaria vesca subsp. vesca
ref|XP_007149360.1|  hypothetical protein PHAVU_005G063700g           73.6    9e-12   Phaseolus vulgaris [French bean]
ref|XP_007149359.1|  hypothetical protein PHAVU_005G063700g           73.6    9e-12   Phaseolus vulgaris [French bean]
emb|CBI24810.3|  unnamed protein product                              73.6    1e-11   Vitis vinifera
emb|CAN81086.1|  hypothetical protein VITISV_027167                   72.8    2e-11   Vitis vinifera
ref|XP_007052604.1|  Serine/threonine-protein kinase DDB_G0280111...  72.0    3e-11   
ref|XP_010670934.1|  PREDICTED: actin-regulating kinase PRK1-like     72.0    3e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004149621.1|  PREDICTED: uncharacterized protein LOC101211119  72.0    3e-11   Cucumis sativus [cucumbers]
ref|XP_007052605.1|  Serine/threonine-protein kinase DDB_G0280111...  72.0    3e-11   
ref|XP_008392404.1|  PREDICTED: AP2-associated protein kinase 1       71.6    3e-11   Malus domestica [apple tree]
ref|XP_007052606.1|  Serine/threonine-protein kinase DDB_G0280111...  71.6    3e-11   
ref|XP_008461768.1|  PREDICTED: probable serine/threonine-protein...  71.6    4e-11   Cucumis melo [Oriental melon]
ref|XP_009339572.1|  PREDICTED: AP2-associated protein kinase 1       71.6    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_010522378.1|  PREDICTED: probable serine/threonine-protein...  70.5    8e-11   Tarenaya hassleriana [spider flower]
ref|XP_010522383.1|  PREDICTED: probable serine/threonine-protein...  70.5    8e-11   Tarenaya hassleriana [spider flower]
ref|XP_002314227.1|  hypothetical protein POPTR_0009s02770g           67.4    1e-10   
ref|XP_010678702.1|  PREDICTED: probable serine/threonine-protein...  68.9    3e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003531422.1|  PREDICTED: probable serine/threonine-protein...  67.0    1e-09   Glycine max [soybeans]
ref|XP_008805476.1|  PREDICTED: AP2-associated protein kinase 1-like  66.2    2e-09   Phoenix dactylifera
gb|KJB22767.1|  hypothetical protein B456_004G065000                  63.2    2e-08   Gossypium raimondii
gb|KJB22768.1|  hypothetical protein B456_004G065000                  63.2    2e-08   Gossypium raimondii
gb|KJB22766.1|  hypothetical protein B456_004G065000                  62.8    2e-08   Gossypium raimondii
ref|XP_003546865.1|  PREDICTED: probable serine/threonine-protein...  62.4    4e-08   Glycine max [soybeans]
gb|KHG06229.1|  putative serine/threonine-protein kinase              62.0    5e-08   Gossypium arboreum [tree cotton]
ref|XP_010257450.1|  PREDICTED: serine/threonine-protein kinase p...  61.6    6e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010257448.1|  PREDICTED: serine/threonine-protein kinase p...  61.6    7e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010257449.1|  PREDICTED: serine/threonine-protein kinase p...  61.6    7e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010913910.1|  PREDICTED: probable serine/threonine-protein...  60.1    2e-07   Elaeis guineensis
emb|CDX79504.1|  BnaC03g18400D                                        57.8    1e-06   
ref|XP_010509956.1|  PREDICTED: probable serine/threonine-protein...  57.4    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006293803.1|  hypothetical protein CARUB_v10022785mg           57.0    2e-06   Capsella rubella
ref|XP_004513162.1|  PREDICTED: probable serine/threonine-protein...  56.6    3e-06   
emb|CAN65496.1|  hypothetical protein VITISV_028322                   56.2    5e-06   Vitis vinifera
ref|XP_010469538.1|  PREDICTED: probable serine/threonine-protein...  55.8    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009132906.1|  PREDICTED: probable serine/threonine-protein...  55.5    5e-06   Brassica rapa
emb|CDX84704.1|  BnaA03g15260D                                        55.5    6e-06   
ref|XP_010413940.1|  PREDICTED: probable serine/threonine-protein...  53.9    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008808088.1|  PREDICTED: AP2-associated protein kinase 1-like  53.5    3e-05   Phoenix dactylifera
ref|XP_006850020.1|  hypothetical protein AMTR_s00022p00186280        51.2    2e-04   Amborella trichopoda
ref|XP_010542987.1|  PREDICTED: AP2-associated protein kinase 1-l...  50.4    3e-04   Tarenaya hassleriana [spider flower]
ref|XP_010542991.1|  PREDICTED: AP2-associated protein kinase 1-l...  50.4    3e-04   Tarenaya hassleriana [spider flower]
ref|XP_006410418.1|  hypothetical protein EUTSA_v10016354mg           50.4    3e-04   Eutrema salsugineum [saltwater cress]
ref|XP_009394517.1|  PREDICTED: AP2-associated protein kinase 1 {...  49.7    6e-04   
ref|XP_002881248.1|  hypothetical protein ARALYDRAFT_482227           49.3    7e-04   
ref|NP_001159134.1|  uncharacterized protein LOC100304212             47.8    7e-04   
gb|KEH33173.1|  Serine/Threonine kinase family protein                48.9    9e-04   Medicago truncatula



>ref|XP_009607019.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana tomentosiformis]
 ref|XP_009607020.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana tomentosiformis]
Length=700

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFG  398
            QGL   S  SPD   WQAFADD PK   T   +N PRS+RT+N    N Q S  +  GFG
Sbjct  596  QGLFGGSQVSPDSKPWQAFADDDPKQQPTSVNAN-PRSVRTKNGHQ-NRQTSETNTSGFG  653

Query  397  TDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            TDSF AVP+++SQ+ A+F++  NSQRFG+ K V++KSASQPAGWAGF
Sbjct  654  TDSFRAVPASSSQIKATFNESKNSQRFGEPKNVNSKSASQPAGWAGF  700



>ref|XP_009772211.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana sylvestris]
 ref|XP_009772212.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana sylvestris]
Length=699

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFG  398
            QGL   S  SPD   WQAFADD PK   T   +N PRS+RT+N    N Q S  +  GFG
Sbjct  595  QGLFGGSQVSPDSKPWQAFADDDPKQQPTSVNAN-PRSVRTKNGHQ-NRQTSETNTSGFG  652

Query  397  TDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            TDSF AVP+++SQ+ A+F++  N QRFG+ K V++KSASQPAGWAGF
Sbjct  653  TDSFRAVPASSSQIKATFNESKNYQRFGEPKNVNSKSASQPAGWAGF  699



>ref|XP_006359171.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Solanum tuberosum]
Length=694

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 6/108 (6%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN-NQPPNTQDSTASAWGF  401
            QGL   S  S D  +WQAFADD PK   TP  S TPRS+RT+N +Q  +T ++  SA  F
Sbjct  591  QGLFGQSQVSSDSKSWQAFADD-PKQQATPVNS-TPRSVRTKNGHQNRDTSETNTSA--F  646

Query  400  GTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            GTDSF AVP+++SQ+ A+F++  NSQRFG+ K +D+KSASQPAGWAGF
Sbjct  647  GTDSFRAVPASSSQIKANFNESKNSQRFGEPKNIDSKSASQPAGWAGF  694



>ref|XP_004229357.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Solanum lycopersicum]
Length=698

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 74/107 (69%), Gaps = 4/107 (4%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFG  398
            QGL   S  S D  +WQAFADD PK   TP  S TPRS+RT+N    N + S  +   FG
Sbjct  595  QGLFGQSQVSSDSKSWQAFADD-PKQQATPVNS-TPRSVRTKNGHQ-NRETSETNTSAFG  651

Query  397  TDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            TDSF AVP+ +SQ+ A+F++  NSQRFG+ K +D+KSASQPAGWAGF
Sbjct  652  TDSFRAVPAFSSQIKATFNESKNSQRFGEPKNIDSKSASQPAGWAGF  698



>emb|CDP07693.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (66%), Gaps = 15/114 (13%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTP----RSMRTRN---NQPPNTQDST  419
            QGLL+ SS+SPDP AWQAFADD       PPP  +     RS+RTRN   N   +  +S 
Sbjct  278  QGLLDQSSTSPDPRAWQAFADD-------PPPQTSVNSNSRSVRTRNGRQNNHVSEVNSG  330

Query  418  ASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKR-VDNKSASQPAGWAGF  260
            A+ WGFGTD+F A P+A+S +NA   +  NSQRF +++ +++   SQPAGWAGF
Sbjct  331  ANTWGFGTDNFKAAPAASSHINAHTVEATNSQRFSERKDIESSQTSQPAGWAGF  384



>ref|XP_010027725.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW54314.1| hypothetical protein EUGRSUZ_I00278 [Eucalyptus grandis]
Length=697

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 69/101 (68%), Gaps = 5/101 (5%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTASA---WGFGTDSFTA  380
            SP+P++WQAFADD PKP        T RS+RTRN Q        AS    WGFG++SFTA
Sbjct  598  SPEPTSWQAFADD-PKPRQPLSRDTTSRSVRTRNGQQSKQGTQAASKNETWGFGSESFTA  656

Query  379  VPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            +P+A+SQ++    + + SQRFGD +  +NKS+SQPAGWAGF
Sbjct  657  MPNASSQISKPIREGSTSQRFGDSKFRENKSSSQPAGWAGF  697



>ref|XP_010027724.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Eucalyptus 
grandis]
Length=703

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 69/101 (68%), Gaps = 5/101 (5%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTASA---WGFGTDSFTA  380
            SP+P++WQAFADD PKP        T RS+RTRN Q        AS    WGFG++SFTA
Sbjct  604  SPEPTSWQAFADD-PKPRQPLSRDTTSRSVRTRNGQQSKQGTQAASKNETWGFGSESFTA  662

Query  379  VPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            +P+A+SQ++    + + SQRFGD +  +NKS+SQPAGWAGF
Sbjct  663  MPNASSQISKPIREGSTSQRFGDSKFRENKSSSQPAGWAGF  703



>ref|XP_011087152.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X3 [Sesamum indicum]
Length=669

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPN---TQDSTASAW  407
            QG  +  S SPD   WQAF DD PKP  T P +N  RS +TRN Q  N      S AS W
Sbjct  564  QGFFDRGSPSPDTQQWQAFTDD-PKP-QTMPTNNASRSAQTRNGQQSNQAAELSSGASTW  621

Query  406  GFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            GFGTDSF    SAT ++N    + NNSQRFG+ K  ++K  SQPAGWAGF
Sbjct  622  GFGTDSFKV--SATPKINLPVGEFNNSQRFGESKSTESKLESQPAGWAGF  669



>ref|XP_011087141.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Sesamum 
indicum]
Length=695

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPN---TQDSTASAW  407
            QG  +  S SPD   WQAF DD PKP  T P +N  RS +TRN Q  N      S AS W
Sbjct  590  QGFFDRGSPSPDTQQWQAFTDD-PKP-QTMPTNNASRSAQTRNGQQSNQAAELSSGASTW  647

Query  406  GFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            GFGTDSF    SAT ++N    + NNSQRFG+ K  ++K  SQPAGWAGF
Sbjct  648  GFGTDSFKV--SATPKINLPVGEFNNSQRFGESKSTESKLESQPAGWAGF  695



>ref|XP_011087144.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Sesamum 
indicum]
Length=690

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPN---TQDSTASAW  407
            QG  +  S SPD   WQAF DD PKP  T P +N  RS +TRN Q  N      S AS W
Sbjct  585  QGFFDRGSPSPDTQQWQAFTDD-PKP-QTMPTNNASRSAQTRNGQQSNQAAELSSGASTW  642

Query  406  GFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            GFGTDSF    SAT ++N    + NNSQRFG+ K  ++K  SQPAGWAGF
Sbjct  643  GFGTDSFKV--SATPKINLPVGEFNNSQRFGESKSTESKLESQPAGWAGF  690



>ref|XP_011087160.1| PREDICTED: AP2-associated protein kinase 1 isoform X4 [Sesamum 
indicum]
 ref|XP_011087168.1| PREDICTED: AP2-associated protein kinase 1 isoform X4 [Sesamum 
indicum]
Length=626

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 67/110 (61%), Gaps = 8/110 (7%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPN---TQDSTASAW  407
            QG  +  S SPD   WQAF DD PKP  T P +N  RS +TRN Q  N      S AS W
Sbjct  521  QGFFDRGSPSPDTQQWQAFTDD-PKP-QTMPTNNASRSAQTRNGQQSNQAAELSSGASTW  578

Query  406  GFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            GFGTDSF    SAT ++N    + NNSQRFG+ K  ++K  SQPAGWAGF
Sbjct  579  GFGTDSFKV--SATPKINLPVGEFNNSQRFGESKSTESKLESQPAGWAGF  626



>ref|XP_010265881.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X2 [Nelumbo nucifera]
Length=700

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 71/114 (62%), Gaps = 15/114 (13%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPS---NTPRSMRTRN----NQPPNTQDST  419
            QGL  +SS SPD   W AF+DD     T P PS   NTPRS+RT N     Q P+ +   
Sbjct  594  QGLFANSSPSPDSKPWNAFSDD-----TKPQPSLKNNTPRSVRTTNGRQKKQAPD-ESHG  647

Query  418  ASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKR-VDNKSASQPAGWAGF  260
               WGFG+D+FTAVPS+T Q+  + S  ++ +R GD R V+ K ASQPAGWAGF
Sbjct  648  LETWGFGSDNFTAVPSST-QVTQTSSQVHSFERIGDSRSVERKKASQPAGWAGF  700



>ref|XP_010265879.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X1 [Nelumbo nucifera]
 ref|XP_010265880.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X1 [Nelumbo nucifera]
Length=701

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 71/114 (62%), Gaps = 15/114 (13%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPS---NTPRSMRTRN----NQPPNTQDST  419
            QGL  +SS SPD   W AF+DD     T P PS   NTPRS+RT N     Q P+ +   
Sbjct  595  QGLFANSSPSPDSKPWNAFSDD-----TKPQPSLKNNTPRSVRTTNGRQKKQAPD-ESHG  648

Query  418  ASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKR-VDNKSASQPAGWAGF  260
               WGFG+D+FTAVPS+T Q+  + S  ++ +R GD R V+ K ASQPAGWAGF
Sbjct  649  LETWGFGSDNFTAVPSST-QVTQTSSQVHSFERIGDSRSVERKKASQPAGWAGF  701



>ref|XP_008231320.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Prunus 
mume]
Length=698

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 72/110 (65%), Gaps = 5/110 (5%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQ--PPNTQDSTA-SAW  407
            QG  + S+ SP+P+ WQ F ++ PK        NT +S+RTRN       TQ +T   +W
Sbjct  590  QGKSDRSTPSPEPNPWQPFVEE-PKSQQPSSTDNTMKSVRTRNGHQNKQTTQVNTGFDSW  648

Query  406  GFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            GFG +SFTAVP+ ++Q++    + NNSQRFG+ +V ++K ASQPAGWAGF
Sbjct  649  GFGAESFTAVPTGSTQISRPMGEGNNSQRFGEAKVMESKPASQPAGWAGF  698



>ref|XP_008231319.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Prunus 
mume]
Length=699

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 72/110 (65%), Gaps = 5/110 (5%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQ--PPNTQDSTA-SAW  407
            QG  + S+ SP+P+ WQ F ++ PK        NT +S+RTRN       TQ +T   +W
Sbjct  591  QGKSDRSTPSPEPNPWQPFVEE-PKSQQPSSTDNTMKSVRTRNGHQNKQTTQVNTGFDSW  649

Query  406  GFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            GFG +SFTAVP+ ++Q++    + NNSQRFG+ +V ++K ASQPAGWAGF
Sbjct  650  GFGAESFTAVPTGSTQISRPMGEGNNSQRFGEAKVMESKPASQPAGWAGF  699



>ref|XP_008231321.1| PREDICTED: AP2-associated protein kinase 1 isoform X3 [Prunus 
mume]
Length=697

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 72/110 (65%), Gaps = 5/110 (5%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQ--PPNTQDSTA-SAW  407
            QG  + S+ SP+P+ WQ F ++ PK        NT +S+RTRN       TQ +T   +W
Sbjct  589  QGKSDRSTPSPEPNPWQPFVEE-PKSQQPSSTDNTMKSVRTRNGHQNKQTTQVNTGFDSW  647

Query  406  GFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            GFG +SFTAVP+ ++Q++    + NNSQRFG+ +V ++K ASQPAGWAGF
Sbjct  648  GFGAESFTAVPTGSTQISRPMGEGNNSQRFGEAKVMESKPASQPAGWAGF  697



>ref|XP_010095876.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXC42162.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=652

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 69/102 (68%), Gaps = 7/102 (7%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQ----DSTASAWGFGTDSFT  383
            SP P  WQAF ++       PP SNT +S+RTRN  P N Q    +S   +WGFGT+SFT
Sbjct  553  SPKPRMWQAFPEEPKPQ-QPPPSSNTVKSVRTRNG-PQNKQATQVNSGFDSWGFGTESFT  610

Query  382  AVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            A+P+ +SQM+ S ++ NNSQ  G+ ++ ++K ASQPAGWAGF
Sbjct  611  AIPTGSSQMSRSLAEGNNSQHTGEAKIMESKPASQPAGWAGF  652



>ref|XP_002512151.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF50185.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=622

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 7/100 (7%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPP-PSNTPRSMRTRN-NQPPNTQDSTASAWGFGTDSFTAV  377
            SPD   W AFADD  KP   PP   N+P+S+RTRN NQ    + + + +WGFG DSFTA 
Sbjct  527  SPDQKPWHAFADDS-KPQQQPPSKGNSPQSVRTRNANQ---RKQAESESWGFGADSFTAA  582

Query  376  PSATSQMNASFSDRNNSQRF-GDKRVDNKSASQPAGWAGF  260
            P+A++Q +   ++ N+SQ F G K +++++A+QPAGWAGF
Sbjct  583  PAASTQTSRPINEGNSSQHFSGTKIMESQAATQPAGWAGF  622



>ref|XP_007220628.1| hypothetical protein PRUPE_ppa002321mg [Prunus persica]
 gb|EMJ21827.1| hypothetical protein PRUPE_ppa002321mg [Prunus persica]
Length=687

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 71/110 (65%), Gaps = 5/110 (5%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQDSTASAW  407
            QG  + S+ SP+P+ WQ F ++ PK        NT +S+RTRN   N+     ++   +W
Sbjct  579  QGKSDRSTPSPEPNPWQPFVEE-PKSQQPSSTDNTMKSVRTRNGHQNKQSTKVNTGFDSW  637

Query  406  GFGTDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            GFG +SFTAVP+ ++Q++    + NNSQ FG+ +V ++K ASQPAGWAGF
Sbjct  638  GFGAESFTAVPTGSTQISRPMGEGNNSQHFGEAKVMESKPASQPAGWAGF  687



>gb|ABK92707.1| unknown [Populus trichocarpa]
Length=226

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTA  380
            SP+  +WQAFADD           N+P+S+RTRN   N+      S   +WGFG++SFTA
Sbjct  130  SPESKSWQAFADDNKSRQKPVSKGNSPQSVRTRNAHQNKQAAELTSNIDSWGFGSESFTA  189

Query  379  VPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
            VP+A+SQ++ S ++ ++    G K +++K A+QPAGWAGF
Sbjct  190  VPAASSQISGSNTEAHSG---GSKIMESKPATQPAGWAGF  226



>emb|CBI32192.3| unnamed protein product [Vitis vinifera]
Length=366

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 5/101 (5%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTA  380
            +PD   WQAF D+  K        NT +S+RTRN   N+P     S    WGFGT+SFTA
Sbjct  267  APDSKPWQAFPDE-LKQHQPLSRDNTSKSVRTRNGHHNKPATEATSGPETWGFGTESFTA  325

Query  379  VPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
             P+A+S  +      NN+Q FGD KR+++K A+QPAGWAGF
Sbjct  326  TPAASSSFSRPTVGGNNAQLFGDSKRIESKPATQPAGWAGF  366



>ref|XP_010659600.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Vitis vinifera]
Length=710

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 63/103 (61%), Gaps = 5/103 (5%)
 Frame = -1

Query  556  SSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSF  386
            S +PD   WQAF D+  K        NT +S+RTRN   N+P     S    WGFGT+SF
Sbjct  609  SPAPDSKPWQAFPDE-LKQHQPLSRDNTSKSVRTRNGHHNKPATEATSGPETWGFGTESF  667

Query  385  TAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            TA P+A+S  +      NN+Q FGD KR+++K A+QPAGWAGF
Sbjct  668  TATPAASSSFSRPTVGGNNAQLFGDSKRIESKPATQPAGWAGF  710



>ref|XP_010659599.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Vitis vinifera]
Length=711

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 63/103 (61%), Gaps = 5/103 (5%)
 Frame = -1

Query  556  SSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSF  386
            S +PD   WQAF D+  K        NT +S+RTRN   N+P     S    WGFGT+SF
Sbjct  610  SPAPDSKPWQAFPDE-LKQHQPLSRDNTSKSVRTRNGHHNKPATEATSGPETWGFGTESF  668

Query  385  TAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            TA P+A+S  +      NN+Q FGD KR+++K A+QPAGWAGF
Sbjct  669  TATPAASSSFSRPTVGGNNAQLFGDSKRIESKPATQPAGWAGF  711



>ref|XP_010659601.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X3 [Vitis vinifera]
Length=698

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 63/103 (61%), Gaps = 5/103 (5%)
 Frame = -1

Query  556  SSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSF  386
            S +PD   WQAF D+  K        NT +S+RTRN   N+P     S    WGFGT+SF
Sbjct  597  SPAPDSKPWQAFPDE-LKQHQPLSRDNTSKSVRTRNGHHNKPATEATSGPETWGFGTESF  655

Query  385  TAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            TA P+A+S  +      NN+Q FGD KR+++K A+QPAGWAGF
Sbjct  656  TATPAASSSFSRPTVGGNNAQLFGDSKRIESKPATQPAGWAGF  698



>ref|XP_006369447.1| hypothetical protein POPTR_0001s23520g [Populus trichocarpa]
 gb|ERP66016.1| hypothetical protein POPTR_0001s23520g [Populus trichocarpa]
Length=666

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 67/103 (65%), Gaps = 6/103 (6%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDS  389
            S+ SP+  +WQAFADD           N+P+S+RTRN   N+      S   +WGFG++S
Sbjct  567  STPSPESKSWQAFADDNKSRQKPVSKGNSPQSVRTRNAHQNKQAAELTSNIDSWGFGSES  626

Query  388  FTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
            FTAVP+A+SQ++ S ++ ++    G K +++K A+QPAGWAGF
Sbjct  627  FTAVPAASSQISGSNTEAHSG---GSKIMESKPATQPAGWAGF  666



>ref|XP_006482823.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X3 [Citrus sinensis]
Length=692

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 9/101 (9%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTA  380
            SP+  +WQAFA+D PKP       NT +S+RTRN     +T  ST+   +WGFGT+SFTA
Sbjct  597  SPESKSWQAFAED-PKP----QQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTA  651

Query  379  VPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  260
            +P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  652  IPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  692



>ref|XP_006482821.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482822.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X2 [Citrus sinensis]
Length=693

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 9/101 (9%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTA  380
            SP+  +WQAFA+D PKP       NT +S+RTRN     +T  ST+   +WGFGT+SFTA
Sbjct  598  SPESKSWQAFAED-PKP----QQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTA  652

Query  379  VPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  260
            +P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  653  IPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  693



>ref|XP_006439041.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 ref|XP_006439042.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52281.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52282.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=692

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 9/101 (9%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTA  380
            SP+  +WQAFA+D PKP       NT +S+RTRN     +T  ST+   +WGFGT+SFTA
Sbjct  597  SPESKSWQAFAED-PKP----QQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTA  651

Query  379  VPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  260
            +P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  652  IPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  692



>ref|XP_006439043.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52283.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=693

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 9/101 (9%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTA  380
            SP+  +WQAFA+D PKP       NT +S+RTRN     +T  ST+   +WGFGT+SFTA
Sbjct  598  SPESKSWQAFAED-PKP----QQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTA  652

Query  379  VPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  260
            +P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  653  IPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  693



>gb|KDO46085.1| hypothetical protein CISIN_1g005558mg [Citrus sinensis]
Length=690

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 9/101 (9%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTA  380
            SP+  +WQAFA+D PKP       NT +S+RTRN     +T  ST+   +WGFGT+SFTA
Sbjct  595  SPESKSWQAFAED-PKP----QQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTA  649

Query  379  VPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  260
            +P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  650  IPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  690



>ref|XP_006482824.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X4 [Citrus sinensis]
Length=691

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 9/101 (9%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTA  380
            SP+  +WQAFA+D PKP       NT +S+RTRN     +T  ST+   +WGFGT+SFTA
Sbjct  596  SPESKSWQAFAED-PKP----QQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTA  650

Query  379  VPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  260
            +P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  651  IPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  691



>ref|XP_006439040.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 ref|XP_006439044.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52280.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52284.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=690

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 9/101 (9%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTA  380
            SP+  +WQAFA+D PKP       NT +S+RTRN     +T  ST+   +WGFGT+SFTA
Sbjct  595  SPESKSWQAFAED-PKP----QQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTA  649

Query  379  VPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  260
            +P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  650  IPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  690



>gb|KDO46086.1| hypothetical protein CISIN_1g005558mg [Citrus sinensis]
Length=691

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 9/101 (9%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTA  380
            SP+  +WQAFA+D PKP       NT +S+RTRN     +T  ST+   +WGFGT+SFTA
Sbjct  596  SPESKSWQAFAED-PKP----QQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTA  650

Query  379  VPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  260
            +P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  651  IPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  691



>gb|KDO46087.1| hypothetical protein CISIN_1g005558mg [Citrus sinensis]
Length=422

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 9/101 (9%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTA  380
            SP+  +WQAFA+D PKP       NT +S+RTRN     +T  ST+   +WGFGT+SFTA
Sbjct  327  SPESKSWQAFAED-PKP----QQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTA  381

Query  379  VPSATSQMNASFSDRNNSQRFG-DKRVDNKSASQPAGWAGF  260
            +P+A SQ +   ++ N+SQ  G  K  +N+ ++QPAGWAGF
Sbjct  382  IPAANSQRSKPITEGNSSQSIGRSKTTENQPSAQPAGWAGF  422



>gb|KDP20398.1| hypothetical protein JCGZ_05281 [Jatropha curcas]
Length=669

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 70/113 (62%), Gaps = 7/113 (6%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN-NQPPNTQDSTA--SAW  407
            QG  + S+ SP+  AWQAFA D     ++   SN+P S+RTRN NQ      +++   +W
Sbjct  557  QGESDWSTPSPETKAWQAFAVDPKTHQSSLSKSNSPLSVRTRNANQKKLAAQASSEFESW  616

Query  406  GFGTDSFTAVPSATSQ----MNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
            GFG DSF+AVP A++Q    +N   S R++ Q  G K V+ + ASQPAGWAGF
Sbjct  617  GFGADSFSAVPGASTQTSRLINEGNSSRSSQQLAGTKVVEGQPASQPAGWAGF  669



>gb|EYU27100.1| hypothetical protein MIMGU_mgv1a022935mg [Erythranthe guttata]
Length=634

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 64/108 (59%), Gaps = 11/108 (10%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFG  398
            QGL + SS S D   WQAF+DD         PS+ P+S+RTRN  P N Q    ++WGF 
Sbjct  536  QGLFDRSSKSSDSQQWQAFSDD--------KPSSAPKSVRTRNT-PQNNQKVETNSWGFE  586

Query  397  TDSFTAVP-SATSQMNASFSDRNNSQRFGDKRVDN-KSASQPAGWAGF  260
            T+SF  VP +A+S ++      N SQRF +++ +  K  + PAGWAGF
Sbjct  587  TESFKVVPNAASSNVSVPVGGLNVSQRFVEQKSNKGKLDAPPAGWAGF  634



>emb|CAN62110.1| hypothetical protein VITISV_038734 [Vitis vinifera]
Length=1625

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 45/112 (40%), Positives = 62/112 (55%), Gaps = 8/112 (7%)
 Frame = -1

Query  574   GLLNHSSSSPDPSAWQAFADDGP---KPFTTPPPSNTPRSMRTRN---NQPPNTQDSTAS  413
             G L H +SS + +AW       P   K F    P N  +S+RT+N   N+P     S   
Sbjct  1515  GTLCHPASS-EIAAWPMXRLTIPSTVKQFLMRCPDNNSKSVRTQNGHHNKPATEGTSGPE  1573

Query  412   AWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
              WGFGT+SFTA P+A+S ++      NN+Q F D K+++ K A+QP  WAGF
Sbjct  1574  TWGFGTESFTATPAASSNISRPSIGGNNAQLFVDSKKIEGKLATQPVEWAGF  1625



>ref|XP_004306499.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468798.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=682

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (64%), Gaps = 9/102 (9%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQ-DSTASAWGFGTDSFT  383
            SP+  +WQ FA+    P       N+ +S+RTRN   N+   TQ +S   +WGFGT+SF+
Sbjct  585  SPETKSWQPFAE----PLQPSSTDNSVKSVRTRNGHQNKQATTQVNSGFDSWGFGTESFS  640

Query  382  AVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            A P+ ++Q+     + N SQRFGD K +++K ASQPAGWAGF
Sbjct  641  AAPTGSTQIPRPMGEGNISQRFGDTKAMESKPASQPAGWAGF  682



>ref|XP_011468799.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=681

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (64%), Gaps = 9/102 (9%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQ-DSTASAWGFGTDSFT  383
            SP+  +WQ FA+    P       N+ +S+RTRN   N+   TQ +S   +WGFGT+SF+
Sbjct  584  SPETKSWQPFAE----PLQPSSTDNSVKSVRTRNGHQNKQATTQVNSGFDSWGFGTESFS  639

Query  382  AVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            A P+ ++Q+     + N SQRFGD K +++K ASQPAGWAGF
Sbjct  640  AAPTGSTQIPRPMGEGNISQRFGDTKAMESKPASQPAGWAGF  681



>ref|XP_007149360.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
 gb|ESW21354.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
Length=674

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 5/101 (5%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRT---RNNQPPNTQDSTASAWGFGTDSFTA  380
            S +P +WQAF ++ P+   +    NT +S RT   R N+ P    +T  +WGFGTDSF+A
Sbjct  575  SSEPKSWQAFPEE-PQQQKSLSAENTTKSARTNNGRQNKQPVPLATTFDSWGFGTDSFSA  633

Query  379  VPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            VPS +SQM    S    SQ FG+ K  ++K  SQPAGWAGF
Sbjct  634  VPSGSSQMQRPSSAGGKSQGFGEAKAFESKPTSQPAGWAGF  674



>ref|XP_007149359.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
 gb|ESW21353.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
Length=673

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 5/101 (5%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRT---RNNQPPNTQDSTASAWGFGTDSFTA  380
            S +P +WQAF ++ P+   +    NT +S RT   R N+ P    +T  +WGFGTDSF+A
Sbjct  574  SSEPKSWQAFPEE-PQQQKSLSAENTTKSARTNNGRQNKQPVPLATTFDSWGFGTDSFSA  632

Query  379  VPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            VPS +SQM    S    SQ FG+ K  ++K  SQPAGWAGF
Sbjct  633  VPSGSSQMQRPSSAGGKSQGFGEAKAFESKPTSQPAGWAGF  673



>emb|CBI24810.3| unnamed protein product [Vitis vinifera]
Length=1100

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 49/85 (58%), Gaps = 7/85 (8%)
 Frame = -1

Query  484   PSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG  314
             P N  +S+RTRN   N+P     S    WGFGT SFTA P+A+S ++      NN   FG
Sbjct  932   PDNNSKSVRTRNGHHNKPATEATSGPETWGFGTQSFTATPAASSNISKPPVGGNNVHLFG  991

Query  313   D-KRVDNKSASQPAGWAGF*ASALC  242
             D K+++ K A QPA WA    SALC
Sbjct  992   DSKKIEGKLAPQPAEWA---VSALC  1013



>emb|CAN81086.1| hypothetical protein VITISV_027167 [Vitis vinifera]
Length=1756

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 46/78 (59%), Gaps = 4/78 (5%)
 Frame = -1

Query  484   PSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG  314
             P N  +S+RTRN   N+P     S    WGFGT SFTA P+A+S ++      NN   FG
Sbjct  1316  PDNNSKSVRTRNGHHNKPATEATSGPETWGFGTQSFTATPAASSNISKPPVGGNNVHLFG  1375

Query  313   D-KRVDNKSASQPAGWAG  263
             D K+++ K A QPA WAG
Sbjct  1376  DSKKIEGKLAPQPAEWAG  1393



>ref|XP_007052604.1| Serine/threonine-protein kinase DDB_G0280111 isoform 1 [Theobroma 
cacao]
 gb|EOX96761.1| Serine/threonine-protein kinase DDB_G0280111 isoform 1 [Theobroma 
cacao]
Length=688

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 61/104 (59%), Gaps = 5/104 (5%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDS  389
            +++SP+   WQAF++D      +    N  RS+RTRN   N+      S    W FGTDS
Sbjct  586  TTASPEAKPWQAFSEDAKLQQQSLSKDNV-RSVRTRNGHSNKHVAEATSGLDTWSFGTDS  644

Query  388  FTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            FTA P+A+ Q     S+ ++SQRFG+  + +N   SQPAGWAGF
Sbjct  645  FTAAPAASPQRLKPMSEGSSSQRFGESMIKENHPTSQPAGWAGF  688



>ref|XP_010670934.1| PREDICTED: actin-regulating kinase PRK1-like [Beta vulgaris subsp. 
vulgaris]
Length=656

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 66/108 (61%), Gaps = 3/108 (3%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFG  398
            +GL + +S++P+P  WQAFA+D   P +   PS + ++    +++   +  ST + WGFG
Sbjct  550  EGLFDKNSTNPEPKTWQAFANDTSTPTSIGHPSKSVKNRSGHSSKQDASVGSTKNGWGFG  609

Query  397  TDSFTAVPSATSQMNASFSDRNNSQRFGD--KRVDNKSASQPAGWAGF  260
             D+F AV +A+S++    +  + S RFGD  K     +ASQPAGWAGF
Sbjct  610  NDNFAAVSAASSRIIRPGAG-STSLRFGDSNKLASKNTASQPAGWAGF  656



>ref|XP_004149621.1| PREDICTED: uncharacterized protein LOC101211119 [Cucumis sativus]
 ref|XP_004170535.1| PREDICTED: uncharacterized LOC101211119 [Cucumis sativus]
 gb|KGN58620.1| hypothetical protein Csa_3G702580 [Cucumis sativus]
Length=676

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 61/102 (60%), Gaps = 8/102 (8%)
 Frame = -1

Query  550  SPDPSAWQAFADDGP--KPFTTPPPSNTPRSMRTRNNQPPNT--QDSTASAWGFGTDSFT  383
            SPD  AWQAFA++ P  +P T   P    +SMRTR+ Q      +++   +WGFG +SFT
Sbjct  578  SPDAKAWQAFAEESPNQQPVT---PEKGVKSMRTRSVQRKQASPENTGFESWGFGAESFT  634

Query  382  AVPSATSQMNASFSDRNNSQRFGDKR-VDNKSASQPAGWAGF  260
            AV + +S  +    +RN+SQR G      N  +SQPAGWAGF
Sbjct  635  AVSAGSSNKSGLTGERNSSQRTGGGEPKSNDISSQPAGWAGF  676



>ref|XP_007052605.1| Serine/threonine-protein kinase DDB_G0280111 isoform 2 [Theobroma 
cacao]
 gb|EOX96762.1| Serine/threonine-protein kinase DDB_G0280111 isoform 2 [Theobroma 
cacao]
Length=678

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 61/104 (59%), Gaps = 5/104 (5%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDS  389
            +++SP+   WQAF++D      +    N  RS+RTRN   N+      S    W FGTDS
Sbjct  576  TTASPEAKPWQAFSEDAKLQQQSLSKDNV-RSVRTRNGHSNKHVAEATSGLDTWSFGTDS  634

Query  388  FTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            FTA P+A+ Q     S+ ++SQRFG+  + +N   SQPAGWAGF
Sbjct  635  FTAAPAASPQRLKPMSEGSSSQRFGESMIKENHPTSQPAGWAGF  678



>ref|XP_008392404.1| PREDICTED: AP2-associated protein kinase 1 [Malus domestica]
Length=681

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 14/109 (13%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPPSNTP---RSMRTRNNQPPNTQDSTASA----WGF  401
            S+ SP+   WQ FA++ PKP   P PS+T    +S RTRN    N Q +  +A    WGF
Sbjct  578  STPSPESKPWQPFAEE-PKP---PQPSSTANAFKSARTRNGHQ-NKQGTQVNAGFDSWGF  632

Query  400  GTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDN-KSASQPAGWAGF  260
            G DSF+A  + ++Q++   S+ NNSQR G+ K ++N K ASQPAGWAGF
Sbjct  633  GADSFSAASTGSTQISRPMSEGNNSQRLGEAKGMENSKPASQPAGWAGF  681



>ref|XP_007052606.1| Serine/threonine-protein kinase DDB_G0280111 isoform 3 [Theobroma 
cacao]
 gb|EOX96763.1| Serine/threonine-protein kinase DDB_G0280111 isoform 3 [Theobroma 
cacao]
Length=679

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 61/104 (59%), Gaps = 5/104 (5%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDS  389
            +++SP+   WQAF++D      +    N  RS+RTRN   N+      S    W FGTDS
Sbjct  577  TTASPEAKPWQAFSEDAKLQQQSLSKDNV-RSVRTRNGHSNKHVAEATSGLDTWSFGTDS  635

Query  388  FTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            FTA P+A+ Q     S+ ++SQRFG+  + +N   SQPAGWAGF
Sbjct  636  FTAAPAASPQRLKPMSEGSSSQRFGESMIKENHPTSQPAGWAGF  679



>ref|XP_008461768.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Cucumis melo]
Length=665

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 60/100 (60%), Gaps = 4/100 (4%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNT--QDSTASAWGFGTDSFTAV  377
            SPD  AWQAFA++ P   +  P     +SMRTR+ Q      +++   +WGFG +SF+AV
Sbjct  567  SPDAKAWQAFAEESPNQQSVTPEKGV-KSMRTRSLQKKQASPENTGFESWGFGAESFSAV  625

Query  376  PSATSQMNASFSDRNNSQRFGDKR-VDNKSASQPAGWAGF  260
             + +S  +    +RN+SQR G      N+ +SQPAGWAGF
Sbjct  626  SAGSSNKSGLTGERNSSQRTGGGEPKSNEVSSQPAGWAGF  665



>ref|XP_009339572.1| PREDICTED: AP2-associated protein kinase 1 [Pyrus x bretschneideri]
Length=688

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 14/109 (13%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPPSNTP---RSMRTRNNQPPNTQDSTASA----WGF  401
            S+ SP+   WQ FA++ PKP   P PS+T    +S RTRN    N Q +  +A    WGF
Sbjct  585  STPSPESKPWQPFAEE-PKP---PQPSSTANAFKSARTRNGHQ-NKQGTQVNAGFDSWGF  639

Query  400  GTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDN-KSASQPAGWAGF  260
            G DSF+A  + ++Q++   S+ NNSQR G+ K ++N K ASQPAGWAGF
Sbjct  640  GADSFSAASTESAQISRPMSEGNNSQRLGEAKGMENSKPASQPAGWAGF  688



>ref|XP_010522378.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522379.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522380.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522382.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
Length=649

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 59/107 (55%), Gaps = 13/107 (12%)
 Frame = -1

Query  544  DPSAWQAFADDGPKP-FTTPPPSN---TPRSMRTRNNQPPNTQDSTAS-------AWGFG  398
            D   WQAF+DD PKP   T    N   T +S  TRN+QP      TA        +WGF 
Sbjct  544  DLKPWQAFSDD-PKPNLQTASKGNNTSTNQSFGTRNSQPSKQTTLTAVPTSQGFDSWGFE  602

Query  397  TDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            TDSF A P++ S         N SQRFG+ RV DN+ A+QPAGW+GF
Sbjct  603  TDSFRATPTSASATQRPLGSGNTSQRFGNSRVRDNQQAAQPAGWSGF  649



>ref|XP_010522383.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Tarenaya hassleriana]
Length=648

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 59/107 (55%), Gaps = 13/107 (12%)
 Frame = -1

Query  544  DPSAWQAFADDGPKP-FTTPPPSN---TPRSMRTRNNQPPNTQDSTAS-------AWGFG  398
            D   WQAF+DD PKP   T    N   T +S  TRN+QP      TA        +WGF 
Sbjct  543  DLKPWQAFSDD-PKPNLQTASKGNNTSTNQSFGTRNSQPSKQTTLTAVPTSQGFDSWGFE  601

Query  397  TDSFTAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            TDSF A P++ S         N SQRFG+ RV DN+ A+QPAGW+GF
Sbjct  602  TDSFRATPTSASATQRPLGSGNTSQRFGNSRVRDNQQAAQPAGWSGF  648



>ref|XP_002314227.1| hypothetical protein POPTR_0009s02770g [Populus trichocarpa]
 gb|EEE88182.1| hypothetical protein POPTR_0009s02770g [Populus trichocarpa]
Length=210

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 61/103 (59%), Gaps = 6/103 (6%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDS  389
            S+ S +  +WQAFADD           N+P+S+RTRN   N+      S   +WGFG+++
Sbjct  111  STLSLETKSWQAFADDKKSQKQHLSKGNSPQSVRTRNAHQNKQAAELTSDFDSWGFGSEN  170

Query  388  FTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
            FTAVP+ +SQ+  S ++ +     G K   +K A+QPAGWAGF
Sbjct  171  FTAVPATSSQIPVSNTEVSVG---GYKITVSKPATQPAGWAGF  210



>ref|XP_010678702.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Beta vulgaris subsp. vulgaris]
Length=664

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 64/114 (56%), Gaps = 18/114 (16%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRS--MRTRNNQPPNTQD----STA  416
            QGL + SS S +   WQAFA        + P S   RS  +RT+N    N QD    +T 
Sbjct  561  QGLSDKSSKSSETKPWQAFA--------SSPTSIADRSKSVRTKNGHS-NKQDASGGTTQ  611

Query  415  SAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD--KRVDNKSASQPAGWAGF  260
              WGFG DSFTA PSA+S+++    + N SQRF D  K     +ASQPAGWAGF
Sbjct  612  DKWGFGDDSFTAAPSASSRISRP-GEGNTSQRFADSNKLASKNTASQPAGWAGF  664



>ref|XP_003531422.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Glycine max]
 gb|KHN29185.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=662

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = -1

Query  535  AWQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSAT  365
            +WQAF ++ P+   +    NT +S+R +N   N+ P    +   +WGFGTDSF+AVP+ +
Sbjct  572  SWQAFPEE-PQQQRSLSAENTSKSVRVKNGQQNKQPVPLATDFDSWGFGTDSFSAVPAGS  630

Query  364  SQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
             QM    S    SQ FG+    NKS SQPAGWAGF
Sbjct  631  PQMQRPSSAGTKSQAFGEA---NKSTSQPAGWAGF  662



>ref|XP_008805476.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
 ref|XP_008805477.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
Length=702

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 60/105 (57%), Gaps = 11/105 (10%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRN----NQPPNTQDSTASA---WGFGTD  392
            SPDP  WQAFA++ PK   TP  S  PRS+RT      ++    Q +T SA   WGF  D
Sbjct  601  SPDPKPWQAFAEE-PKVQGTPK-SIHPRSVRTVRAANGSRDTTKQAATYSANEPWGFDND  658

Query  391  SFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKS-ASQPAGWAGF  260
            SF AVPS +     S    N SQRFG  R   K+ A+QPAGWAGF
Sbjct  659  SFRAVPSGSEVPRTSVQG-NTSQRFGGGREMKKAEANQPAGWAGF  702



>gb|KJB22767.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
 gb|KJB22769.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=661

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 5/106 (5%)
 Frame = -1

Query  565  NHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTAS----AWGFG  398
            N  ++SP+   WQAF +D       P   +  +S+RTRN    N   + A+     WGFG
Sbjct  557  NWKTASPEAKPWQAFPEDAKPQQQQPLSKDNVQSVRTRNGHS-NMHAAQATFGMETWGFG  615

Query  397  TDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
             D+FTA P+A+SQ   S  +  +S +   K  ++   SQPAGWAGF
Sbjct  616  ADNFTAAPTASSQRLKSMINEGSSSQRESKIKESNPVSQPAGWAGF  661



>gb|KJB22768.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=662

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 5/106 (5%)
 Frame = -1

Query  565  NHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTAS----AWGFG  398
            N  ++SP+   WQAF +D       P   +  +S+RTRN    N   + A+     WGFG
Sbjct  558  NWKTASPEAKPWQAFPEDAKPQQQQPLSKDNVQSVRTRNGHS-NMHAAQATFGMETWGFG  616

Query  397  TDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
             D+FTA P+A+SQ   S  +  +S +   K  ++   SQPAGWAGF
Sbjct  617  ADNFTAAPTASSQRLKSMINEGSSSQRESKIKESNPVSQPAGWAGF  662



>gb|KJB22766.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=658

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 5/106 (5%)
 Frame = -1

Query  565  NHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTAS----AWGFG  398
            N  ++SP+   WQAF +D       P   +  +S+RTRN    N   + A+     WGFG
Sbjct  554  NWKTASPEAKPWQAFPEDAKPQQQQPLSKDNVQSVRTRNGHS-NMHAAQATFGMETWGFG  612

Query  397  TDSFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
             D+FTA P+A+SQ   S  +  +S +   K  ++   SQPAGWAGF
Sbjct  613  ADNFTAAPTASSQRLKSMINEGSSSQRESKIKESNPVSQPAGWAGF  658



>ref|XP_003546865.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X1 [Glycine max]
 ref|XP_006598247.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X2 [Glycine max]
Length=660

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 7/94 (7%)
 Frame = -1

Query  532  WQAFADDGPKPFTTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATS  362
            W AF ++ P+   +    NT +S+R +N   N+ P    +   +WGFG+DSF+AVP+ + 
Sbjct  571  WHAFPEE-PQQQKSFSAENTSKSVRVKNGQQNKQPVALATDFDSWGFGSDSFSAVPAGSP  629

Query  361  QMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
             M    S    SQ FG+    NKS SQPAGWAGF
Sbjct  630  HMQRPSSAGTKSQAFGEA---NKSTSQPAGWAGF  660



>gb|KHG06229.1| putative serine/threonine-protein kinase [Gossypium arboreum]
Length=653

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 62/107 (58%), Gaps = 7/107 (7%)
 Frame = -1

Query  565  NHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTAS----AWGFG  398
            N  ++SP+   WQAF +D       P   +  +S+RTRN    N   + A+     WGFG
Sbjct  549  NWKTASPEAKPWQAFPEDAKPQQQQPLSKDNVQSVRTRNGHS-NMHAAQATFGMETWGFG  607

Query  397  TDSFTAVPSATSQ-MNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
             D+FTA P+A+SQ + ++ ++ ++SQR   K  ++   SQPAGWAGF
Sbjct  608  ADNFTAAPTASSQRLKSTINEGSSSQR-ESKIKESNPVSQPAGWAGF  653



>ref|XP_010257450.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X3 [Nelumbo nucifera]
Length=707

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 61/111 (55%), Gaps = 10/111 (9%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRT----RNNQPPNTQDSTASA  410
            QG+L  SS  PD   W+AF D+  KP  TPP S++PRS+RT    +N Q P+ +    + 
Sbjct  602  QGILASSSPIPDSKPWRAFFDE-TKP-QTPPKSSSPRSVRTTNGHQNKQAPSGRHGPET-  658

Query  409  WGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            W F  +SF   PS+T      +    N Q   D K V+ K AS PAGWAGF
Sbjct  659  WNFEPNSFKEFPSSTQV--TQYGQVLNFQLVADSKSVERKQASLPAGWAGF  707



>ref|XP_010257448.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X1 [Nelumbo nucifera]
Length=709

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 61/111 (55%), Gaps = 10/111 (9%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRT----RNNQPPNTQDSTASA  410
            QG+L  SS  PD   W+AF D+  KP  TPP S++PRS+RT    +N Q P+ +    + 
Sbjct  604  QGILASSSPIPDSKPWRAFFDE-TKP-QTPPKSSSPRSVRTTNGHQNKQAPSGRHGPET-  660

Query  409  WGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            W F  +SF   PS+T      +    N Q   D K V+ K AS PAGWAGF
Sbjct  661  WNFEPNSFKEFPSSTQV--TQYGQVLNFQLVADSKSVERKQASLPAGWAGF  709



>ref|XP_010257449.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X2 [Nelumbo nucifera]
Length=708

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 61/111 (55%), Gaps = 10/111 (9%)
 Frame = -1

Query  577  QGLLNHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRT----RNNQPPNTQDSTASA  410
            QG+L  SS  PD   W+AF D+  KP  TPP S++PRS+RT    +N Q P+ +    + 
Sbjct  603  QGILASSSPIPDSKPWRAFFDE-TKP-QTPPKSSSPRSVRTTNGHQNKQAPSGRHGPET-  659

Query  409  WGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            W F  +SF   PS+T      +    N Q   D K V+ K AS PAGWAGF
Sbjct  660  WNFEPNSFKEFPSSTQV--TQYGQVLNFQLVADSKSVERKQASLPAGWAGF  708



>ref|XP_010913910.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Elaeis guineensis]
Length=702

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 53/105 (50%), Gaps = 11/105 (10%)
 Frame = -1

Query  550  SPDPSAWQAFADDGPKPFTTPPPSNTPRSMRT-------RNNQPPNTQDSTASAWGFGTD  392
            SPDP  WQ FA++      + P    PRS+RT       R++    T  S    WGF  D
Sbjct  601  SPDPKPWQPFAEESK--VQSTPKGIHPRSVRTVRAANGSRDDTKQTTTYSANEPWGFDDD  658

Query  391  SFTAVPSATSQMNASFSDRNNSQRFGDKRVDNKSA-SQPAGWAGF  260
            SF A+PS +     S    N+SQRFG      K+  SQPAGWAGF
Sbjct  659  SFKAIPSGSGVSGTSVQG-NSSQRFGGGGETKKAETSQPAGWAGF  702



>emb|CDX79504.1| BnaC03g18400D [Brassica napus]
Length=607

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (59%), Gaps = 4/102 (4%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTA  380
            S+ S DP++WQ F+D+ PKP     PS + R+     +  P         WGF T+SF A
Sbjct  508  STGSSDPNSWQPFSDE-PKP-VLETPSKSVRTKSKPASSAPAPASQGFEPWGFETESFRA  565

Query  379  VPSATSQMN-ASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
              ++++     S S  N+SQRFG+ ++ DN+ A+QPAGWAGF
Sbjct  566  AATSSASATPKSVSSGNSSQRFGNTKMRDNQKAAQPAGWAGF  607



>ref|XP_010509956.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
 ref|XP_010509957.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
Length=673

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 57/110 (52%), Gaps = 10/110 (9%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPPSNTP---RSMRTRNNQPPNTQDSTASAWGFGTDS  389
            S+ S DP++WQ F+DD      +    N+    +S+RT++            AWGF T+S
Sbjct  564  STGSSDPNSWQPFSDDAKPVLESASKGNSNTSNQSVRTKSKPASAAGTQGFEAWGFETES  623

Query  388  FTA-----VPSATSQMNASFSDRNNSQRFGDKRV--DNKSASQPAGWAGF  260
            F A     V ++TS    S    N SQR+G  +   +N+  +QPAGWAGF
Sbjct  624  FRAATPSSVATSTSATQRSMGSGNTSQRYGSTKAMRENQKTAQPAGWAGF  673



>ref|XP_006293803.1| hypothetical protein CARUB_v10022785mg [Capsella rubella]
 gb|EOA26701.1| hypothetical protein CARUB_v10022785mg [Capsella rubella]
Length=672

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 61/110 (55%), Gaps = 11/110 (10%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPP---SNTP-RSMRTRNNQPPNTQDSTASAWGFGTD  392
            S+ S DP++WQ F+D G KP         SNT  +S+RTR+            AWGF T+
Sbjct  564  STGSSDPNSWQPFSD-GVKPVLESASKGNSNTMNQSVRTRSKPASAAGTQGFDAWGFETE  622

Query  391  SFTAV---PSATSQ--MNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            SF A    P+ATS      S    N++QR+G  ++ DN+  +QPAGWAGF
Sbjct  623  SFRAATPSPAATSASATQRSMGSGNSAQRYGSSKMRDNQKTAQPAGWAGF  672



>ref|XP_004513162.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X1 [Cicer arietinum]
 ref|XP_004513163.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X2 [Cicer arietinum]
 ref|XP_004513164.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X3 [Cicer arietinum]
 ref|XP_004513165.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X4 [Cicer arietinum]
 ref|XP_004513166.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X5 [Cicer arietinum]
 ref|XP_004513167.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X6 [Cicer arietinum]
 ref|XP_004513168.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X7 [Cicer arietinum]
 ref|XP_004513169.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X8 [Cicer arietinum]
Length=681

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 59/101 (58%), Gaps = 10/101 (10%)
 Frame = -1

Query  544  DPSAWQAFADD--GPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTAS---AWGFGTDSFTA  380
            +P +WQAF +D  G K  +     N  +S+R+RN Q        AS   +WGFGTD+F+A
Sbjct  585  EPKSWQAFPEDAEGVKSLSA---DNAFKSVRSRNGQQNMQATQPASDFDSWGFGTDTFSA  641

Query  379  VPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            V + + QM     + + +  FG+ K  ++KS +QPAGWAGF
Sbjct  642  VHAGSPQMPRP-GEGSKAHVFGEAKAFESKSNTQPAGWAGF  681



>emb|CAN65496.1| hypothetical protein VITISV_028322 [Vitis vinifera]
Length=1137

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 42/76 (55%), Gaps = 8/76 (11%)
 Frame = -1

Query  484   PSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-K  308
             P    +  R R N  P T       WGFGT+SF A P+A+S ++      NN+Q F D K
Sbjct  1069  PKWPSQQTRHRRNFCPET-------WGFGTESFRATPAASSNISRPSIGGNNAQLFVDSK  1121

Query  307   RVDNKSASQPAGWAGF  260
             +++ K A+QP  WAGF
Sbjct  1122  KIEGKLATQPTEWAGF  1137



>ref|XP_010469538.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Camelina sativa]
Length=672

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 61/109 (56%), Gaps = 9/109 (8%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPPSN---TPRSMRTRNNQPPNTQDSTASAWGFGTDS  389
            S+ S DP++WQ F+DD      +    N   + +S+RTR+            AWGF T+S
Sbjct  564  STGSSDPNSWQPFSDDAKPVLESASKGNNSTSNQSVRTRSKPASGAGTQGFEAWGFETES  623

Query  388  FTAVPSATSQMNASFSDR-----NNSQRFGDKRV-DNKSASQPAGWAGF  260
            F A   +++  +AS + R     N SQR+G  ++ +N+ A+QPAGWAGF
Sbjct  624  FRAATPSSAATSASATQRNMGTGNTSQRYGSTKMRENQKAAQPAGWAGF  672



>ref|XP_009132906.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Brassica rapa]
Length=612

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSF-T  383
            S+ S DP++WQ F+D+ PKP     PS + R+     +  P         WGF T+SF  
Sbjct  513  STGSSDPNSWQPFSDE-PKP-VLESPSKSVRTKSKPASSAPAPASQGFEPWGFETESFRA  570

Query  382  AVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            A  S+ S    S S  N+SQRFG+ ++ +N+ A+QPAGWAGF
Sbjct  571  AATSSASATQRSASSGNSSQRFGNTKMRENQKAAQPAGWAGF  612



>emb|CDX84704.1| BnaA03g15260D [Brassica napus]
Length=612

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSF-T  383
            S+ S DP++WQ F+D+ PKP     PS + R+     +  P         WGF T+SF  
Sbjct  513  STGSSDPNSWQPFSDE-PKP-VLESPSKSVRTKSKPASSAPAPASQGFEPWGFETESFRA  570

Query  382  AVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            A  S+ S    S S  N+SQRFG+ ++ +N+ A+QPAGWAGF
Sbjct  571  AATSSASATQRSASSGNSSQRFGNTKMRENQKAAQPAGWAGF  612



>ref|XP_010413940.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
Length=671

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 57/108 (53%), Gaps = 8/108 (7%)
 Frame = -1

Query  559  SSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTA--SAWGFGTDSF  386
            S+ S DP++WQ F+DD      +    N   +   R    P +   T    AWGF T+SF
Sbjct  564  STGSSDPNSWQPFSDDAKPVLESASKGNNTSNQSVRTKSKPASAAGTQGFEAWGFETESF  623

Query  385  TAVPSATSQMNASFSDR-----NNSQRFGDKRV-DNKSASQPAGWAGF  260
             A   +++  +AS + R     N SQR+G  ++ +N+  +QPAGWAGF
Sbjct  624  RAATPSSAATSASATQRSMGSGNTSQRYGSTKMRENQKTAQPAGWAGF  671



>ref|XP_008808088.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
 ref|XP_008808089.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
Length=698

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 60/115 (52%), Gaps = 22/115 (19%)
 Frame = -1

Query  577  QGLLNHSSSSP--DPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTAS---  413
            QG+L +SS SP  +P  WQAF+ +         P    R+  T N     T+ S A+   
Sbjct  597  QGMLANSSPSPSQEPKPWQAFSGE---------PKAQSRAAGTTNGHQNLTKQSAAAPSS  647

Query  412  -AWGFGTDSFTAVPSATSQMNASFSDRNNSQRF---GDKRVDNKSASQPAGWAGF  260
              WGF  +SFTA P   +Q++ + +  N SQR    G K+V+    SQP+GWAGF
Sbjct  648  DVWGFNLESFTAAPFG-AQVSRTSAQANTSQRLSGGGTKKVET---SQPSGWAGF  698



>ref|XP_006850020.1| hypothetical protein AMTR_s00022p00186280 [Amborella trichopoda]
 gb|ERN11601.1| hypothetical protein AMTR_s00022p00186280 [Amborella trichopoda]
Length=706

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 55/117 (47%), Gaps = 18/117 (15%)
 Frame = -1

Query  565  NHSSSSPDPSAWQAFADDGPKPFTTPPPSN--TPRSMRTRNNQPPNTQD-----STASAW  407
            N S+ SPD   WQAF D   K    PPPS    P+   TR      T+      S+A AW
Sbjct  593  NTSNISPDSKPWQAFTDTPAK--IQPPPSKNSNPKQTSTRPTNGHQTKQTASLYSSADAW  650

Query  406  GFGTDSFTAVPSATSQMNASFSDRNNSQRFG--------DKRVDNKSASQPAGWAGF  260
            GFG D F A       +  + +  + SQRF          K +D+ S +QPAGWAGF
Sbjct  651  GFGQDGFVAANKDGPHITKTSTQASISQRFAPPNPHIAQPKSMDD-SRTQPAGWAGF  706



>ref|XP_010542987.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542988.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542989.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
Length=633

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 48/101 (48%), Gaps = 21/101 (21%)
 Frame = -1

Query  541  PSAWQAFADDGPKP-FTTPPPSNTP---RSMRTRNNQPPNTQDSTASAWGFGTDSF---T  383
            P AW+AF+D+ PKP   T    N     +S+ TRN+QP  T       WGF TDSF   T
Sbjct  547  PKAWKAFSDE-PKPGLQTASKGNNISNNQSVITRNSQPSKTASQGFDPWGFETDSFRAAT  605

Query  382  AVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
             + S+ S M       NN             A QPAGWAGF
Sbjct  606  TLSSSASAMQRPLGSDNN-------------APQPAGWAGF  633



>ref|XP_010542991.1| PREDICTED: AP2-associated protein kinase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=632

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 48/101 (48%), Gaps = 21/101 (21%)
 Frame = -1

Query  541  PSAWQAFADDGPKP-FTTPPPSNTP---RSMRTRNNQPPNTQDSTASAWGFGTDSF---T  383
            P AW+AF+D+ PKP   T    N     +S+ TRN+QP  T       WGF TDSF   T
Sbjct  546  PKAWKAFSDE-PKPGLQTASKGNNISNNQSVITRNSQPSKTASQGFDPWGFETDSFRAAT  604

Query  382  AVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
             + S+ S M       NN             A QPAGWAGF
Sbjct  605  TLSSSASAMQRPLGSDNN-------------APQPAGWAGF  632



>ref|XP_006410418.1| hypothetical protein EUTSA_v10016354mg [Eutrema salsugineum]
 gb|ESQ51871.1| hypothetical protein EUTSA_v10016354mg [Eutrema salsugineum]
Length=674

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 66/115 (57%), Gaps = 14/115 (12%)
 Frame = -1

Query  565  NHSSSSPDPSAWQAFADDGPKPF---TTPPPSNT-PRSMRTRNNQPPNTQDSTASA---W  407
            N S+ S DP++WQ F+D+ PKP     +   +NT  +S+RT++    +     +     W
Sbjct  561  NWSTGSSDPNSWQPFSDE-PKPVLESVSKGNNNTFNQSVRTKSKPASSAPAPASQGTEPW  619

Query  406  GFGTDSF-----TAVPSATSQMNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            GF T+SF     ++  ++ S    S S  N +QRFG+ ++ DN+ A+QPAGWAGF
Sbjct  620  GFETESFRAAATSSASASASSTQRSVSSGNTAQRFGNSKMRDNQKAAQPAGWAGF  674



>ref|XP_009394517.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009394519.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009394520.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
Length=704

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 54/112 (48%), Gaps = 14/112 (13%)
 Frame = -1

Query  565  NHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRT-------RNNQPPNTQDSTASAW  407
            N S+ SPDP  W AF D         P S+ P+S+RT       RNN    +  S    W
Sbjct  597  NPSTPSPDPKPWSAFGDTM---VQDTPKSSHPKSVRTIRGTNSNRNNIKQPSASSADEPW  653

Query  406  GFGTDSFTAVPSATSQMNASFSDRNNSQRFGD---KRVDNKSASQPAGWAGF  260
            GF  DSF A  S +SQ+     + N SQRFG     +V     ++P+GW GF
Sbjct  654  GFNQDSFRA-DSHSSQVPKPSFEGNTSQRFGGGGPGKVKAVETNRPSGWTGF  704



>ref|XP_002881248.1| hypothetical protein ARALYDRAFT_482227 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57507.1| hypothetical protein ARALYDRAFT_482227 [Arabidopsis lyrata subsp. 
lyrata]
Length=660

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 9/111 (8%)
 Frame = -1

Query  565  NHSSSSPDPSAWQAFADDGPKPFTTPPPSN---TPRSMRTRNNQPPNTQDSTASAWGFGT  395
            N S+ S D ++WQ F+D+      +    N     +S+RTR+            AWGF T
Sbjct  550  NWSTGSSDTNSWQPFSDEAKPVMESASKGNNNTINQSVRTRSKPASAAGTQGFEAWGFET  609

Query  394  DSFTAVPSATSQMNASF-----SDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            +SF A  ++++   ++      S  N SQR+G+ ++ DN+  +QPAGWAGF
Sbjct  610  ESFRAAATSSATTASATQRSMGSGNNTSQRYGNSKMRDNQKTAQPAGWAGF  660



>ref|NP_001159134.1| uncharacterized protein LOC100304212 [Zea mays]
 gb|ACN25170.1| unknown [Zea mays]
Length=163

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 57/111 (51%), Gaps = 12/111 (11%)
 Frame = -1

Query  577  QGLL--NHSSSSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQPPNTQDSTASAWG  404
            QG+L  N SS+S D   WQAF    P   T   P     +  ++N     T  ++  AWG
Sbjct  60   QGMLASNTSSASSDVKTWQAF----PDTQTQARPKVDHGTNGSQNITKNTTSGASPDAWG  115

Query  403  FGTDSF---TAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
            FGTDSF   +A   A +Q+N + +  ++SQRF       K   QP+GWAGF
Sbjct  116  FGTDSFRTSSAPVKAATQINRA-AQGSSSQRFNSGVA--KKVEQPSGWAGF  163



>gb|KEH33173.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=678

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 60/104 (58%), Gaps = 8/104 (8%)
 Frame = -1

Query  553  SSPDPSAWQAFADDGPKPFTTPPPSNTPRSMRTRNNQ--PPNTQ-DSTASAWGFGTDSFT  383
            SS   S+WQ F+++  +PF +    N  +S+R+RN Q   P TQ  +   +WGFG D+F+
Sbjct  577  SSEPKSSWQPFSEES-EPFKSLSADNASKSVRSRNGQQSKPATQPAADFDSWGFGADTFS  635

Query  382  AVP--SATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
            A    S + QM     + + +  F + K  ++KS SQPAGWAGF
Sbjct  636  AARAGSGSPQMPRP-GEGSTAHVFREAKGFESKSTSQPAGWAGF  678



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985