BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF045I24

Length=653
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI14966.3|  unnamed protein product                              89.4    9e-19   Vitis vinifera
ref|XP_004236255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  94.4    1e-18   Solanum lycopersicum
ref|XP_006344459.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  94.4    1e-18   Solanum tuberosum [potatoes]
ref|XP_011071940.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  94.0    2e-18   Sesamum indicum [beniseed]
ref|XP_011071939.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  94.0    2e-18   Sesamum indicum [beniseed]
ref|XP_006439905.1|  hypothetical protein CICLE_v10019394mg           91.7    2e-18   
gb|KDO69502.1|  hypothetical protein CISIN_1g013176mg                 90.9    8e-18   Citrus sinensis [apfelsine]
ref|XP_009594348.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  92.0    1e-17   Nicotiana tomentosiformis
ref|XP_009769444.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  91.7    1e-17   Nicotiana sylvestris
ref|XP_006439909.1|  hypothetical protein CICLE_v10019394mg           90.9    2e-17   Citrus clementina [clementine]
ref|XP_006476870.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  90.1    3e-17   Citrus sinensis [apfelsine]
emb|CDY48128.1|  BnaCnng15700D                                        90.1    3e-17   Brassica napus [oilseed rape]
ref|XP_009112063.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  90.1    3e-17   Brassica rapa
emb|CDY16735.1|  BnaA09g06470D                                        90.1    3e-17   Brassica napus [oilseed rape]
gb|KFK25761.1|  hypothetical protein AALP_AA8G156100                  90.1    4e-17   Arabis alpina [alpine rockcress]
ref|XP_006394312.1|  hypothetical protein EUTSA_v10003871mg           90.1    4e-17   Eutrema salsugineum [saltwater cress]
gb|AFW97645.1|  cold responsive DEAD-box RNA helicase                 89.7    4e-17   Chorispora bungeana
emb|CDP12744.1|  unnamed protein product                              89.4    6e-17   Coffea canephora [robusta coffee]
ref|XP_010678860.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  89.0    8e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011046220.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  89.0    9e-17   Populus euphratica
ref|XP_008239580.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  89.0    9e-17   Prunus mume [ume]
ref|XP_007210287.1|  hypothetical protein PRUPE_ppa002741mg           89.0    9e-17   Prunus persica
dbj|BAB10554.1|  ATP-dependent RNA helicase-like protein              88.6    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974985.1|  DEAD-box ATP-dependent RNA helicase 30              88.6    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010102487.1|  DEAD-box ATP-dependent RNA helicase 20           88.2    2e-16   Morus notabilis
ref|XP_010484038.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  87.8    2e-16   Camelina sativa [gold-of-pleasure]
gb|KDP31038.1|  hypothetical protein JCGZ_11414                       88.2    2e-16   Jatropha curcas
ref|XP_010444189.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  87.8    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010459851.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  87.8    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002866536.1|  hypothetical protein ARALYDRAFT_496494           87.8    2e-16   
ref|XP_002322195.2|  hypothetical protein POPTR_0015s09460g           87.4    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002318665.2|  ethylene-responsive DEAD box RNA helicase fa...  87.0    3e-16   
ref|XP_011047813.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  87.4    3e-16   Populus euphratica
ref|XP_007155472.1|  hypothetical protein PHAVU_003G204200g           87.0    4e-16   Phaseolus vulgaris [French bean]
emb|CAN78903.1|  hypothetical protein VITISV_026451                   87.4    4e-16   Vitis vinifera
ref|XP_010663104.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  87.4    4e-16   Vitis vinifera
gb|KHG00891.1|  DEAD-box ATP-dependent RNA helicase 30                81.6    5e-16   Gossypium arboreum [tree cotton]
ref|XP_006280218.1|  hypothetical protein CARUB_v10026128mg           86.3    7e-16   Capsella rubella
ref|XP_010550696.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  85.5    1e-15   Tarenaya hassleriana [spider flower]
gb|KGN63543.1|  hypothetical protein Csa_1G004090                     80.5    2e-15   Cucumis sativus [cucumbers]
gb|KHN34349.1|  DEAD-box ATP-dependent RNA helicase 30                84.3    2e-15   Glycine soja [wild soybean]
ref|XP_004299135.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  84.7    2e-15   Fragaria vesca subsp. vesca
ref|XP_006579582.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  84.7    3e-15   
gb|KHN18420.1|  DEAD-box ATP-dependent RNA helicase 30                84.0    3e-15   Glycine soja [wild soybean]
ref|XP_008365657.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  84.0    4e-15   
ref|XP_003549600.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  83.6    5e-15   Glycine max [soybeans]
ref|XP_007036326.1|  P-loop containing nucleoside triphosphate hy...  83.6    6e-15   
ref|NP_001172705.1|  Os01g0911100                                     78.2    8e-15   
ref|XP_006845267.1|  hypothetical protein AMTR_s00005p00263980        82.8    1e-14   Amborella trichopoda
ref|XP_009345779.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  81.6    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_009363040.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  81.6    3e-14   Pyrus x bretschneideri [bai li]
ref|XP_010932245.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  81.6    3e-14   Elaeis guineensis
ref|XP_010251083.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  81.6    3e-14   Nelumbo nucifera [Indian lotus]
ref|XP_008807455.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  81.3    4e-14   Phoenix dactylifera
tpg|DAA56213.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...  80.5    5e-14   
ref|XP_006646592.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.5    5e-14   
ref|NP_001105241.1|  DEAD box RNA helicase1                           80.5    5e-14   
ref|XP_004138092.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.5    6e-14   Cucumis sativus [cucumbers]
ref|XP_008464517.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.5    6e-14   Cucumis melo [Oriental melon]
gb|EMT04443.1|  DEAD-box ATP-dependent RNA helicase 30                77.0    9e-14   
gb|KEH31793.1|  DEAD-box ATP-dependent RNA helicase-like protein      79.7    1e-13   Medicago truncatula
gb|KJB40103.1|  hypothetical protein B456_007G047000                  79.3    1e-13   Gossypium raimondii
ref|XP_004515873.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.3    1e-13   Cicer arietinum [garbanzo]
ref|XP_010027294.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.6    2e-13   Eucalyptus grandis [rose gum]
gb|EYU22173.1|  hypothetical protein MIMGU_mgv1a003417mg              78.6    3e-13   Erythranthe guttata [common monkey flower]
ref|XP_004971011.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.6    3e-13   Setaria italica
ref|XP_004971010.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.6    3e-13   
ref|XP_002458964.1|  hypothetical protein SORBIDRAFT_03g043450        78.2    3e-13   Sorghum bicolor [broomcorn]
gb|EMS66298.1|  DEAD-box ATP-dependent RNA helicase 30                77.8    5e-13   Triticum urartu
emb|CDM85602.1|  unnamed protein product                              77.4    6e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003564892.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  76.6    1e-12   Brachypodium distachyon [annual false brome]
dbj|BAD82427.1|  putative DEAD box RNA helicase                       76.3    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009412685.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  76.3    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN39916.1|  unknown                                               75.9    2e-12   Picea sitchensis
ref|XP_006385358.1|  DEAD box RNA helicase family protein             74.7    4e-12   
sp|Q5N7W4.2|RH30_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...  74.3    8e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011000790.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  73.9    8e-12   Populus euphratica
gb|ABR16327.1|  unknown                                               73.6    9e-12   Picea sitchensis
ref|XP_009336746.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  69.7    1e-11   Pyrus x bretschneideri [bai li]
gb|AAG51573.1|AC027034_19  RNA helicase, 5' partial; 101954-101280    70.1    1e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAA09209.1|  RNA helicase                                         69.7    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EPS60527.1|  hypothetical protein M569_14276                       70.1    2e-11   Genlisea aurea
ref|XP_006392683.1|  hypothetical protein EUTSA_v10011413mg           71.6    4e-11   Eutrema salsugineum [saltwater cress]
ref|XP_006392681.1|  hypothetical protein EUTSA_v10011413mg           71.2    4e-11   Eutrema salsugineum [saltwater cress]
ref|XP_004486821.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.9    7e-11   Cicer arietinum [garbanzo]
ref|XP_010542432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.9    8e-11   Tarenaya hassleriana [spider flower]
ref|XP_006426523.1|  hypothetical protein CICLE_v10025421mg           70.5    9e-11   
gb|KDO65284.1|  hypothetical protein CISIN_1g010649mg                 70.5    9e-11   Citrus sinensis [apfelsine]
ref|XP_004486820.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.5    1e-10   
ref|XP_002527412.1|  dead box ATP-dependent RNA helicase, putative    70.5    1e-10   Ricinus communis
gb|KDO65287.1|  hypothetical protein CISIN_1g010649mg                 70.1    1e-10   Citrus sinensis [apfelsine]
ref|XP_006426525.1|  hypothetical protein CICLE_v10025421mg           70.5    1e-10   Citrus clementina [clementine]
ref|XP_006466041.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.1    1e-10   Citrus sinensis [apfelsine]
ref|XP_006466042.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.1    1e-10   Citrus sinensis [apfelsine]
ref|XP_006426524.1|  hypothetical protein CICLE_v10025421mg           70.1    1e-10   Citrus clementina [clementine]
ref|XP_006426526.1|  hypothetical protein CICLE_v10025421mg           70.1    1e-10   
gb|KDP40778.1|  hypothetical protein JCGZ_24777                       70.1    1e-10   Jatropha curcas
gb|KHG24204.1|  DEAD-box ATP-dependent RNA helicase 20 -like protein  70.1    1e-10   Gossypium arboreum [tree cotton]
ref|XP_010262147.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.1    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010242202.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.1    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010262145.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.1    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010262146.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.1    1e-10   Nelumbo nucifera [Indian lotus]
gb|KDO65286.1|  hypothetical protein CISIN_1g010649mg                 70.1    1e-10   Citrus sinensis [apfelsine]
gb|KHN39300.1|  DEAD-box ATP-dependent RNA helicase 20                69.7    1e-10   Glycine soja [wild soybean]
ref|XP_006583016.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.1    1e-10   Glycine max [soybeans]
ref|XP_003529884.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.1    1e-10   Glycine max [soybeans]
gb|KJB56888.1|  hypothetical protein B456_009G140700                  70.1    1e-10   Gossypium raimondii
ref|XP_006858286.1|  hypothetical protein AMTR_s00064p00050700        70.1    1e-10   Amborella trichopoda
ref|XP_002279117.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.1    1e-10   Vitis vinifera
ref|XP_010686087.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  69.7    2e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB56890.1|  hypothetical protein B456_009G140700                  69.7    2e-10   Gossypium raimondii
ref|XP_007135556.1|  hypothetical protein PHAVU_010G139400g           69.7    2e-10   Phaseolus vulgaris [French bean]
ref|XP_008447604.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  69.7    2e-10   Cucumis melo [Oriental melon]
gb|KJB70270.1|  hypothetical protein B456_011G066000                  69.7    2e-10   Gossypium raimondii
ref|XP_004146825.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  69.7    2e-10   Cucumis sativus [cucumbers]
gb|KHF98903.1|  DEAD-box ATP-dependent RNA helicase 20 -like protein  69.7    2e-10   Gossypium arboreum [tree cotton]
ref|XP_003531619.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  69.3    2e-10   Glycine max [soybeans]
gb|KCW53605.1|  hypothetical protein EUGRSUZ_J028691                  69.3    2e-10   Eucalyptus grandis [rose gum]
ref|XP_007024450.1|  DEA(D/H)-box RNA helicase family protein         69.3    2e-10   
ref|NP_175911.1|  DEAD-box ATP-dependent RNA helicase 20              69.3    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010033787.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  69.3    3e-10   Eucalyptus grandis [rose gum]
ref|XP_008228305.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  69.3    3e-10   Prunus mume [ume]
ref|XP_008228303.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    3e-10   Prunus mume [ume]
ref|XP_010501121.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_007215261.1|  hypothetical protein PRUPE_ppa004545mg           68.9    3e-10   Prunus persica
ref|XP_008805785.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    3e-10   Phoenix dactylifera
ref|XP_008805786.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    3e-10   Phoenix dactylifera
ref|XP_009367550.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_008391321.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    4e-10   Malus domestica [apple tree]
ref|XP_010480028.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.6    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010480030.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.6    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010106662.1|  DEAD-box ATP-dependent RNA helicase 20           68.2    5e-10   
ref|XP_010462358.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.2    5e-10   Camelina sativa [gold-of-pleasure]
emb|CDO97919.1|  unnamed protein product                              68.2    5e-10   Coffea canephora [robusta coffee]
ref|XP_010462359.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.2    6e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009380443.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.2    6e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004297601.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.8    6e-10   Fragaria vesca subsp. vesca
ref|XP_004968530.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.8    8e-10   Setaria italica
ref|NP_001142117.1|  uncharacterized protein LOC100274281             67.8    8e-10   Zea mays [maize]
ref|XP_003597619.1|  DEAD-box ATP-dependent RNA helicase              67.4    1e-09   Medicago truncatula
ref|XP_002891814.1|  hypothetical protein ARALYDRAFT_474570           67.4    1e-09   
gb|AFK42127.1|  unknown                                               67.4    1e-09   Medicago truncatula
ref|XP_004968529.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.4    1e-09   
ref|NP_001234650.1|  ethylene-responsive RNA helicase                 67.0    1e-09   
ref|XP_010314157.1|  PREDICTED: ethylene-responsive RNA helicase ...  67.0    1e-09   
ref|XP_011072507.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.0    1e-09   Sesamum indicum [beniseed]
ref|XP_006366150.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.0    1e-09   Solanum tuberosum [potatoes]
ref|XP_006645603.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  66.6    1e-09   Oryza brachyantha
ref|XP_008673096.1|  PREDICTED: putative DEAD-box ATP-dependent R...  67.0    2e-09   
gb|EEC70110.1|  hypothetical protein OsI_00766                        66.6    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_009625322.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  66.6    2e-09   Nicotiana tomentosiformis
ref|XP_009802114.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  66.6    2e-09   Nicotiana sylvestris
gb|EEE54050.1|  hypothetical protein OsJ_00740                        66.6    2e-09   Oryza sativa Japonica Group [Japonica rice]
sp|Q5QMN3.2|RH20_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...  66.6    2e-09   Oryza sativa Japonica Group [Japonica rice]
gb|KCW55996.1|  hypothetical protein EUGRSUZ_I01775                   64.7    2e-09   Eucalyptus grandis [rose gum]
emb|CDY02459.1|  BnaA08g00660D                                        66.2    2e-09   
ref|XP_009106904.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  66.2    2e-09   Brassica rapa
ref|XP_011011886.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  66.6    3e-09   Populus euphratica
ref|XP_001763089.1|  predicted protein                                66.2    3e-09   
gb|KCW55995.1|  hypothetical protein EUGRSUZ_I01775                   64.7    3e-09   Eucalyptus grandis [rose gum]
ref|XP_010915213.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.9    3e-09   Elaeis guineensis
emb|CDY10596.1|  BnaC03g70180D                                        65.9    3e-09   Brassica napus [oilseed rape]
ref|XP_006306418.1|  hypothetical protein CARUB_v10012355mg           65.5    4e-09   Capsella rubella
gb|KCW55992.1|  hypothetical protein EUGRSUZ_I01775                   64.7    4e-09   Eucalyptus grandis [rose gum]
gb|KIP10983.1|  hypothetical protein PHLGIDRAFT_171911                61.6    5e-09   Phlebiopsis gigantea 11061_1 CR5-6
gb|KFK38698.1|  hypothetical protein AALP_AA3G148400                  65.1    5e-09   Arabis alpina [alpine rockcress]
gb|KCW55994.1|  hypothetical protein EUGRSUZ_I01775                   64.7    5e-09   Eucalyptus grandis [rose gum]
emb|CDM81540.1|  unnamed protein product                              65.1    6e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003564953.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  64.7    6e-09   Brachypodium distachyon [annual false brome]
ref|XP_002324002.1|  hypothetical protein POPTR_0017s10760g           65.1    7e-09   
ref|NP_001168054.1|  putative DEAD-box ATP-dependent RNA helicase...  64.7    8e-09   Zea mays [maize]
gb|EPB85904.1|  hypothetical protein HMPREF1544_07320                 64.7    8e-09   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002970463.1|  hypothetical protein SELMODRAFT_441099           65.1    8e-09   
ref|XP_003032253.1|  hypothetical protein SCHCODRAFT_82297            64.7    8e-09   Schizophyllum commune H4-8
emb|CDO77180.1|  hypothetical protein BN946_scf184705.g5              61.2    9e-09   Trametes cinnabarina
ref|XP_008654141.1|  PREDICTED: ATP-dependent RNA helicase-like p...  61.2    9e-09   Zea mays [maize]
dbj|GAN02653.1|  ATP-dependent RNA helicase dbp-2                     64.7    1e-08   Mucor ambiguus
gb|KHN25107.1|  DEAD-box ATP-dependent RNA helicase 20                63.9    1e-08   Glycine soja [wild soybean]
ref|XP_006675622.1|  hypothetical protein BATDEDRAFT_29115            63.9    1e-08   Batrachochytrium dendrobatidis JAM81
gb|EYU21378.1|  hypothetical protein MIMGU_mgv1a004869mg              63.5    2e-08   Erythranthe guttata [common monkey flower]
ref|XP_001771533.1|  predicted protein                                63.9    2e-08   
ref|XP_004304637.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.5    2e-08   Fragaria vesca subsp. vesca
ref|XP_010534902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.5    2e-08   Tarenaya hassleriana [spider flower]
ref|XP_010534903.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.2    2e-08   Tarenaya hassleriana [spider flower]
ref|XP_004968358.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.5    2e-08   
ref|XP_002987999.1|  hypothetical protein SELMODRAFT_269342           63.2    2e-08   
ref|XP_002972931.1|  hypothetical protein SELMODRAFT_98552            63.2    2e-08   
ref|XP_006840690.1|  hypothetical protein AMTR_s00096p00079870        63.5    2e-08   
ref|XP_005710055.1|  ATP-dependent RNA helicase DBP2, putative        63.2    2e-08   Chondrus crispus [carageen]
gb|EXX56938.1|  Dbp2p                                                 63.2    2e-08   Rhizophagus irregularis DAOM 197198w
ref|XP_004968355.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.2    2e-08   Setaria italica
ref|XP_010550155.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.2    3e-08   Tarenaya hassleriana [spider flower]
gb|KIM40445.1|  hypothetical protein M413DRAFT_73199                  63.2    3e-08   Hebeloma cylindrosporum h7
ref|XP_004968357.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.2    3e-08   Setaria italica
ref|XP_010029150.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  63.2    3e-08   Eucalyptus grandis [rose gum]
ref|XP_004968356.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.2    3e-08   
ref|XP_005850349.1|  hypothetical protein CHLNCDRAFT_30080            63.2    3e-08   Chlorella variabilis
emb|CDS08010.1|  hypothetical protein LRAMOSA01959                    63.2    3e-08   Lichtheimia ramosa
ref|XP_008341438.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.2    3e-08   Malus domestica [apple tree]
gb|KIM84767.1|  hypothetical protein PILCRDRAFT_96565                 62.8    3e-08   Piloderma croceum F 1598
emb|CCM04686.1|  predicted protein                                    63.2    3e-08   Fibroporia radiculosa
ref|XP_004968354.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.2    3e-08   
ref|XP_008039863.1|  DEAD-domain-containing protein                   62.4    4e-08   Trametes versicolor FP-101664 SS1
ref|XP_736707.1|  helicase                                            59.7    4e-08   
gb|KII89609.1|  hypothetical protein PLICRDRAFT_158683                62.4    4e-08   Plicaturopsis crispa FD-325 SS-3
ref|XP_009375127.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.8    4e-08   Pyrus x bretschneideri [bai li]
emb|CBI34896.3|  unnamed protein product                              62.8    4e-08   Vitis vinifera
ref|XP_007330446.1|  hypothetical protein AGABI1DRAFT_100622          62.4    4e-08   Agaricus bisporus var. burnettii JB137-S8
ref|XP_006459201.1|  hypothetical protein AGABI2DRAFT_65810           62.4    4e-08   Agaricus bisporus var. bisporus H97
ref|XP_006958620.1|  p68 RNA helicase                                 62.4    5e-08   Wallemia mellicola CBS 633.66
ref|XP_008379232.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.4    5e-08   
ref|XP_009334108.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.4    5e-08   Pyrus x bretschneideri [bai li]
ref|XP_744215.1|  helicase                                            60.1    5e-08   
ref|XP_004164821.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.4    6e-08   
gb|KGN59687.1|  hypothetical protein Csa_3G838660                     62.4    6e-08   Cucumis sativus [cucumbers]
ref|XP_008439374.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.0    6e-08   
ref|XP_004141097.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  62.0    6e-08   
gb|KIK10334.1|  hypothetical protein K443DRAFT_146564                 60.1    7e-08   Laccaria amethystina LaAM-08-1
gb|KJA13443.1|  hypothetical protein HYPSUDRAFT_73013                 61.6    7e-08   Hypholoma sublateritium FD-334 SS-4
gb|KHN85192.1|  putative ATP-dependent RNA helicase DDX17             62.0    7e-08   Toxocara canis
ref|XP_008443543.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.0    7e-08   Cucumis melo [Oriental melon]
ref|XP_004159856.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  62.0    8e-08   
gb|KDP46436.1|  hypothetical protein JCGZ_10276                       61.6    9e-08   Jatropha curcas
ref|XP_007414813.1|  hypothetical protein MELLADRAFT_78893            61.6    9e-08   Melampsora larici-populina 98AG31
ref|XP_010524303.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.6    9e-08   Tarenaya hassleriana [spider flower]
ref|XP_010660890.1|  PREDICTED: ATP-dependent RNA helicase-like p...  61.6    9e-08   Vitis vinifera
ref|XP_002521446.1|  dead box ATP-dependent RNA helicase, putative    61.6    1e-07   Ricinus communis
gb|KDQ24573.1|  hypothetical protein PLEOSDRAFT_1090372               61.2    1e-07   Pleurotus ostreatus PC15
ref|XP_002273908.2|  PREDICTED: ATP-dependent RNA helicase-like p...  61.6    1e-07   Vitis vinifera
ref|XP_008439373.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.6    1e-07   
gb|KGN57060.1|  hypothetical protein Csa_3G151370                     61.6    1e-07   Cucumis sativus [cucumbers]
emb|CDR95325.1|  p68-like protein, putative                           61.2    1e-07   Babesia bigemina
ref|XP_004134467.1|  PREDICTED: uncharacterized protein LOC101206109  61.6    1e-07   
emb|CDI80731.1|  hypothetical protein, conserved                      59.3    1e-07   Eimeria acervulina
ref|XP_004349647.1|  ATPdependent RNA helicase dbp2, putative         61.2    1e-07   Acanthamoeba castellanii str. Neff
emb|CDI51261.1|  p68-like protein                                     58.2    1e-07   Melanopsichium pennsylvanicum 4
ref|XP_005705091.1|  DEAD-box family RNA-dependent helicase           58.5    1e-07   Galdieria sulphuraria
gb|KIZ00407.1|  ATP-dependent RNA helicase DDX5/DBP2                  61.2    1e-07   Monoraphidium neglectum
ref|XP_006408522.1|  hypothetical protein EUTSA_v10020294mg           61.2    1e-07   Eutrema salsugineum [saltwater cress]
ref|XP_006408521.1|  hypothetical protein EUTSA_v10020294mg           61.2    1e-07   
ref|XP_010248506.1|  PREDICTED: ATP-dependent RNA helicase-like p...  61.2    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_003618186.1|  DEAD-box ATP-dependent RNA helicase              60.8    1e-07   
dbj|BAF00715.1|  DRH1 DEAD box protein - like                         60.8    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_764197.1|  RNA helicase                                        60.8    1e-07   Theileria parva strain Muguga
gb|KIM24458.1|  hypothetical protein M408DRAFT_75932                  60.8    1e-07   Serendipita vermifera MAFF 305830
ref|XP_001690022.1|  DEAD-box RNA helicase                            60.8    1e-07   Chlamydomonas reinhardtii
tpg|DAA42421.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...  61.2    1e-07   
ref|NP_001190309.1|  DEAD-box ATP-dependent RNA helicase 46           60.8    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAY84883.1|  DEAD-box ATPase-RNA-helicase                          60.5    1e-07   Triticum aestivum [Canadian hard winter wheat]
emb|CDM81987.1|  unnamed protein product                              60.8    1e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011270510.1|  hypothetical protein CAOG_08856                  60.5    2e-07   Capsaspora owczarzaki ATCC 30864
gb|EPS60732.1|  hypothetical protein M569_14070                       60.8    2e-07   Genlisea aurea
ref|XP_008668268.1|  PREDICTED: uncharacterized protein LOC100381...  61.2    2e-07   
gb|KIK28896.1|  hypothetical protein PISMIDRAFT_90259                 60.8    2e-07   Pisolithus microcarpus 441
emb|CAH89939.1|  hypothetical protein                                 59.7    2e-07   Pongo abelii [orang utan]
gb|KHN23518.1|  DEAD-box ATP-dependent RNA helicase 46                60.8    2e-07   Glycine soja [wild soybean]
gb|AAN31934.1|  putative RNA helicase, DRH1                           60.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|EIE79143.1|  hypothetical protein RO3G_03848                       57.4    2e-07   Rhizopus delemar RA 99-880
gb|EYU34729.1|  hypothetical protein MIMGU_mgv1a002636mg              60.8    2e-07   Erythranthe guttata [common monkey flower]
ref|XP_009124816.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.8    2e-07   Brassica rapa
gb|EGN99017.1|  hypothetical protein SERLA73DRAFT_137127              60.1    2e-07   Serpula lacrymans var. lacrymans S7.3
ref|XP_008230577.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.8    2e-07   Prunus mume [ume]
ref|XP_007217002.1|  hypothetical protein PRUPE_ppa002303mg           60.8    2e-07   Prunus persica
ref|XP_007217003.1|  hypothetical protein PRUPE_ppa002303mg           60.8    2e-07   
ref|XP_009134609.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.5    2e-07   Brassica rapa
emb|CEJ03535.1|  Putative ATP-dependent RNA helicase dbp2 (Fragment)  58.2    2e-07   Rhizopus microsporus
ref|XP_003524550.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.8    2e-07   Glycine max [soybeans]
gb|KHN27447.1|  DEAD-box ATP-dependent RNA helicase 46                60.8    2e-07   Glycine soja [wild soybean]
ref|XP_006579766.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.8    2e-07   Glycine max [soybeans]
dbj|BAK00243.1|  predicted protein                                    60.5    2e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDH49080.1|  atp-dependent rna helicase dbp2                      60.5    2e-07   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_010420106.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.5    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010492272.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.5    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010420104.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.5    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010492271.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.5    2e-07   Camelina sativa [gold-of-pleasure]
gb|AAL32669.1|  RNA helicase, DRH1                                    60.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882175.1|  hypothetical protein ARALYDRAFT_477362           60.5    2e-07   
ref|XP_006287260.1|  hypothetical protein CARUB_v10000450mg           60.5    2e-07   
ref|NP_001082679.1|  DEAD (Asp-Glu-Ala-Asp) box helicase 17           60.5    2e-07   Xenopus laevis [clawed frog]
ref|NP_850492.1|  RNA helicase DRH1                                   60.5    2e-07   
ref|NP_690019.2|  probable ATP-dependent RNA helicase DDX17 isofo...  59.7    2e-07   
gb|KIK57769.1|  hypothetical protein GYMLUDRAFT_45959                 60.5    2e-07   
ref|XP_007318616.1|  hypothetical protein SERLADRAFT_449372           60.5    2e-07   
ref|NP_566141.1|  RNA helicase DRH1                                   60.5    2e-07   
dbj|BAD73320.1|  putative ethylene-responsive RNA helicase            60.5    2e-07   
ref|NP_001015018.1|  probable ATP-dependent RNA helicase DDX17        59.7    2e-07   
gb|EDM15799.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...  59.7    2e-07   
ref|NP_001016781.1|  DEAD (Asp-Glu-Ala-Asp) box helicase 17           60.5    2e-07   
ref|XP_011405456.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.5    2e-07   
ref|XP_006287261.1|  hypothetical protein CARUB_v10000450mg           60.5    2e-07   
gb|EJU04549.1|  DEAD-domain-containing protein                        60.1    2e-07   
ref|XP_007370735.1|  DEAD-domain-containing protein                   60.1    2e-07   
gb|AGE46032.1|  dead-box ATP-dependent RNA helicase                   59.7    2e-07   
ref|XP_678450.1|  helicase                                            58.2    2e-07   
gb|KIL67445.1|  hypothetical protein M378DRAFT_159266                 60.1    2e-07   
ref|XP_007151015.1|  hypothetical protein PHAVU_004G011600g           60.5    2e-07   
gb|KJE94426.1|  hypothetical protein CAOG_008856                      60.1    2e-07   
gb|EMS57490.1|  DEAD-box ATP-dependent RNA helicase 14                60.1    3e-07   
ref|XP_953213.1|  DEAD-box family RNA-dependent helicase              60.1    3e-07   
ref|XP_002502954.1|  predicted protein                                60.1    3e-07   
ref|XP_002455105.1|  hypothetical protein SORBIDRAFT_03g004420        60.1    3e-07   
ref|XP_006521353.1|  PREDICTED: probable ATP-dependent RNA helica...  59.7    3e-07   
ref|XP_001880766.1|  predicted protein                                60.1    3e-07   
gb|EMT04160.1|  DEAD-box ATP-dependent RNA helicase 14                60.1    3e-07   
ref|XP_002455005.1|  hypothetical protein SORBIDRAFT_03g002860        59.7    3e-07   
gb|EMS23120.1|  ATP-dependent rna helicase dbp2                       60.1    3e-07   
ref|NP_196965.2|  DEAD-box ATP-dependent RNA helicase 46              60.1    3e-07   
ref|XP_002871624.1|  ATP binding protein                              60.1    3e-07   
emb|CAB87628.1|  DRH1 DEAD box protein-like                           60.1    3e-07   
ref|XP_008776302.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.7    3e-07   
gb|KIJ66791.1|  hypothetical protein HYDPIDRAFT_180508                59.7    3e-07   
gb|KIR72047.1|  ATP-dependent RNA helicase DBP2-A                     59.7    3e-07   
gb|KGB75854.1|  ATP-dependent RNA helicase DBP2-A                     59.7    3e-07   
gb|KIR99876.1|  ATP-dependent RNA helicase DBP2-A                     59.7    3e-07   
ref|XP_011047343.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.7    4e-07   
gb|EUC64866.1|  ATP-dependent RNA helicase DBP2                       59.7    4e-07   
emb|CDR15320.1|  helicase, putative                                   59.7    4e-07   
ref|XP_003618185.1|  DEAD-box ATP-dependent RNA helicase              59.7    4e-07   
ref|XP_007008272.1|  hypothetical protein TREMEDRAFT_46029            59.7    4e-07   
gb|EMS68918.1|  DEAD-box ATP-dependent RNA helicase 40                59.7    4e-07   
ref|XP_010611222.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  59.3    4e-07   
ref|XP_010453591.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.7    4e-07   
emb|CDY28671.1|  BnaCnng05570D                                        59.7    4e-07   
ref|XP_010453589.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.7    4e-07   
ref|XP_010940176.1|  PREDICTED: ATP-dependent RNA helicase-like p...  59.7    4e-07   
ref|XP_001760431.1|  predicted protein                                59.7    4e-07   
gb|KJB33798.1|  hypothetical protein B456_006G031200                  59.7    4e-07   
ref|XP_729738.1|  hypothetical protein                                57.8    4e-07   
ref|XP_002300045.2|  hypothetical protein POPTR_0001s35150g           59.7    4e-07   
ref|XP_007342874.1|  DEAD-domain-containing protein                   59.3    4e-07   
ref|XP_010940175.1|  PREDICTED: ATP-dependent RNA helicase-like p...  59.7    4e-07   
ref|XP_004489252.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.3    4e-07   
emb|CDX91943.1|  BnaC03g32450D                                        59.3    5e-07   
gb|KIY52138.1|  DEAD-domain-containing protein                        59.3    5e-07   
ref|XP_010492273.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.3    5e-07   
ref|XP_008565102.1|  PREDICTED: probable ATP-dependent RNA helica...  59.3    5e-07   
gb|EDM15798.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...  59.3    5e-07   
dbj|BAJ94202.1|  predicted protein                                    59.3    5e-07   
gb|EMS55994.1|  DEAD-box ATP-dependent RNA helicase 20                58.9    5e-07   
ref|XP_010341891.1|  PREDICTED: probable ATP-dependent RNA helica...  59.3    5e-07   
ref|XP_009481222.1|  PREDICTED: probable ATP-dependent RNA helica...  59.3    6e-07   
gb|KIY68841.1|  DEAD-domain-containing protein                        58.9    6e-07   
gb|ETE72827.1|  putative ATP-dependent RNA helicase DDX17             59.3    6e-07   
ref|XP_008939400.1|  PREDICTED: probable ATP-dependent RNA helica...  59.3    6e-07   
ref|XP_010408888.1|  PREDICTED: probable ATP-dependent RNA helica...  59.3    6e-07   
ref|XP_009805513.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_004700310.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_004610567.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_010145760.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_010013794.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_009951301.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
gb|EOB03912.1|  Putative ATP-dependent RNA helicase DDX17             58.9    6e-07   
ref|XP_010420107.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.3    6e-07   
ref|XP_010565532.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
dbj|BAN64363.1|  p68-like protein                                     58.5    6e-07   
ref|XP_004311417.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_008634834.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_010185205.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
gb|EAW60248.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...  58.9    6e-07   
ref|XP_009436590.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_006174954.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_008067650.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_009566745.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_009880187.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_009933308.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_010225318.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_010132422.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_005016061.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_010085938.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
gb|EMS48902.1|  DEAD-box ATP-dependent RNA helicase 40                59.3    6e-07   
ref|XP_005567355.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_005567354.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_005883260.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
gb|ABN12070.1|  putative RNA-dependent helicase p68                   58.5    6e-07   
ref|XP_010168247.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_007622847.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_007622846.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_004650369.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_003264799.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_009330949.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_010710490.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
emb|CDX74304.1|  BnaA03g27430D                                        58.9    6e-07   
ref|XP_007939858.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_006865247.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|NP_001035277.1|  probable ATP-dependent RNA helicase DDX17 is...  58.9    6e-07   
ref|XP_010288347.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_005514775.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_006752810.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_010126497.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_009584901.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_008494759.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
emb|CEP17640.1|  hypothetical protein                                 59.3    6e-07   
gb|EPY88394.1|  putative ATP-dependent RNA helicase DDX17             58.9    6e-07   
emb|CCN25578.1|  DEAD-box ATP-dependent RNA helicase, putative        58.9    6e-07   
ref|XP_004134468.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.3    6e-07   
ref|XP_007189120.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_009502718.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
gb|KFG62415.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17             57.0    6e-07   
ref|NP_001267194.1|  probable ATP-dependent RNA helicase DDX17        58.9    6e-07   
ref|XP_010307626.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_009900873.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    6e-07   
ref|XP_003321253.2|  hypothetical protein PGTG_02295                  58.9    6e-07   
ref|XP_004675717.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
gb|ETN62014.1|  DEAD box ATP-dependent RNA helicase                   58.9    7e-07   
ref|XP_007099364.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...  58.9    7e-07   
ref|XP_005354345.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_009924066.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_006979214.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_010208864.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  58.9    7e-07   
ref|XP_009646040.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_009972429.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_007519377.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
gb|EYU44765.1|  hypothetical protein MIMGU_mgv1a003026mg              58.9    7e-07   
ref|XP_008142844.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_007519378.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_005322311.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_001092491.2|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|NP_001095463.1|  probable ATP-dependent RNA helicase DDX17        58.9    7e-07   
ref|XP_006102491.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_006071393.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_006914795.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_006890184.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_007111784.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_004883536.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_008929884.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_009073300.1|  PREDICTED: probable ATP-dependent RNA helica...  58.5    7e-07   
ref|XP_005379316.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_003470541.2|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_007441609.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_004589558.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_008977411.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_008849476.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
gb|AAP88874.1|  DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17, ...  58.9    7e-07   
ref|XP_003706564.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_003514725.2|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_008067649.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_009979992.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_005302557.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_008255265.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_007503261.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_005066907.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  58.9    7e-07   
ref|XP_006155420.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_009863069.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
emb|CDY08048.1|  BnaC03g34750D                                        58.9    7e-07   
gb|EMT09661.1|  DEAD-box ATP-dependent RNA helicase 20                58.5    7e-07   
ref|XP_003227208.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    7e-07   
ref|XP_010941500.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.9    8e-07   
ref|XP_007910174.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    8e-07   
ref|XP_007851403.1|  rna helicase                                     58.5    8e-07   
gb|KFQ57153.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
ref|XP_007867458.1|  DEAD-domain-containing protein                   58.5    8e-07   
gb|KFP59950.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
gb|KFP37484.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
gb|KFM02164.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
gb|KFR08900.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
gb|KFV00645.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
gb|KFO88513.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
gb|KGL73587.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
gb|KFZ60114.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
gb|KFP53210.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
ref|XP_008555058.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.5    8e-07   
gb|KFV75709.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
gb|KFO06156.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
ref|XP_008555059.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.5    8e-07   
dbj|BAE87553.1|  unnamed protein product                              58.5    8e-07   
gb|KFZ49707.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
gb|KFP74117.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
ref|XP_004224073.1|  helicase                                         58.5    8e-07   
gb|KFP10244.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
gb|KFQ77919.1|  putative ATP-dependent RNA helicase DDX17             58.5    8e-07   
ref|XP_001605420.2|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.5    8e-07   
gb|EMC76814.1|  putative ATP-dependent RNA helicase DDX17             58.5    9e-07   
gb|KFV68880.1|  putative ATP-dependent RNA helicase DDX17             58.5    9e-07   
gb|KFR10998.1|  putative ATP-dependent RNA helicase DDX17             58.5    9e-07   
gb|KFQ18808.1|  putative ATP-dependent RNA helicase DDX17             58.5    9e-07   
ref|XP_001615932.1|  helicase                                         58.5    9e-07   
gb|KFV60123.1|  putative ATP-dependent RNA helicase DDX17             58.5    9e-07   
gb|KFW90864.1|  putative ATP-dependent RNA helicase DDX17             58.5    9e-07   
gb|KFQ23731.1|  putative ATP-dependent RNA helicase DDX17             58.5    9e-07   
ref|XP_008209140.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.5    9e-07   
gb|KFO95968.1|  putative ATP-dependent RNA helicase DDX17             58.5    9e-07   
gb|KFQ80585.1|  putative ATP-dependent RNA helicase DDX17             58.5    9e-07   
ref|XP_009473564.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  58.5    9e-07   
gb|KGL90702.1|  putative ATP-dependent RNA helicase DDX17             58.5    9e-07   
gb|KFO81715.1|  putative ATP-dependent RNA helicase DDX17             58.5    9e-07   
gb|KFP69316.1|  putative ATP-dependent RNA helicase DDX17             58.2    9e-07   
gb|KFO61287.1|  putative ATP-dependent RNA helicase DDX17             58.5    9e-07   
gb|KJB33797.1|  hypothetical protein B456_006G031200                  58.5    9e-07   
gb|KJB33795.1|  hypothetical protein B456_006G031200                  58.5    9e-07   
ref|XP_008565101.1|  PREDICTED: probable ATP-dependent RNA helica...  58.5    9e-07   
gb|KGN57061.1|  hypothetical protein Csa_3G151380                     58.5    9e-07   
gb|KHJ83794.1|  hypothetical protein OESDEN_16503                     55.1    9e-07   
emb|CBY37141.1|  unnamed protein product                              58.5    9e-07   
ref|XP_011132110.1|  DEAD-box RNA helicase                            58.5    9e-07   
ref|XP_001609970.1|  p68-like protein                                 58.5    9e-07   
gb|KFQ42674.1|  putative ATP-dependent RNA helicase DDX17             58.2    9e-07   
ref|XP_005606692.1|  PREDICTED: probable ATP-dependent RNA helica...  58.5    9e-07   
ref|XP_007262740.1|  DEAD-domain-containing protein                   58.2    1e-06   
emb|CBY21093.1|  unnamed protein product                              58.2    1e-06   
ref|XP_002780686.1|  DEAD box ATP-dependent RNA helicase, putative    56.2    1e-06   



>emb|CBI14966.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 89/113 (79%), Gaps = 3/113 (3%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA TFFTH NAKFAR+L+KILQ+AGQ
Sbjct  20   DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAITFFTHSNAKFARDLIKILQEAGQ  79

Query  472  IVPPQLSALA---CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            +V P LSA+A         SGGN       G FGNRG ISGSNT+PLGA+R W
Sbjct  80   VVSPALSAMARSSGSAFGGSGGNFRSRGRGGSFGNRGLISGSNTIPLGARRPW  132



>ref|XP_004236255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Solanum lycopersicum]
Length=651

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDY+HRIGRTGRAGA GTAFTFFTH NAKF REL+KILQQAGQ
Sbjct  540  DVKDIKCVINYDFPSSLEDYIHRIGRTGRAGATGTAFTFFTHANAKFTRELIKILQQAGQ  599

Query  472  IVPPQLSALA  443
            IVPPQLSALA
Sbjct  600  IVPPQLSALA  609



>ref|XP_006344459.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Solanum tuberosum]
Length=648

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDY+HRIGRTGRAGA GTA+TFFTH NAKF REL+KILQQAGQ
Sbjct  538  DVKDIKCVINYDFPSSLEDYIHRIGRTGRAGATGTAYTFFTHANAKFTRELIKILQQAGQ  597

Query  472  IVPPQLSALA  443
            IVPPQLSALA
Sbjct  598  IVPPQLSALA  607



>ref|XP_011071940.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Sesamum indicum]
Length=600

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAF+FFTHGNAK+AR+L+KILQQAGQ
Sbjct  489  DVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGASGTAFSFFTHGNAKYARDLIKILQQAGQ  548

Query  472  IVPPQLSALA  443
            +VPPQL+ALA
Sbjct  549  VVPPQLAALA  558



>ref|XP_011071939.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Sesamum indicum]
Length=626

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAF+FFTHGNAK+AR+L+KILQQAGQ
Sbjct  515  DVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGASGTAFSFFTHGNAKYARDLIKILQQAGQ  574

Query  472  IVPPQLSALA  443
            +VPPQL+ALA
Sbjct  575  VVPPQLAALA  584



>ref|XP_006439905.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53145.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=389

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 94/112 (84%), Gaps = 2/112 (2%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR+L+KILQ+AGQ
Sbjct  278  DVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFARDLIKILQEAGQ  337

Query  472  IVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            IV P LS LA      F   G NFRSRGRGGFG R S+SGSNT+PLG+KR W
Sbjct  338  IVSPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSMSGSNTIPLGSKRLW  389



>gb|KDO69502.1| hypothetical protein CISIN_1g013176mg [Citrus sinensis]
Length=448

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 94/112 (84%), Gaps = 2/112 (2%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR+L+KILQ+AGQ
Sbjct  337  DVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFARDLIKILQEAGQ  396

Query  472  IVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            IV P LS LA      F   G NFRSRGRGGFG R S+SGSNT+PLG+KR W
Sbjct  397  IVSPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSMSGSNTIPLGSKRLW  448



>ref|XP_009594348.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
tomentosiformis]
Length=646

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDY+HRIGRTGRAGA GTAFTFFTH NAK+ R+L+KILQQAGQ
Sbjct  538  DVKDIKCVINYDFPSSLEDYIHRIGRTGRAGATGTAFTFFTHANAKYTRQLIKILQQAGQ  597

Query  472  IVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            IVPPQLSALA   G S+GG+NFRSRGRGGFGNR   SGSN +PLG +R W
Sbjct  598  IVPPQLSALAGSTGPSTGGSNFRSRGRGGFGNRDQKSGSNVIPLG-RRPW  646



>ref|XP_009769444.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
sylvestris]
Length=646

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP+ LEDY+HRIGRTGRAGA GTAFTFFTH NAK+ R+L+KILQQAGQ
Sbjct  538  DVKDIKCVVNYDFPSSLEDYIHRIGRTGRAGATGTAFTFFTHANAKYTRQLIKILQQAGQ  597

Query  472  IVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            IVPPQLSALA     S+GG+NFRSRGRGGFGNR   SGSN +PLG +R W
Sbjct  598  IVPPQLSALAGSTSHSTGGSNFRSRGRGGFGNRDQKSGSNVIPLG-RRPW  646



>ref|XP_006439909.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53149.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=599

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 94/112 (84%), Gaps = 2/112 (2%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR+L+KILQ+AGQ
Sbjct  488  DVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFARDLIKILQEAGQ  547

Query  472  IVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            IV P LS LA      F   G NFRSRGRGGFG R S+SGSNT+PLG+KR W
Sbjct  548  IVSPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSMSGSNTIPLGSKRLW  599



>ref|XP_006476870.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Citrus sinensis]
Length=599

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 94/112 (84%), Gaps = 2/112 (2%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR+L+KILQ+AGQ
Sbjct  488  DVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFARDLIKILQEAGQ  547

Query  472  IVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            IV P LS LA      F   G NFRSRGRGGFG R SISGSNT+PLG+KR W
Sbjct  548  IVSPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSISGSNTIPLGSKRLW  599



>emb|CDY48128.1| BnaCnng15700D [Brassica napus]
Length=594

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG A TFFTH NAKFAREL+KILQ+AGQ
Sbjct  479  DVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAMTFFTHDNAKFARELIKILQEAGQ  538

Query  472  IVPPQLSAL  446
            +VPP LSAL
Sbjct  539  VVPPTLSAL  547



>ref|XP_009112063.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Brassica rapa]
Length=591

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG A TFFTH NAKFAREL+KILQ+AGQ
Sbjct  476  DVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAMTFFTHDNAKFARELIKILQEAGQ  535

Query  472  IVPPQLSAL  446
            +VPP LSAL
Sbjct  536  VVPPTLSAL  544



>emb|CDY16735.1| BnaA09g06470D [Brassica napus]
Length=591

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG A TFFTH NAKFAREL+KILQ+AGQ
Sbjct  477  DVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAMTFFTHDNAKFARELIKILQEAGQ  536

Query  472  IVPPQLSAL  446
            +VPP LSAL
Sbjct  537  VVPPTLSAL  545



>gb|KFK25761.1| hypothetical protein AALP_AA8G156100 [Arabis alpina]
Length=582

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ
Sbjct  469  DVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQ  528

Query  472  IVPPQLSAL  446
            +VPP LSAL
Sbjct  529  VVPPTLSAL  537



>ref|XP_006394312.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
 gb|ESQ31598.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
Length=596

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ
Sbjct  481  DVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQ  540

Query  472  IVPPQLSAL  446
            +VPP LSAL
Sbjct  541  VVPPTLSAL  549



>gb|AFW97645.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
 gb|AHZ57094.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
Length=595

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ
Sbjct  477  DVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQ  536

Query  472  IVPPQLSAL  446
            +VPP LSAL
Sbjct  537  VVPPTLSAL  545



>emb|CDP12744.1| unnamed protein product [Coffea canephora]
Length=624

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAFTFFTH NAKFAR+L+KIL+ AGQ
Sbjct  516  DVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGATGTAFTFFTHANAKFARDLIKILRDAGQ  575

Query  472  IVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            I+PP LSA+A     S+ G N       G      ISGSNT+PLGAK+ W
Sbjct  576  IIPPDLSAMAR-STGSTMGGNNFRSRGRGGFGNRGISGSNTIPLGAKKPW  624



>ref|XP_010678860.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=643

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFPT LEDY+HRIGRTGRAGAKGTA+TFFTH NAKF REL+KIL++AGQ
Sbjct  536  DVKDIKCVINYDFPTSLEDYIHRIGRTGRAGAKGTAYTFFTHSNAKFTRELIKILREAGQ  595

Query  472  IVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            ++PP LSA+A   G + GG NFRSRGRGGFGNR   SGSNT+P+G  R W
Sbjct  596  MIPPALSAMAQSSGSNFGGGNFRSRGRGGFGNRSQKSGSNTIPVG--RRW  643



>ref|XP_011046220.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Populus 
euphratica]
Length=612

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTA TFFT  NAKFAR+L+KILQ+AGQ
Sbjct  505  DVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGASGTALTFFTESNAKFARDLIKILQEAGQ  564

Query  472  IVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            IVPP LSA+       S G NFRSRGRGGF NR  ISGSNTVPLGA R W
Sbjct  565  IVPPSLSAMT--RSAGSFGGNFRSRGRGGFSNRRMISGSNTVPLGAGRPW  612



>ref|XP_008239580.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Prunus mume]
Length=609

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAREL+KILQ+AGQ
Sbjct  500  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFARELIKILQEAGQ  559

Query  472  IVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            +V P L+A++   G   G          G G    ISGSNTVP+G KR W
Sbjct  560  VVSPALAAMSRSSGSFGGSGGNFRNRGRGGGFGNRISGSNTVPIGYKRPW  609



>ref|XP_007210287.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
 gb|EMJ11486.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
Length=638

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAREL+KILQ+AGQ
Sbjct  529  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFARELIKILQEAGQ  588

Query  472  IVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            +V P L+A++   G   G          G G    ISGSNTVP+G KR W
Sbjct  589  VVSPALAAMSRSSGSFGGSGGNFRNRGRGGGFGNRISGSNTVPIGYKRPW  638



>dbj|BAB10554.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
Length=564

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFARELVKILQ+AGQ
Sbjct  448  DVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELVKILQEAGQ  507

Query  472  IVPPQLSAL  446
            +VPP LSAL
Sbjct  508  VVPPTLSAL  516



>ref|NP_974985.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
 sp|Q8W4R3.2|RH30_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis 
thaliana]
 dbj|BAE98724.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
 gb|AED97706.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
Length=591

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFARELVKILQ+AGQ
Sbjct  475  DVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELVKILQEAGQ  534

Query  472  IVPPQLSAL  446
            +VPP LSAL
Sbjct  535  VVPPTLSAL  543



>ref|XP_010102487.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
 gb|EXB93551.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
Length=625

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA+GTA TFFTH NAKFAREL+KILQ+AGQ
Sbjct  514  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGARGTALTFFTHANAKFARELIKILQEAGQ  573

Query  472  IVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            +V P LSAL           G +FRSRGRGGFGNR   SGSNTVPLG KR W
Sbjct  574  VVTPALSALVRSAGSSGGGSGGSFRSRGRGGFGNRALKSGSNTVPLGNKRSW  625



>ref|XP_010484038.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=594

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ
Sbjct  477  DVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQ  536

Query  472  IVPPQLSAL  446
            +VPP LSAL
Sbjct  537  VVPPTLSAL  545



>gb|KDP31038.1| hypothetical protein JCGZ_11414 [Jatropha curcas]
Length=627

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 94/111 (85%), Gaps = 1/111 (1%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDY+HRIGRTGRAGA+GTA TFFTH NAKFAR+L+KILQ+A Q
Sbjct  517  DVKDIKCVINYDFPSSLEDYIHRIGRTGRAGARGTAITFFTHANAKFARDLIKILQEARQ  576

Query  472  IVPPQLSALA-CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            I+PP LSA+A   G     G NFRSRGRGGFGNR  ISGSNT+PLG++R W
Sbjct  577  ILPPTLSAMARSAGTHGGSGGNFRSRGRGGFGNRSLISGSNTIPLGSRRPW  627



>ref|XP_010444189.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=591

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ
Sbjct  475  DVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQ  534

Query  472  IVPPQLSAL  446
            +VPP LSAL
Sbjct  535  VVPPTLSAL  543



>ref|XP_010459851.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Camelina sativa]
Length=598

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ
Sbjct  481  DVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQ  540

Query  472  IVPPQLSAL  446
            +VPP LSAL
Sbjct  541  VVPPTLSAL  549



>ref|XP_002866536.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42795.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ
Sbjct  472  DVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQ  531

Query  472  IVPPQLSAL  446
            +VPP LSAL
Sbjct  532  VVPPTLSAL  540



>ref|XP_002322195.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
 gb|EEF06322.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
Length=609

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA+GTA TFFT  NAKFAR+L+KILQ+AGQ
Sbjct  502  DVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGARGTALTFFTESNAKFARDLIKILQEAGQ  561

Query  472  IVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            IVPP LSA+       S G NFRSRGRGGFGNRG ISGSNTVPLGA R W
Sbjct  562  IVPPSLSAMT--RSAGSFGGNFRSRGRGGFGNRGMISGSNTVPLGAGRPW  609



>ref|XP_002318665.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
 gb|EEE96885.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
Length=543

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 89/112 (79%), Gaps = 2/112 (2%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA+GTAFTFFT  NAKFAR L++ILQ++GQ
Sbjct  432  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGARGTAFTFFTDSNAKFARGLIRILQESGQ  491

Query  472  IVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            IVPP LSALA        S GN       G FGNRGSISGSNTVPLGA+R W
Sbjct  492  IVPPALSALARSSGSFGGSAGNFRSRGRGGSFGNRGSISGSNTVPLGARRPW  543



>ref|XP_011047813.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Populus euphratica]
Length=625

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 89/112 (79%), Gaps = 2/112 (2%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA+GTAFTFFT  NAKFAR L++ILQ++GQ
Sbjct  514  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGARGTAFTFFTDSNAKFARGLIRILQESGQ  573

Query  472  IVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            IVPP LSALA        S GN       G FGNRGSISGSNTVPLGA+R W
Sbjct  574  IVPPALSALARSSGSFGGSAGNFRSRGRGGSFGNRGSISGSNTVPLGARRPW  625



>ref|XP_007155472.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
 gb|ESW27466.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
Length=603

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA+TFFTHGNAKFAR+L+KILQ AGQ
Sbjct  489  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAYTFFTHGNAKFARDLIKILQDAGQ  548

Query  472  IVPPQLSAL  446
            +V P LSAL
Sbjct  549  VVSPALSAL  557



>emb|CAN78903.1| hypothetical protein VITISV_026451 [Vitis vinifera]
Length=692

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA TFFTH NAKFAR+L+KILQ+AGQ
Sbjct  580  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAITFFTHSNAKFARDLIKILQEAGQ  639

Query  472  IVPPQLSALA  443
            +V P LSA+A
Sbjct  640  VVSPALSAMA  649



>ref|XP_010663104.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
Length=718

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA TFFTH NAKFAR+L+KILQ+AGQ
Sbjct  606  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAITFFTHSNAKFARDLIKILQEAGQ  665

Query  472  IVPPQLSALA  443
            +V P LSA+A
Sbjct  666  VVSPALSAMA  675



>gb|KHG00891.1| DEAD-box ATP-dependent RNA helicase 30 [Gossypium arboreum]
Length=127

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFT  NAK+AR+L+K+LQ AGQ
Sbjct  15   DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTQANAKYARDLIKLLQDAGQ  74

Query  472  IVPPQLSALA  443
            +V P LS LA
Sbjct  75   VVSPALSTLA  84



>ref|XP_006280218.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
 gb|EOA13116.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
Length=594

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ
Sbjct  476  DVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQ  535

Query  472  IVPPQLSAL  446
             VPP LSAL
Sbjct  536  AVPPTLSAL  544



>ref|XP_010550696.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Tarenaya hassleriana]
Length=576

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NA+FAREL+KIL +AGQ
Sbjct  469  DVKDIKCVINYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNARFARELIKILHEAGQ  528

Query  472  IVPPQLSAL  446
            +VPP LS L
Sbjct  529  VVPPSLSDL  537



>gb|KGN63543.1| hypothetical protein Csa_1G004090 [Cucumis sativus]
Length=131

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            +VKDIKCVIN+DFP+ LEDYVHRIGRTGRAGAKGTAFTFFTH NAK AR+L+KIL++AGQ
Sbjct  20   NVKDIKCVINFDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTHENAKHARDLIKILREAGQ  79

Query  472  IVPPQLSALA  443
            IV P LSALA
Sbjct  80   IVTPALSALA  89



>gb|KHN34349.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR+L+KILQ AGQ
Sbjct  403  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFARDLIKILQDAGQ  462

Query  472  IVPPQLSAL  446
            +V P LSAL
Sbjct  463  VVSPALSAL  471



>ref|XP_004299135.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Fragaria vesca 
subsp. vesca]
Length=606

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFT  N KFAREL+KILQ+AGQ
Sbjct  500  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTESNGKFARELIKILQEAGQ  559

Query  472  IVPPQLSALA  443
            +V P LSA+A
Sbjct  560  VVSPALSAMA  569



>ref|XP_006579582.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=605

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR+L+KILQ AGQ
Sbjct  491  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFARDLIKILQDAGQ  550

Query  472  IVPPQLSAL  446
            +V P LSAL
Sbjct  551  VVSPALSAL  559



>gb|KHN18420.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFPT LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR+L+KILQ AGQ
Sbjct  403  DVKDIKCVINYDFPTSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFARDLIKILQDAGQ  462

Query  472  IVPPQLSAL--ACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
             V P L+AL  +   G    G  FRSRGRGG+GNRG  SGSN +PLG+KR W
Sbjct  463  TVSPALTALVRSAGSGQFGSGGGFRSRGRGGYGNRGLTSGSNAIPLGSKRPW  514



>ref|XP_008365657.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Malus 
domestica]
Length=643

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKF R+L+KILQ+AGQ
Sbjct  532  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAAGTALTFFTHANAKFTRDLIKILQEAGQ  591

Query  472  IVPPQLSALA  443
            +V P L+A+A
Sbjct  592  VVSPALAAMA  601



>ref|XP_003549600.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=602

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFPT LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR+L+KILQ AGQ
Sbjct  488  DVKDIKCVINYDFPTSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFARDLIKILQDAGQ  547

Query  472  IVPPQLSAL--ACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
             V P L+AL  +   G    G  FRSRGRGG+GNRG  SGSN +PLG+KR W
Sbjct  548  TVSPALTALVRSAGSGQFGSGGGFRSRGRGGYGNRGLTSGSNAIPLGSKRPW  599



>ref|XP_007036326.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY20827.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=626

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFT  NAK+AR+L+K+LQ AGQ
Sbjct  515  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTQANAKYARDLIKLLQDAGQ  574

Query  472  IVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
            +V P LS LA      F     NFRSRGRGG+GNR SISGSNT+PLGA+R W
Sbjct  575  VVSPALSTLARSAASSFGGSRGNFRSRGRGGYGNRSSISGSNTIPLGARRPW  626



>ref|NP_001172705.1| Os01g0911100 [Oryza sativa Japonica Group]
 dbj|BAH91435.1| Os01g0911100, partial [Oryza sativa Japonica Group]
Length=117

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFT  NAKF+R LVKIL++AGQ
Sbjct  12   DVKDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTLSNAKFSRNLVKILREAGQ  71

Query  472  IVPPQLSALA  443
            +V P L ++A
Sbjct  72   VVNPALESMA  81



>ref|XP_006845267.1| hypothetical protein AMTR_s00005p00263980 [Amborella trichopoda]
 gb|ERN06942.1| hypothetical protein AMTR_s00005p00263980 [Amborella trichopoda]
Length=670

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 74/110 (67%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT+ NA+FAREL+KILQ+AGQ
Sbjct  561  DVKDIKCVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTNANARFARELIKILQEAGQ  620

Query  472  IVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
             V PQL+AL    G    G         G+GNR  ISGSNT+P+G KR W
Sbjct  621  AVSPQLAALGRSSGGGGSGGGNFRSRGRGYGNRSLISGSNTIPIGGKRPW  670



>ref|XP_009345779.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
Length=612

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIK VINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAR+L+KILQ+AGQ
Sbjct  501  DVKDIKFVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFARDLIKILQEAGQ  560

Query  472  IVPPQLSALA  443
            +V P L+A+A
Sbjct  561  VVSPALAAMA  570



>ref|XP_009363040.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Pyrus 
x bretschneideri]
Length=611

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIK VINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAR+L+KILQ+AGQ
Sbjct  500  DVKDIKFVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFARDLIKILQEAGQ  559

Query  472  IVPPQLSALA  443
            +V P L+A+A
Sbjct  560  VVSPALAAMA  569



>ref|XP_010932245.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Elaeis 
guineensis]
Length=701

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 57/70 (81%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFPT LEDYVHRIGRTGRAGAKGTAFTFFTH NA+FAR+L+KILQ+AGQ
Sbjct  594  DVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGAKGTAFTFFTHANARFARDLIKILQEAGQ  653

Query  472  IVPPQLSALA  443
             V P L+++A
Sbjct  654  SVTPALASMA  663



>ref|XP_010251083.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Nelumbo 
nucifera]
Length=719

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA+G AFTFFTH NA+FAR+L+KILQ  GQ
Sbjct  606  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGARGNAFTFFTHANARFARDLIKILQDCGQ  665

Query  472  IVPPQLSALA  443
            +V P L+A+A
Sbjct  666  VVNPALAAMA  675



>ref|XP_008807455.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Phoenix 
dactylifera]
Length=683

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 56/70 (80%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFPT LEDYVHRIGRTGRAGAKGTA TFFTH NA+FAR+L+KILQ+AG+
Sbjct  576  DVKDIKCVINYDFPTSLEDYVHRIGRTGRAGAKGTALTFFTHANARFARDLIKILQEAGK  635

Query  472  IVPPQLSALA  443
             V P L+++A
Sbjct  636  SVTPALASMA  645



>tpg|DAA56213.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=571

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LVKIL++AGQ
Sbjct  463  DVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLVKILREAGQ  522

Query  472  IVPPQLSALA  443
            +V P L +++
Sbjct  523  VVNPALESMS  532



>ref|XP_006646592.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Oryza 
brachyantha]
Length=547

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LVKIL++AGQ
Sbjct  442  DVKDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHSNAKFSRNLVKILREAGQ  501

Query  472  IVPPQLSALA  443
            +V P L ++A
Sbjct  502  VVNPALESMA  511



>ref|NP_001105241.1| DEAD box RNA helicase1 [Zea mays]
 gb|AAR29370.1| DEAD box RNA helicase [Zea mays]
Length=566

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LVKIL++AGQ
Sbjct  460  DVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLVKILREAGQ  519

Query  472  IVPPQLSALA  443
            +V P L +++
Sbjct  520  VVNPALESMS  529



>ref|XP_004138092.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis 
sativus]
 ref|XP_004168110.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis 
sativus]
Length=622

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVIN+DFP+ LEDYVHRIGRTGRAGAKGTAFTFFTH NAK AR+L+KIL++AGQ
Sbjct  511  DVKDIKCVINFDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTHENAKHARDLIKILREAGQ  570

Query  472  IVPPQLSALA  443
            IV P LSALA
Sbjct  571  IVTPALSALA  580



>ref|XP_008464517.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Cucumis melo]
Length=622

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFTH NAK AR+L+KIL++AGQ
Sbjct  511  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTHENAKHARDLIKILREAGQ  570

Query  472  IVPPQLSALA  443
            IV P LS LA
Sbjct  571  IVTPALSTLA  580



>gb|EMT04443.1| DEAD-box ATP-dependent RNA helicase 30 [Aegilops tauschii]
Length=210

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH NAK++R LVKIL++AGQ
Sbjct  42   DVKDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNAKYSRNLVKILREAGQ  101

Query  472  IVPPQLSA  449
            +V P L A
Sbjct  102  VVNPALEA  109



>gb|KEH31793.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=625

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGAKGTA++FFT  NAK+AR+L+KILQ AGQ
Sbjct  511  DVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGAKGTAYSFFTSANAKYARDLIKILQDAGQ  570

Query  472  IVPPQLSALA  443
            IV P LSAL 
Sbjct  571  IVSPALSALT  580



>gb|KJB40103.1| hypothetical protein B456_007G047000 [Gossypium raimondii]
Length=623

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFT  NAK+AR+L+K+LQ AGQ
Sbjct  511  DVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTQANAKYARDLIKLLQDAGQ  570

Query  472  IVPPQLSALA  443
            +V P LS LA
Sbjct  571  VVSPALSTLA  580



>ref|XP_004515873.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Cicer arietinum]
Length=622

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGAKGTA++FFT  NAKFAR+L+KILQ AGQ
Sbjct  507  DVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGAKGTAYSFFTRANAKFARDLIKILQDAGQ  566

Query  472  IVPPQLSALA  443
            +V P LS L+
Sbjct  567  VVSPALSELS  576



>ref|XP_010027294.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Eucalyptus 
grandis]
 gb|KCW83292.1| hypothetical protein EUGRSUZ_B00227 [Eucalyptus grandis]
Length=624

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP  LEDYVHRIGRTGRAGAKGTAFTFFT  N++FA EL+KILQ AGQ
Sbjct  507  DVKDIKCVINYDFPMTLEDYVHRIGRTGRAGAKGTAFTFFTDSNSRFAGELLKILQDAGQ  566

Query  472  IVPPQLSALA  443
            +VPP LS LA
Sbjct  567  VVPPALSDLA  576



>gb|EYU22173.1| hypothetical protein MIMGU_mgv1a003417mg [Erythranthe guttata]
Length=586

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAFTFFTH N K A  L+KILQQA Q
Sbjct  478  DVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGATGTAFTFFTHANVKSAGHLIKILQQARQ  537

Query  472  IVPPQLSALA  443
             VPPQL+ALA
Sbjct  538  AVPPQLAALA  547



>ref|XP_004971011.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X2 [Setaria italica]
Length=569

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LVKIL++AGQ
Sbjct  461  DVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLVKILREAGQ  520

Query  472  IVPPQL  455
            +V P L
Sbjct  521  VVNPAL  526



>ref|XP_004971010.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Setaria italica]
Length=596

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LVKIL++AGQ
Sbjct  461  DVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLVKILREAGQ  520

Query  472  IVPPQL  455
            +V P L
Sbjct  521  VVNPAL  526



>ref|XP_002458964.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
 gb|EES04084.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
Length=578

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LVKIL++AGQ
Sbjct  469  DVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLVKILREAGQ  528

Query  472  IVPPQLSAL  446
             V P L ++
Sbjct  529  AVNPALESM  537



>gb|EMS66298.1| DEAD-box ATP-dependent RNA helicase 30 [Triticum urartu]
Length=587

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH NAK++R LVKIL++AGQ
Sbjct  464  DVKDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNAKYSRNLVKILREAGQ  523

Query  472  IVPPQLSALA  443
            +V P L A++
Sbjct  524  VVNPALEAMS  533



>emb|CDM85602.1| unnamed protein product [Triticum aestivum]
Length=574

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH NAK++R LVKIL++AGQ
Sbjct  464  DVKDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNAKYSRNLVKILREAGQ  523

Query  472  IVPPQLSALA  443
            +V P L A++
Sbjct  524  VVNPALEAMS  533



>ref|XP_003564892.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Brachypodium 
distachyon]
Length=571

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH N+K++R LVKIL++AGQ
Sbjct  467  DVKDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNSKYSRNLVKILREAGQ  526

Query  472  IVPPQLSALA  443
            +V P L A++
Sbjct  527  VVNPALEAMS  536



>dbj|BAD82427.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 dbj|BAD82339.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 gb|EEE55863.1| hypothetical protein OsJ_04500 [Oryza sativa Japonica Group]
Length=571

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFT  NAKF+R LVKIL++AGQ
Sbjct  466  DVKDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTLSNAKFSRNLVKILREAGQ  525

Query  472  IVPPQLSALA  443
            +V P L ++A
Sbjct  526  VVNPALESMA  535



>ref|XP_009412685.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Musa 
acuminata subsp. malaccensis]
Length=695

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 56/70 (80%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCV+N+DFPT LEDYVHRIGRTGRAGAKGTAFTFFT  N +FARELVKILQ AGQ
Sbjct  590  DVKDIKCVVNFDFPTSLEDYVHRIGRTGRAGAKGTAFTFFTQANIRFARELVKILQDAGQ  649

Query  472  IVPPQLSALA  443
             V P L+++A
Sbjct  650  NVSPALASMA  659



>gb|ACN39916.1| unknown [Picea sitchensis]
Length=593

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  N +FARELV ILQ+AGQ
Sbjct  480  DVKDIKCVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANGRFARELVGILQEAGQ  539

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  540  RVNPELAAMT  549



>ref|XP_006385358.1| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|ERP63155.1| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=497

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT GNA+FA+ELV IL++AGQ
Sbjct  401  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAGNARFAKELVTILEEAGQ  460

Query  472  IVPPQLSALA  443
             V P+L+A+A
Sbjct  461  KVSPELTAMA  470



>sp|Q5N7W4.2|RH30_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Oryza sativa 
Japonica Group]
Length=666

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFT  NAKF+R LVKIL++AGQ
Sbjct  561  DVKDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTLSNAKFSRNLVKILREAGQ  620

Query  472  IVPPQLSALA  443
            +V P L ++A
Sbjct  621  VVNPALESMA  630



>ref|XP_011000790.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Populus euphratica]
Length=506

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  +EDYVHRIGRTGRAGAKGTA+TFFT GNA+FA+ELV IL++AGQ
Sbjct  410  DVKDVKYVINYDFPGSIEDYVHRIGRTGRAGAKGTAYTFFTAGNARFAKELVTILEEAGQ  469

Query  472  IVPPQLSALA  443
             V P+L+A+A
Sbjct  470  KVSPELTAMA  479



>gb|ABR16327.1| unknown [Picea sitchensis]
Length=504

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP  +EDYVHRIGRTGRAGAKGTA+T+FT  NA+FAR+L+KIL++AGQ
Sbjct  409  DVKDIKCVINYDFPGSMEDYVHRIGRTGRAGAKGTAYTYFTAANARFARDLIKILEEAGQ  468

Query  472  IVPPQLSALA  443
             + P L+ + 
Sbjct  469  SISPSLAEMG  478



>ref|XP_009336746.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
 ref|XP_009336748.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
Length=140

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ +L++AGQ
Sbjct  44   DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQ  103

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  104  KVSPELAAMG  113



>gb|AAG51573.1|AC027034_19 RNA helicase, 5' partial; 101954-101280 [Arabidopsis thaliana]
Length=155

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL  ILQ+AGQ
Sbjct  63   DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELTNILQEAGQ  122

Query  472  IVPPQLSALA  443
             V P+L+++ 
Sbjct  123  KVSPELASMG  132



>emb|CAA09209.1| RNA helicase [Arabidopsis thaliana]
Length=187

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL  ILQ+AGQ
Sbjct  95   DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELTNILQEAGQ  154

Query  472  IVPPQLSALA  443
             V P+L+++ 
Sbjct  155  KVSPELASMG  164



>gb|EPS60527.1| hypothetical protein M569_14276, partial [Genlisea aurea]
Length=230

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NAKFA+EL+ IL++AGQ
Sbjct  136  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANAKFAKELINILREAGQ  195

Query  472  IVPPQLSALA  443
             V P+L A+ 
Sbjct  196  KVSPELVAMG  205



>ref|XP_006392683.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29969.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
Length=501

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ ILQ+AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELISILQEAGQ  468

Query  472  IVPPQLSALA  443
             V P+LS++ 
Sbjct  469  KVSPELSSMG  478



>ref|XP_006392681.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 ref|XP_006392682.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29967.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29968.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
Length=429

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ ILQ+AGQ
Sbjct  337  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELISILQEAGQ  396

Query  472  IVPPQLSALA  443
             V P+LS++ 
Sbjct  397  KVSPELSSMG  406



>ref|XP_004486821.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Cicer arietinum]
Length=501

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+ELV IL++AGQ
Sbjct  407  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELVSILEEAGQ  466

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  467  RVSPELAAMG  476



>ref|XP_010542432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Tarenaya hassleriana]
Length=503

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELISILEEAGQ  468

Query  472  IVPPQLSAL  446
             V P+L+A+
Sbjct  469  RVSPELAAM  477



>ref|XP_006426523.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39763.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=473

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  378  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  437

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  438  KVSPELAAMG  447



>gb|KDO65284.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=473

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  378  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  437

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  438  KVSPELAAMG  447



>ref|XP_004486820.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Cicer arietinum]
Length=546

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+ELV IL++AGQ
Sbjct  407  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELVSILEEAGQ  466

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  467  RVSPELAAMG  476



>ref|XP_002527412.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF34978.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=505

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTASNARFAKELISILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>gb|KDO65287.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=491

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  396  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  455

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  456  KVSPELAAMG  465



>ref|XP_006426525.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39765.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=505

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>ref|XP_006466041.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Citrus sinensis]
 gb|KDO65282.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=505

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>ref|XP_006466042.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Citrus sinensis]
 gb|KDO65283.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=504

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>ref|XP_006426524.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39764.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=504

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>ref|XP_006426526.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39766.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=495

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  400  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  459

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  460  KVSPELAAMG  469



>gb|KDP40778.1| hypothetical protein JCGZ_24777 [Jatropha curcas]
Length=503

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  408  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTASNARFAKELITILEEAGQ  467

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  468  KVSPELAAMG  477



>gb|KHG24204.1| DEAD-box ATP-dependent RNA helicase 20 -like protein [Gossypium 
arboreum]
Length=505

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>ref|XP_010262147.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X3 [Nelumbo nucifera]
Length=505

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  410  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  469

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  470  KVSPELAAMG  479



>ref|XP_010242202.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nelumbo nucifera]
Length=512

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  416  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  475

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  476  KVSPELAAMG  485



>ref|XP_010262145.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Nelumbo nucifera]
Length=512

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  417  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  476

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  477  KVSPELAAMG  486



>ref|XP_010262146.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Nelumbo nucifera]
Length=511

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  416  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  475

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  476  KVSPELAAMG  485



>gb|KDO65286.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=498

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  403  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  462

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  463  KVSPELAAMG  472



>gb|KHN39300.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=433

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+EL+ IL++AGQ
Sbjct  337  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAKELIAILEEAGQ  396

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  397  KVSPELAAMG  406



>ref|XP_006583016.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Glycine max]
Length=496

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+EL+ IL++AGQ
Sbjct  411  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAKELIAILEEAGQ  470

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  471  KVSPELAAMG  480



>ref|XP_003529884.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Glycine max]
Length=507

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+EL+ IL++AGQ
Sbjct  411  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAKELIAILEEAGQ  470

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  471  KVSPELAAMG  480



>gb|KJB56888.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
 gb|KJB56891.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=505

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>ref|XP_006858286.1| hypothetical protein AMTR_s00064p00050700 [Amborella trichopoda]
 gb|ERN19753.1| hypothetical protein AMTR_s00064p00050700 [Amborella trichopoda]
Length=501

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  N +FA+EL+ ILQ+AGQ
Sbjct  405  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANGRFAKELISILQEAGQ  464

Query  472  IVPPQLSAL  446
             V P+L+A+
Sbjct  465  KVSPELAAM  473



>ref|XP_002279117.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
 emb|CBI35942.3| unnamed protein product [Vitis vinifera]
Length=506

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  410  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQ  469

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  470  RVAPELAAMG  479



>ref|XP_010686087.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  408  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGATGTAYTFFTAANARFAKELIAILEEAGQ  467

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  468  KVNPELAAMG  477



>gb|KJB56890.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=487

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>ref|XP_007135556.1| hypothetical protein PHAVU_010G139400g [Phaseolus vulgaris]
 gb|ESW07550.1| hypothetical protein PHAVU_010G139400g [Phaseolus vulgaris]
Length=507

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  411  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQ  470

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  471  KVSPELAAMG  480



>ref|XP_008447604.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Cucumis melo]
Length=505

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIGILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>gb|KJB70270.1| hypothetical protein B456_011G066000 [Gossypium raimondii]
 gb|KJB70271.1| hypothetical protein B456_011G066000 [Gossypium raimondii]
Length=505

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILKEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>ref|XP_004146825.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Cucumis 
sativus]
 ref|XP_004154799.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Cucumis 
sativus]
 gb|KGN59824.1| hypothetical protein Csa_3G848820 [Cucumis sativus]
Length=505

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIGILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>gb|KHF98903.1| DEAD-box ATP-dependent RNA helicase 20 -like protein [Gossypium 
arboreum]
Length=519

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILKEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>ref|XP_003531619.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Glycine 
max]
 gb|KHN11290.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=507

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K V+NYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+EL+ IL++AGQ
Sbjct  411  DVKDVKYVVNYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAKELIAILEEAGQ  470

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  471  KVSPELAAMG  480



>gb|KCW53605.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
 gb|KCW53606.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
Length=485

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELISILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P L+A+ 
Sbjct  469  KVSPDLAAMG  478



>ref|XP_007024450.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
 gb|EOY27072.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
Length=505

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIVILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>ref|NP_175911.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
 sp|Q9C718.1|RH20_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis 
thaliana]
 gb|AAG50841.1|AC073944_8 ethylene-responsive RNA helicase, putative [Arabidopsis thaliana]
 gb|AAL32823.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91186.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33192.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
Length=501

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL  ILQ+AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELTNILQEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+++ 
Sbjct  469  KVSPELASMG  478



>ref|XP_010033787.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
 ref|XP_010033788.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
Length=504

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELISILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P L+A+ 
Sbjct  469  KVSPDLAAMG  478



>ref|XP_008228305.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X3 
[Prunus mume]
Length=504

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ +L++AGQ
Sbjct  408  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQ  467

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  468  KVSPELAAMG  477



>ref|XP_008228303.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Prunus mume]
Length=504

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ +L++AGQ
Sbjct  408  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQ  467

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  468  KVSPELAAMG  477



>ref|XP_010501121.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Camelina 
sativa]
Length=502

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  410  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELINILEEAGQ  469

Query  472  IVPPQLSALA  443
             V P+L+++ 
Sbjct  470  KVSPELASMG  479



>ref|XP_007215261.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
 gb|EMJ16460.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
Length=504

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ +L++AGQ
Sbjct  408  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQ  467

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  468  KVSPELAAMG  477



>ref|XP_008805785.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Phoenix dactylifera]
Length=530

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ
Sbjct  434  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQ  493

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  494  KVSPELAAMG  503



>ref|XP_008805786.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Phoenix dactylifera]
Length=498

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ
Sbjct  402  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQ  461

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  462  KVSPELAAMG  471



>ref|XP_009367550.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Pyrus x bretschneideri]
Length=505

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ +L++AGQ
Sbjct  409  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>ref|XP_008391321.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Malus domestica]
Length=505

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ +L++AGQ
Sbjct  409  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  469  KVSPELAAMG  478



>ref|XP_010480028.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Camelina sativa]
Length=502

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  410  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELINILEEAGQ  469

Query  472  IVPPQLSALA  443
             V P+L+++ 
Sbjct  470  KVSPELASMG  479



>ref|XP_010480030.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Camelina sativa]
Length=464

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  372  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELINILEEAGQ  431

Query  472  IVPPQLSALA  443
             V P+L+++ 
Sbjct  432  KVSPELASMG  441



>ref|XP_010106662.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
 gb|EXC11111.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
Length=494

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ
Sbjct  404  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLITILEEAGQ  463

Query  472  IVPPQLSALA  443
             V P+L+A+ 
Sbjct  464  KVSPELAAMG  473



>ref|XP_010462358.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Camelina sativa]
Length=502

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  410  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELMNILEEAGQ  469

Query  472  IVPPQLSALA  443
             V P+L+++ 
Sbjct  470  KVSPELASMG  479



>emb|CDO97919.1| unnamed protein product [Coffea canephora]
Length=500

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ ILQ+AGQ
Sbjct  408  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKDLINILQEAGQ  467

Query  472  IVPPQLSALA  443
             V P+L+++ 
Sbjct  468  KVSPELASMG  477



>ref|XP_010462359.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Camelina sativa]
Length=464

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  372  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELMNILEEAGQ  431

Query  472  IVPPQLSALA  443
             V P+L+++ 
Sbjct  432  KVSPELASMG  441



>ref|XP_009380443.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Musa acuminata 
subsp. malaccensis]
Length=497

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+KIL++AGQ
Sbjct  405  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLIKILEEAGQ  464

Query  472  IVPPQLSAL  446
             V P+L+ +
Sbjct  465  KVNPELAKM  473



>ref|XP_004297601.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Fragaria vesca 
subsp. vesca]
Length=505

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA TFFT  NA+FA+EL+ +L++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAHTFFTAANARFAKELIGLLEEAGQ  468

Query  472  IVPPQLSALA  443
             V P L+A+ 
Sbjct  469  KVSPDLAAMG  478



>ref|XP_004968530.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Setaria italica]
Length=492

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  399  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELINILEEAGQ  458

Query  472  IVPPQLSALA  443
             V  +L+A+ 
Sbjct  459  KVSSELAAMG  468



>ref|NP_001142117.1| uncharacterized protein LOC100274281 [Zea mays]
 gb|ACF86539.1| unknown [Zea mays]
 gb|ACF87679.1| unknown [Zea mays]
 tpg|DAA52978.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=494

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  401  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELINILEEAGQ  460

Query  472  IVPPQLSALA  443
             V  +L+A+ 
Sbjct  461  KVSSELAAMG  470



>ref|XP_003597619.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 ref|XP_003636418.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|ABN08415.1| Helicase, C-terminal [Medicago truncatula]
 gb|AES67870.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=499

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  405  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELISILEEAGQ  464

Query  472  IVPPQLSALA  443
             V  +L+A+ 
Sbjct  465  RVSSELAAMG  474



>ref|XP_002891814.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68073.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL  IL++AGQ
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELSNILEEAGQ  468

Query  472  IVPPQLSALA  443
             V P+L+++ 
Sbjct  469  KVSPELASMG  478



>gb|AFK42127.1| unknown [Medicago truncatula]
Length=499

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIG+TGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  405  DVKDVKYVINYDFPGSLEDYVHRIGKTGRAGAKGTAYTFFTAANARFAKELISILEEAGQ  464

Query  472  IVPPQLSALA  443
             V  +L+A+ 
Sbjct  465  RVSSELAAMG  474



>ref|XP_004968529.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Setaria italica]
Length=517

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ
Sbjct  399  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELINILEEAGQ  458

Query  472  IVPPQLSALA  443
             V  +L+A+ 
Sbjct  459  KVSSELAAMG  468



>ref|NP_001234650.1| ethylene-responsive RNA helicase [Solanum lycopersicum]
 gb|AAD46404.1|AF096248_1 ethylene-responsive RNA helicase [Solanum lycopersicum]
Length=474

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA++LV IL++AGQ
Sbjct  379  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFFTAANARFAKDLVNILEEAGQ  438

Query  472  IVPPQLSAL  446
             V P+L+ +
Sbjct  439  KVSPELAKM  447



>ref|XP_010314157.1| PREDICTED: ethylene-responsive RNA helicase isoform X1 [Solanum 
lycopersicum]
Length=501

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA++LV IL++AGQ
Sbjct  406  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFFTAANARFAKDLVNILEEAGQ  465

Query  472  IVPPQLSAL  446
             V P+L+ +
Sbjct  466  KVSPELAKM  474



>ref|XP_011072507.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Sesamum indicum]
Length=507

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ
Sbjct  412  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQ  471

Query  472  IVPPQLSALA  443
             V P+L A+ 
Sbjct  472  KVSPELVAMG  481



>ref|XP_006366150.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006366151.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Solanum tuberosum]
Length=501

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA++LV IL++AGQ
Sbjct  406  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFFTAANARFAKDLVNILEEAGQ  465

Query  472  IVPPQLSAL  446
             V P+L+ +
Sbjct  466  KVGPELAKM  474



>ref|XP_006645603.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Oryza 
brachyantha]
Length=485

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ
Sbjct  392  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQ  451

Query  472  IVPPQLSALA  443
             V P+L+ + 
Sbjct  452  KVSPELANMG  461



>ref|XP_008673096.1| PREDICTED: putative DEAD-box ATP-dependent RNA helicase family 
protein isoform X1 [Zea mays]
Length=539

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+A+TFF   ++K+A ELVKIL+ A Q
Sbjct  333  DIKDIRIVVNYDFPTGVEDYVHRIGRTGRAGATGSAYTFFGDQDSKYASELVKILEGANQ  392

Query  472  IVPPQLSALA  443
             VPPQL  +A
Sbjct  393  SVPPQLKEMA  402



>gb|EEC70110.1| hypothetical protein OsI_00766 [Oryza sativa Indica Group]
Length=470

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ
Sbjct  377  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQ  436

Query  472  IVPPQLSALA  443
             V P+L+ + 
Sbjct  437  KVSPELANMG  446



>ref|XP_009625322.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
tomentosiformis]
Length=501

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+T+FT  NA+FA++L+ IL++AGQ
Sbjct  406  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTYFTAANARFAKDLINILEEAGQ  465

Query  472  IVPPQLSAL  446
             V P+L+ +
Sbjct  466  KVSPELAKM  474



>ref|XP_009802114.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
sylvestris]
Length=501

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+T+FT  NA+FA++L+ IL++AGQ
Sbjct  406  DVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTYFTAANARFAKDLINILEEAGQ  465

Query  472  IVPPQLSAL  446
             V P+L+ +
Sbjct  466  KVSPELAKM  474



>gb|EEE54050.1| hypothetical protein OsJ_00740 [Oryza sativa Japonica Group]
Length=468

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ
Sbjct  375  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQ  434

Query  472  IVPPQLSALA  443
             V P+L+ + 
Sbjct  435  KVSPELANMG  444



>sp|Q5QMN3.2|RH20_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 20 [Oryza sativa 
Japonica Group]
Length=494

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ
Sbjct  401  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQ  460

Query  472  IVPPQLSALA  443
             V P+L+ + 
Sbjct  461  KVSPELANMG  470



>gb|KCW55996.1| hypothetical protein EUGRSUZ_I01775 [Eucalyptus grandis]
Length=246

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TFF+  +AK+A EL+K+L+ A Q
Sbjct  81   DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGASGLAHTFFSDQDAKYAAELIKVLEGANQ  140

Query  472  IVPPQLSALAC  440
             VPP++  +A 
Sbjct  141  RVPPEIRNMAS  151



>emb|CDY02459.1| BnaA08g00660D [Brassica napus]
Length=499

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+ELV IL++AGQ
Sbjct  407  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAKELVSILEEAGQ  466

Query  472  IVPPQLSALA  443
             V  +L+++ 
Sbjct  467  KVSHELASMG  476



>ref|XP_009106904.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Brassica rapa]
Length=499

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+ELV IL++AGQ
Sbjct  407  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAKELVSILEEAGQ  466

Query  472  IVPPQLSALA  443
             V  +L+++ 
Sbjct  467  KVSHELASMG  476



>ref|XP_011011886.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
14-like [Populus euphratica]
Length=788

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+LQ A Q
Sbjct  471  DIKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGVAYTFFGDQDAKYASDLIKVLQGANQ  530

Query  472  IVPPQLSALA  443
            +VPP++ A+A
Sbjct  531  LVPPEIRAMA  540



>ref|XP_001763089.1| predicted protein [Physcomitrella patens]
 gb|EDQ71966.1| predicted protein [Physcomitrella patens]
Length=514

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIKCVINYDFP   EDYVHRIGRTGRAGAKG A+TFFT  NAK A+ELV IL +AGQ
Sbjct  404  DVKDIKCVINYDFPGSCEDYVHRIGRTGRAGAKGAAYTFFTAANAKHAKELVSILVEAGQ  463

Query  472  IVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  323
             V  QL A+        GG   R RG GG G     SGSNT+PLG +R W
Sbjct  464  PVSSQLQAMVGSSRGGGGGGFHRGRGFGGRGFGVQQSGSNTIPLGGQR-W  512



>gb|KCW55995.1| hypothetical protein EUGRSUZ_I01775 [Eucalyptus grandis]
Length=267

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TFF+  +AK+A EL+K+L+ A Q
Sbjct  102  DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGASGLAHTFFSDQDAKYAAELIKVLEGANQ  161

Query  472  IVPPQLSALAC  440
             VPP++  +A 
Sbjct  162  RVPPEIRNMAS  172



>ref|XP_010915213.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Elaeis guineensis]
Length=498

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ
Sbjct  402  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQ  461

Query  472  IVPPQLSALA  443
             V  +L+A+ 
Sbjct  462  KVSSELAAMG  471



>emb|CDY10596.1| BnaC03g70180D [Brassica napus]
Length=499

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+EL+ IL++AGQ
Sbjct  407  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAKELISILEEAGQ  466

Query  472  IVPPQLSALA  443
             V  +L+++ 
Sbjct  467  KVSHELASMG  476



>ref|XP_006306418.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
 gb|EOA39316.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
Length=499

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+ELV IL++AGQ
Sbjct  407  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELVNILEEAGQ  466

Query  472  IVPPQLSALA  443
             V  +L+++ 
Sbjct  467  KVSHELASMG  476



>gb|KCW55992.1| hypothetical protein EUGRSUZ_I01775 [Eucalyptus grandis]
 gb|KCW55993.1| hypothetical protein EUGRSUZ_I01775 [Eucalyptus grandis]
Length=320

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TFF+  +AK+A EL+K+L+ A Q
Sbjct  81   DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGASGLAHTFFSDQDAKYAAELIKVLEGANQ  140

Query  472  IVPPQLSALAC  440
             VPP++  +A 
Sbjct  141  RVPPEIRNMAS  151



>gb|KIP10983.1| hypothetical protein PHLGIDRAFT_171911 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=116

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ IL++A  
Sbjct  32   DVKDVGYVINYDFPNNCEDYIHRIGRTGRAGLKGTSYTYFTTDNAKSARELITILREAKA  91

Query  472  IVPPQLSALA  443
            IVPPQL  ++
Sbjct  92   IVPPQLEEMS  101



>gb|KFK38698.1| hypothetical protein AALP_AA3G148400 [Arabis alpina]
Length=499

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+  VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+ELV ILQ+AGQ
Sbjct  407  DVKDVMYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELVNILQEAGQ  466

Query  472  IVPPQLSALA  443
             V  +L+++ 
Sbjct  467  KVSSELASMG  476



>gb|KCW55994.1| hypothetical protein EUGRSUZ_I01775 [Eucalyptus grandis]
Length=349

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TFF+  +AK+A EL+K+L+ A Q
Sbjct  81   DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGASGLAHTFFSDQDAKYAAELIKVLEGANQ  140

Query  472  IVPPQLSALAC  440
             VPP++  +A 
Sbjct  141  RVPPEIRNMAS  151



>emb|CDM81540.1| unnamed protein product [Triticum aestivum]
Length=496

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA++FFT  NA+FA++L+ IL +AGQ
Sbjct  403  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGATGTAYSFFTAANARFAKDLISILVEAGQ  462

Query  472  IVPPQLSALA  443
             V P+L+ + 
Sbjct  463  KVSPELANMG  472



>ref|XP_003564953.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Brachypodium 
distachyon]
Length=496

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA++L+ IL +AGQ
Sbjct  403  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGATGTAYTFFTAANARFAKDLINILVEAGQ  462

Query  472  IVPPQLSALA  443
             V P+L+ + 
Sbjct  463  KVSPELANMG  472



>ref|XP_002324002.1| hypothetical protein POPTR_0017s10760g [Populus trichocarpa]
 gb|EEF04135.1| hypothetical protein POPTR_0017s10760g [Populus trichocarpa]
Length=726

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q
Sbjct  463  DIKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGVAYTFFGDQDAKYASDLIKVLEGANQ  522

Query  472  IVPPQLSALA  443
            +VPP++ A+A
Sbjct  523  LVPPEIRAMA  532



>ref|NP_001168054.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
 gb|ACN26946.1| unknown [Zea mays]
 tpg|DAA53249.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=672

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+A+TFF   ++K+A ELVKIL+ A Q
Sbjct  466  DIKDIRIVVNYDFPTGVEDYVHRIGRTGRAGATGSAYTFFGDQDSKYASELVKILEGANQ  525

Query  472  IVPPQLSALA  443
             VPPQL  +A
Sbjct  526  SVPPQLKEMA  535



>gb|EPB85904.1| hypothetical protein HMPREF1544_07320 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=625

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFPT +EDYVHR+GRTGR G  G +FTFFT  NA+ ARELV ILQQ  Q
Sbjct  507  DVKDVKFVINYDFPTNIEDYVHRVGRTGRGGNTGHSFTFFTADNARQARELVDILQQTNQ  566

Query  472  IVPPQLSAL  446
            +V P+L  L
Sbjct  567  VVDPRLQML  575



>ref|XP_002970463.1| hypothetical protein SELMODRAFT_441099 [Selaginella moellendorffii]
 gb|EFJ28593.1| hypothetical protein SELMODRAFT_441099 [Selaginella moellendorffii]
Length=1198

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TFF   + K+AR+L+K+L+ A Q
Sbjct  489  DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAHTFFAEQDGKYARDLIKVLEGANQ  548

Query  472  IVPPQLSALA  443
             VPP+L  +A
Sbjct  549  KVPPELREMA  558



>ref|XP_003032253.1| hypothetical protein SCHCODRAFT_82297 [Schizophyllum commune 
H4-8]
 gb|EFI97350.1| hypothetical protein SCHCODRAFT_82297 [Schizophyllum commune 
H4-8]
Length=488

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI  VINYDFP   EDY+HRIGRTGRAGAKGTA+T+FT  NAK ARELV IL +A Q
Sbjct  372  DVKDIGYVINYDFPNNCEDYIHRIGRTGRAGAKGTAYTYFTTENAKSARELVSILTEAKQ  431

Query  472  IVPPQLSALAC  440
            +VPP+L  +A 
Sbjct  432  VVPPELQEMAA  442



>emb|CDO77180.1| hypothetical protein BN946_scf184705.g5 [Trametes cinnabarina]
Length=148

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD++ VINYDFP   EDY+HRIGRTGRAG  GT++T+FT  NAK AREL+ IL++A  
Sbjct  35   DVKDVRYVINYDFPNNCEDYIHRIGRTGRAGMTGTSYTYFTTDNAKQARELIGILKEANA  94

Query  472  IVPPQLSALA  443
             VPPQL  +A
Sbjct  95   QVPPQLEEMA  104



>ref|XP_008654141.1| PREDICTED: ATP-dependent RNA helicase-like protein DB10 [Zea 
mays]
Length=130

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDIK VINYDFPT +EDYVHRIGRTGRAGA G ++TFF+  + K A +LVK+LQ   Q
Sbjct  53   DIKDIKVVINYDFPTGIEDYVHRIGRTGRAGATGVSYTFFSEHDWKHAGDLVKLLQGVNQ  112

Query  472  IVPPQLSALAC  440
             VPPQL  +A 
Sbjct  113  HVPPQLRDMAA  123



>dbj|GAN02653.1| ATP-dependent RNA helicase dbp-2 [Mucor ambiguus]
Length=880

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFPT +EDYVHR+GRTGR G  G +FTFFT  NA+ ARE+V ILQQ  Q
Sbjct  507  DVKDVKFVINYDFPTNIEDYVHRVGRTGRGGNTGHSFTFFTADNARQAREMVDILQQTNQ  566

Query  472  IVPPQLSAL  446
            +V P+L  L
Sbjct  567  VVDPRLQML  575



>gb|KHN25107.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=378

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDF   LEDYVHRIGR GRAGAKGTA+ +FT  NA+FA++L+ IL++AGQ
Sbjct  293  DVKDVKYVINYDFRGSLEDYVHRIGRIGRAGAKGTAYPYFTAANARFAKDLIAILEEAGQ  352

Query  472  IVPPQLSALAC  440
             V P+L+A+  
Sbjct  353  KVSPELAAMGS  363



>ref|XP_006675622.1| hypothetical protein BATDEDRAFT_29115 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83025.1| hypothetical protein BATDEDRAFT_29115 [Batrachochytrium dendrobatidis 
JAM81]
Length=483

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VIN+DFP  +EDYVHRIGRTGRA  KGTA+T F+  N K AR+LVKIL++AGQ
Sbjct  367  DVKDVKFVINFDFPNNIEDYVHRIGRTGRANNKGTAYTLFSPDNFKSARDLVKILEEAGQ  426

Query  472  IVPPQLSALA  443
            +V PQL   A
Sbjct  427  VVDPQLHDFA  436



>gb|EYU21378.1| hypothetical protein MIMGU_mgv1a004869mg [Erythranthe guttata]
Length=506

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA++L+ IL++AGQ
Sbjct  413  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTVANARFAKDLINILEEAGQ  472

Query  472  IVPPQLSALA  443
             V  +L A+ 
Sbjct  473  KVSSELVAMG  482



>ref|XP_001771533.1| predicted protein [Physcomitrella patens]
 gb|EDQ63733.1| predicted protein [Physcomitrella patens]
Length=684

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF+  + K+A+EL+K+L+ A Q
Sbjct  459  DIKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGLAYTFFSEQDGKYAKELIKVLEGANQ  518

Query  472  IVPPQLSALA  443
             VPP+L  +A
Sbjct  519  KVPPELKDIA  528



>ref|XP_004304637.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14 isoform X1 
[Fragaria vesca subsp. vesca]
Length=678

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A EL+K+L+ A Q
Sbjct  477  DVKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKYAAELIKVLEGANQ  536

Query  472  IVPPQLSALA  443
             VPP++  LA
Sbjct  537  RVPPEIRDLA  546



>ref|XP_010534902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Tarenaya hassleriana]
Length=504

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+F ++L+ IL++A Q
Sbjct  409  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFVKDLINILEEAEQ  468

Query  472  IVPPQLSAL  446
             V P+L+A+
Sbjct  469  RVSPELAAM  477



>ref|XP_010534903.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Tarenaya hassleriana]
Length=432

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+F ++L+ IL++A Q
Sbjct  337  DVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFVKDLINILEEAEQ  396

Query  472  IVPPQLSAL  446
             V P+L+A+
Sbjct  397  RVSPELAAM  405



>ref|XP_004968358.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like isoform 
X5 [Setaria italica]
Length=672

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+AFTFF   ++K+A +LVKIL+ A Q
Sbjct  466  DIKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGSAFTFFGDQDSKYASDLVKILEGADQ  525

Query  472  IVPPQLSALA  443
             VPPQL  +A
Sbjct  526  SVPPQLKEMA  535



>ref|XP_002987999.1| hypothetical protein SELMODRAFT_269342 [Selaginella moellendorffii]
 gb|EFJ10791.1| hypothetical protein SELMODRAFT_269342 [Selaginella moellendorffii]
Length=505

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI+ VINYDFP   EDYVHRIGRTGRAGAKGTA+TFFT  NAK ARELV IL +AGQ
Sbjct  395  DVKDIRYVINYDFPGSCEDYVHRIGRTGRAGAKGTAYTFFTVSNAKHARELVSILSEAGQ  454

Query  472  IVPPQLSAL  446
             + P+L ++
Sbjct  455  RITPELQSM  463



>ref|XP_002972931.1| hypothetical protein SELMODRAFT_98552 [Selaginella moellendorffii]
 gb|EFJ26152.1| hypothetical protein SELMODRAFT_98552 [Selaginella moellendorffii]
Length=534

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI+ VINYDFP   EDYVHRIGRTGRAGAKGTA+TFFT  NAK ARELV IL +AGQ
Sbjct  400  DVKDIRYVINYDFPGSCEDYVHRIGRTGRAGAKGTAYTFFTVSNAKHARELVSILSEAGQ  459

Query  472  IVPPQLSAL  446
             + P+L ++
Sbjct  460  RITPELQSM  468



>ref|XP_006840690.1| hypothetical protein AMTR_s00096p00079870 [Amborella trichopoda]
 gb|ERN02365.1| hypothetical protein AMTR_s00096p00079870 [Amborella trichopoda]
Length=766

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G ++TFF+  +AK+A +L+K+L+ AGQ
Sbjct  469  DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGISYTFFSDQDAKYASDLIKVLEGAGQ  528

Query  472  IVPPQLSALA  443
             VPP +  +A
Sbjct  529  RVPPDIRNMA  538



>ref|XP_005710055.1| ATP-dependent RNA helicase DBP2, putative [Chondrus crispus]
 emb|CDF39761.1| ATP-dependent RNA helicase DBP2, putative [Chondrus crispus]
Length=585

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVK ++CVIN+DFP  +EDYVHRIGRTGRAGAKGT+ T FT  N+K AR+L+++++ AGQ
Sbjct  487  DVKAVQCVINFDFPNNVEDYVHRIGRTGRAGAKGTSITLFTSNNSKSARDLIQLMRDAGQ  546

Query  472  IVPPQLSALA  443
             +PP+L  LA
Sbjct  547  EIPPKLEELA  556



>gb|EXX56938.1| Dbp2p [Rhizophagus irregularis DAOM 197198w]
Length=601

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFPT +EDYVHRIGRTGR GAKG+A TFFT  NAK A++LV IL++A Q
Sbjct  505  DVKDVKLVINYDFPTNVEDYVHRIGRTGRGGAKGSATTFFTMDNAKQAKDLVNILREANQ  564

Query  472  IVPPQLSALA  443
             V P+L+ LA
Sbjct  565  EVDPKLADLA  574



>ref|XP_004968355.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like isoform 
X2 [Setaria italica]
Length=668

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+AFTFF   ++K+A +LVKIL+ A Q
Sbjct  466  DIKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGSAFTFFGDQDSKYASDLVKILEGADQ  525

Query  472  IVPPQLSALA  443
             VPPQL  +A
Sbjct  526  SVPPQLKEMA  535



>ref|XP_010550155.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14 [Tarenaya hassleriana]
Length=653

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G AFTF    +AK A +L+KIL+ A Q
Sbjct  477  DIKDIRVVINYDFPTGIEDYVHRIGRTGRAGATGMAFTFLGEQDAKHASDLIKILEGASQ  536

Query  472  IVPPQLSALA  443
             VPPQ+  +A
Sbjct  537  KVPPQIREMA  546



>gb|KIM40445.1| hypothetical protein M413DRAFT_73199 [Hebeloma cylindrosporum 
h7]
Length=489

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK AREL+ IL++A  
Sbjct  372  DVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGISYTYFTTDNAKSARELIGILREAKA  431

Query  472  IVPPQLSALAC  440
            IVPPQL  +A 
Sbjct  432  IVPPQLEEMAS  442



>ref|XP_004968357.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like isoform 
X4 [Setaria italica]
Length=667

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+AFTFF   ++K+A +LVKIL+ A Q
Sbjct  466  DIKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGSAFTFFGDQDSKYASDLVKILEGADQ  525

Query  472  IVPPQLSALA  443
             VPPQL  +A
Sbjct  526  SVPPQLKEMA  535



>ref|XP_010029150.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
14 [Eucalyptus grandis]
Length=707

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TFF+  +AK+A EL+K+L+ A Q
Sbjct  468  DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGASGLAHTFFSDQDAKYAAELIKVLEGANQ  527

Query  472  IVPPQLSALA  443
             VPP++  +A
Sbjct  528  RVPPEIRNMA  537



>ref|XP_004968356.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like isoform 
X3 [Setaria italica]
Length=668

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+AFTFF   ++K+A +LVKIL+ A Q
Sbjct  466  DIKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGSAFTFFGDQDSKYASDLVKILEGADQ  525

Query  472  IVPPQLSALA  443
             VPPQL  +A
Sbjct  526  SVPPQLKEMA  535



>ref|XP_005850349.1| hypothetical protein CHLNCDRAFT_30080, partial [Chlorella variabilis]
 gb|EFN58247.1| hypothetical protein CHLNCDRAFT_30080, partial [Chlorella variabilis]
Length=551

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIK VINYD P+  EDYVHRIGRTGRAGA G A++FFT  N + AR+LV+IL++A Q
Sbjct  438  DVKDIKMVINYDMPSCAEDYVHRIGRTGRAGASGAAYSFFTAANGRMARQLVQILEEASQ  497

Query  472  IVPPQLSALA  443
             VPP+L   A
Sbjct  498  AVPPELRQFA  507



>emb|CDS08010.1| hypothetical protein LRAMOSA01959 [Absidia idahoensis var. thermophila]
Length=633

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+K VINYDFPT +EDYVHR+GRTGR GAKG AFTFFT  NA+ ARELV IL++  Q
Sbjct  515  DVKDVKFVINYDFPTNIEDYVHRVGRTGRGGAKGQAFTFFTTDNARQARELVGILRETNQ  574

Query  472  IVPPQLSALAC  440
            ++ P+L  ++ 
Sbjct  575  VIDPRLEMMST  585



>ref|XP_008341438.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like [Malus 
domestica]
Length=667

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q
Sbjct  472  DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKYASDLIKVLEGANQ  531

Query  472  IVPPQLSALA  443
             VPP++  LA
Sbjct  532  CVPPEVRELA  541



>gb|KIM84767.1| hypothetical protein PILCRDRAFT_96565 [Piloderma croceum F 1598]
Length=482

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK ARELV IL++A  
Sbjct  372  DVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGISYTYFTTDNAKSARELVTILREAKA  431

Query  472  IVPPQLSALAC  440
            +VPPQL  +A 
Sbjct  432  VVPPQLEEMAM  442



>emb|CCM04686.1| predicted protein [Fibroporia radiculosa]
Length=755

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ IL++A  
Sbjct  638  DVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGTSYTYFTTDNAKSARELISILREAKA  697

Query  472  IVPPQLSALA  443
            IVPPQL  +A
Sbjct  698  IVPPQLEEMA  707



>ref|XP_004968354.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like isoform 
X1 [Setaria italica]
Length=702

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+AFTFF   ++K+A +LVKIL+ A Q
Sbjct  466  DIKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGSAFTFFGDQDSKYASDLVKILEGADQ  525

Query  472  IVPPQLSALA  443
             VPPQL  +A
Sbjct  526  SVPPQLKEMA  535



>ref|XP_008039863.1| DEAD-domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW57832.1| DEAD-domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=494

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD++ VINYDFP   EDY+HRIGRTGRAG  GT+FT+FT  NAK AREL+ IL++A  
Sbjct  372  DVKDVRYVINYDFPNNCEDYIHRIGRTGRAGTTGTSFTYFTTDNAKQARELIGILKEAKA  431

Query  472  IVPPQLSALAC  440
            +VPPQL  ++ 
Sbjct  432  VVPPQLEEMSM  442



>ref|XP_736707.1| helicase [Plasmodium chabaudi chabaudi]
 emb|CAH85853.1| helicase, putative [Plasmodium chabaudi chabaudi]
Length=158

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KD+K VINYDFP  +EDYVHRIGRTGRAGA G +FTF T    + A+ELVKIL+++ Q
Sbjct  71   DIKDVKFVINYDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLAKELVKILRESEQ  130

Query  472  IVPPQLSALA  443
             +PPQL  ++
Sbjct  131  PIPPQLEKIS  140



>gb|KII89609.1| hypothetical protein PLICRDRAFT_158683 [Plicaturopsis crispa 
FD-325 SS-3]
Length=493

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK ARELV IL++A  
Sbjct  372  DVKDVGYVINYDFPNNCEDYIHRIGRTGRAGNKGISYTYFTTDNAKSARELVGILREANA  431

Query  472  IVPPQLSALAC  440
            ++PPQL  +A 
Sbjct  432  VIPPQLEEMAM  442



>ref|XP_009375127.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like [Pyrus 
x bretschneideri]
 ref|XP_009377198.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like [Pyrus 
x bretschneideri]
Length=667

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q
Sbjct  472  DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKYASDLIKVLEGANQ  531

Query  472  IVPPQLSALA  443
             VPP++  LA
Sbjct  532  RVPPEIRELA  541



>emb|CBI34896.3| unnamed protein product [Vitis vinifera]
Length=1180

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +LVK+L+ A Q
Sbjct  331  DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGVAYTFFAEQDAKYASDLVKVLEGANQ  390

Query  472  IVPPQLSALA  443
             VPP++  +A
Sbjct  391  RVPPEIRDMA  400



>ref|XP_007330446.1| hypothetical protein AGABI1DRAFT_100622 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM78570.1| hypothetical protein AGABI1DRAFT_100622 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=494

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ IL++A  
Sbjct  372  DVKDVGYVINYDFPNNCEDYIHRIGRTGRAGLKGTSYTYFTTENAKAARELINILREAKA  431

Query  472  IVPPQLSALAC  440
            ++PPQL  +A 
Sbjct  432  VIPPQLEEMAA  442



>ref|XP_006459201.1| hypothetical protein AGABI2DRAFT_65810 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV49124.1| hypothetical protein AGABI2DRAFT_65810 [Agaricus bisporus var. 
bisporus H97]
Length=494

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ IL++A  
Sbjct  372  DVKDVGYVINYDFPNNCEDYIHRIGRTGRAGLKGTSYTYFTTENAKAARELINILREAKA  431

Query  472  IVPPQLSALAC  440
            ++PPQL  +A 
Sbjct  432  VIPPQLEEMAA  442



>ref|XP_006958620.1| p68 RNA helicase [Wallemia sebi CBS 633.66]
 gb|EIM21267.1| p68 RNA helicase [Wallemia sebi CBS 633.66]
Length=546

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI  VINYDF + +EDY+HRIGRTGRAG KGT+ TFFT  NAK +R+LVKIL++A Q
Sbjct  432  DVKDIGYVINYDFSSNVEDYIHRIGRTGRAGTKGTSITFFTTENAKSSRDLVKILREANQ  491

Query  472  IVPPQLSALAC  440
             VPP+L  +A 
Sbjct  492  NVPPELEEMAS  502



>ref|XP_008379232.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like [Malus 
domestica]
Length=673

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q
Sbjct  473  DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKYASDLIKVLEGANQ  532

Query  472  IVPPQLSALA  443
             VPP++  LA
Sbjct  533  RVPPEVRELA  542



>ref|XP_009334108.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14 [Pyrus x bretschneideri]
Length=675

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q
Sbjct  473  DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKYASDLIKVLEGANQ  532

Query  472  IVPPQLSALA  443
             VPP++  LA
Sbjct  533  RVPPEVRELA  542



>ref|XP_744215.1| helicase  [Plasmodium chabaudi chabaudi]
 emb|CAH74440.1| helicase, truncated, putative [Plasmodium chabaudi chabaudi]
Length=186

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KD+K VINYDFP  +EDYVHRIGRTGRAGA G +FTF T    + A+ELVKIL+++ Q
Sbjct  84   DIKDVKFVINYDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLAKELVKILRESEQ  143

Query  472  IVPPQLSALA  443
             +PPQL  ++
Sbjct  144  PIPPQLEKIS  153



>ref|XP_004164821.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 46-like [Cucumis 
sativus]
Length=778

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFP+ +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+KIL+ A Q
Sbjct  470  DIKDIRVVINYDFPSGVEDYVHRIGRTGRAGATGIAYTFFGEQDAKYASDLIKILEGANQ  529

Query  472  IVPPQLSALA  443
             VPP+L  +A
Sbjct  530  RVPPELRDMA  539



>gb|KGN59687.1| hypothetical protein Csa_3G838660 [Cucumis sativus]
Length=840

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFP+ +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+KIL+ A Q
Sbjct  532  DIKDIRVVINYDFPSGVEDYVHRIGRTGRAGATGIAYTFFGEQDAKYASDLIKILEGANQ  591

Query  472  IVPPQLSALA  443
             VPP+L  +A
Sbjct  592  RVPPELRDMA  601



>ref|XP_008439374.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 40-like, partial 
[Cucumis melo]
Length=603

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF+  + KFA +L+K+L+ A Q
Sbjct  255  DIKDIRVVINYDFPTGIEDYVHRIGRTGRAGATGVAYTFFSEQDWKFAADLIKVLEGAEQ  314

Query  472  IVPPQLSALA  443
             VPP+L  +A
Sbjct  315  PVPPELQNMA  324



>ref|XP_004141097.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
46-like [Cucumis sativus]
Length=785

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFP+ +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+KIL+ A Q
Sbjct  477  DIKDIRVVINYDFPSGVEDYVHRIGRTGRAGATGIAYTFFGEQDAKYASDLIKILEGANQ  536

Query  472  IVPPQLSALA  443
             VPP+L  +A
Sbjct  537  RVPPELRDMA  546



>gb|KIK10334.1| hypothetical protein K443DRAFT_146564 [Laccaria amethystina LaAM-08-1]
Length=223

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK AREL+ IL++A  
Sbjct  97   DVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGISYTYFTTDNAKSARELIGILREAKA  156

Query  472  IVPPQLSALA  443
             VPPQL  +A
Sbjct  157  TVPPQLEEMA  166



>gb|KJA13443.1| hypothetical protein HYPSUDRAFT_73013 [Hypholoma sublateritium 
FD-334 SS-4]
Length=482

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  N+K ARELV IL++A  
Sbjct  356  DVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGISYTYFTTDNSKCARELVGILKEAKA  415

Query  472  IVPPQLSALAC  440
            IVPPQL  +A 
Sbjct  416  IVPPQLEEMAS  426



>gb|KHN85192.1| putative ATP-dependent RNA helicase DDX17 [Toxocara canis]
Length=763

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -2

Query  649  VKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQI  470
            V DIK VINYD+P   EDYVHRIGRT R   KGTA+TFFT  NA  AR+L+K++Q+A Q+
Sbjct  638  VDDIKFVINYDYPNNSEDYVHRIGRTARCEKKGTAYTFFTPSNAPKARDLIKVMQEANQV  697

Query  469  VPPQLSALA  443
            VPPQL  LA
Sbjct  698  VPPQLMELA  706



>ref|XP_008443543.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 46 [Cucumis melo]
Length=778

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFP+ +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+KIL+ A Q
Sbjct  473  DIKDIRVVINYDFPSGVEDYVHRIGRTGRAGATGIAYTFFGEQDAKYASDLIKILEGANQ  532

Query  472  IVPPQLSALA  443
             VPP+L  +A
Sbjct  533  RVPPELRDMA  542



>ref|XP_004159856.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
40-like [Cucumis sativus]
Length=1142

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VIN+DFPT +EDYVHRIGRTGRAGA G A+TFF+  + KFA +L+K+L+ AGQ
Sbjct  804  DIKDIRVVINFDFPTGIEDYVHRIGRTGRAGATGVAYTFFSEQDWKFASDLIKVLEGAGQ  863

Query  472  IVPPQLSALA  443
             VPP+L  +A
Sbjct  864  PVPPELRNMA  873



>gb|KDP46436.1| hypothetical protein JCGZ_10276 [Jatropha curcas]
Length=765

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q
Sbjct  469  DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGVAYTFFGDQDAKYASDLIKVLEGASQ  528

Query  472  IVPPQLSALA  443
             VPP++  +A
Sbjct  529  RVPPEIRDMA  538



>ref|XP_007414813.1| hypothetical protein MELLADRAFT_78893 [Melampsora larici-populina 
98AG31]
 gb|EGG01979.1| hypothetical protein MELLADRAFT_78893 [Melampsora larici-populina 
98AG31]
Length=537

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+  VINYD P  +EDY+HRIGRTGRAG  GTA+++ +    K ARELVKILQ A Q
Sbjct  418  DVKDVAYVINYDMPNGIEDYIHRIGRTGRAGRTGTAYSYISADQGKLARELVKILQDAKQ  477

Query  472  IVPPQLSALAC  440
            +VPP L  L+ 
Sbjct  478  VVPPALVELSS  488



>ref|XP_010524303.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14 [Tarenaya hassleriana]
Length=639

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TF    + K A +L+KIL+ A Q
Sbjct  478  DIKDIRVVINYDFPTGIEDYVHRIGRTGRAGATGLAHTFIGEQDGKHASDLIKILEGANQ  537

Query  472  IVPPQLSALAC  440
             VPP++  +A 
Sbjct  538  RVPPEIREMAS  548



>ref|XP_010660890.1| PREDICTED: ATP-dependent RNA helicase-like protein DB10 isoform 
X2 [Vitis vinifera]
Length=862

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +LVK+L+ A Q
Sbjct  471  DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGVAYTFFAEQDAKYASDLVKVLEGANQ  530

Query  472  IVPPQLSALA  443
             VPP++  +A
Sbjct  531  RVPPEIRDMA  540



>ref|XP_002521446.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF40936.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=781

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q
Sbjct  472  DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGVAYTFFGDQDAKYASDLIKVLEGASQ  531

Query  472  IVPPQLSALA  443
             VPP++  +A
Sbjct  532  RVPPEIRDMA  541



>gb|KDQ24573.1| hypothetical protein PLEOSDRAFT_1090372 [Pleurotus ostreatus 
PC15]
Length=523

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+  VINYDFP   EDY+HRIGRTGRAG  GT++T+FT  NAK ARELV IL++A  
Sbjct  407  DVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMTGTSYTYFTTDNAKSARELVGILREAKA  466

Query  472  IVPPQLSALAC  440
            ++PPQL  +  
Sbjct  467  VIPPQLEEMTM  477



>ref|XP_002273908.2| PREDICTED: ATP-dependent RNA helicase-like protein DB10 isoform 
X1 [Vitis vinifera]
Length=863

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +LVK+L+ A Q
Sbjct  472  DIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGVAYTFFAEQDAKYASDLVKVLEGANQ  531

Query  472  IVPPQLSALA  443
             VPP++  +A
Sbjct  532  RVPPEIRDMA  541



>ref|XP_008439373.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 40-like [Cucumis 
melo]
Length=1106

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF+  + KF+ +L+K+L+ AGQ
Sbjct  758  DIKDIRVVINYDFPTGIEDYVHRIGRTGRAGATGVAYTFFSEQDWKFSSDLIKVLEGAGQ  817

Query  472  IVPPQLSALA  443
             VPP+L  +A
Sbjct  818  PVPPELRNMA  827



>gb|KGN57060.1| hypothetical protein Csa_3G151370 [Cucumis sativus]
Length=1193

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VIN+DFPT +EDYVHRIGRTGRAGA G A+TFF+  + KFA +L+K+L+ AGQ
Sbjct  855  DIKDIRVVINFDFPTGIEDYVHRIGRTGRAGATGVAYTFFSEQDWKFASDLIKVLEGAGQ  914

Query  472  IVPPQLSALA  443
             VPP+L  +A
Sbjct  915  PVPPELRNMA  924



>emb|CDR95325.1| p68-like protein, putative [Babesia bigemina]
Length=535

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DV+D+K VIN+DFP  +EDYVHRIGRTGR G KG ++TF T    + ARELVK++++A Q
Sbjct  422  DVRDVKVVINFDFPNQIEDYVHRIGRTGRGGNKGASYTFLTPDKGRIARELVKLMREANQ  481

Query  472  IVPPQLSALA  443
             + P+LS LA
Sbjct  482  TISPELSKLA  491



>ref|XP_004134467.1| PREDICTED: uncharacterized protein LOC101206109 [Cucumis sativus]
Length=1152

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VIN+DFPT +EDYVHRIGRTGRAGA G A+TFF+  + KFA +L+K+L+ AGQ
Sbjct  814  DIKDIRVVINFDFPTGIEDYVHRIGRTGRAGATGVAYTFFSEQDWKFASDLIKVLEGAGQ  873

Query  472  IVPPQLSALA  443
             VPP+L  +A
Sbjct  874  PVPPELRNMA  883



>emb|CDI80731.1| hypothetical protein, conserved [Eimeria acervulina]
Length=199

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI+ VIN+D P  +EDYVHRIGRTGRAGAKG A+TFFT    + AR+LV++L++A Q
Sbjct  85   DVKDIRHVINFDMPNQIEDYVHRIGRTGRAGAKGNAYTFFTTDKQRLARDLVRVLKEANQ  144

Query  472  IVPPQLSAL  446
             VPP+L AL
Sbjct  145  TVPPELEAL  153



>ref|XP_004349647.1| ATPdependent RNA helicase dbp2, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR22559.1| ATPdependent RNA helicase dbp2, putative [Acanthamoeba castellanii 
str. Neff]
Length=706

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD++ VINYDF +  EDYVHRIGRTGRAGA GTA++FFT G+ K A+ L+K+L +AGQ
Sbjct  512  DVKDVRYVINYDFASTAEDYVHRIGRTGRAGATGTAYSFFTSGDFKLAKRLIKVLSEAGQ  571

Query  472  IVPPQLSALA  443
             VPPQL   A
Sbjct  572  EVPPQLHQFA  581



>emb|CDI51261.1| p68-like protein [Melanopsichium pennsylvanicum 4]
Length=131

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI  VINYDFPT  EDYVH+IGRTGRAG  GTA+T+FT  N+K AREL+ IL++A Q
Sbjct  20   DVKDISYVINYDFPTNTEDYVHQIGRTGRAGRTGTAYTYFTPENSKSARELIGILREAKQ  79

Query  472  IVPPQLSAL  446
             +P ++  +
Sbjct  80   DIPREIEEM  88



>ref|XP_005705091.1| DEAD-box family RNA-dependent helicase [Galdieria sulphuraria]
 gb|EME28571.1| DEAD-box family RNA-dependent helicase [Galdieria sulphuraria]
Length=160

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KD+K VINYDFP  +EDYVHRIGRTGRAGA G + TFFT    + A+ELV +L++AGQ
Sbjct  45   DIKDVKYVINYDFPHTIEDYVHRIGRTGRAGALGKSHTFFTPDKFRVAKELVNLLREAGQ  104

Query  472  IVPPQLSAL  446
             VPP+L+ L
Sbjct  105  DVPPELARL  113



>gb|KIZ00407.1| ATP-dependent RNA helicase DDX5/DBP2 [Monoraphidium neglectum]
Length=552

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIK V+N+D P   EDYVHRIGRTGRAGA GTA++FFT  N + ARE++KI+ +A Q
Sbjct  454  DVKDIKVVVNFDMPNNAEDYVHRIGRTGRAGATGTAYSFFTAANGRLAREIIKIMNEANQ  513

Query  472  IVPPQLSALAC  440
            +VP +L ++A 
Sbjct  514  VVPTELQSIAS  524



>ref|XP_006408522.1| hypothetical protein EUTSA_v10020294mg [Eutrema salsugineum]
 gb|ESQ49975.1| hypothetical protein EUTSA_v10020294mg [Eutrema salsugineum]
Length=629

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI+ VINYDFP  +EDYVHRIGRTGRAGA G AFTFF   ++K A +L+KIL+ A Q
Sbjct  476  DVKDIRAVINYDFPNGVEDYVHRIGRTGRAGATGQAFTFFGDQDSKHASDLIKILEGANQ  535

Query  472  IVPPQLSALAC  440
             VPPQ+  +A 
Sbjct  536  RVPPQIREMAT  546



>ref|XP_006408521.1| hypothetical protein EUTSA_v10020294mg [Eutrema salsugineum]
 gb|ESQ49974.1| hypothetical protein EUTSA_v10020294mg [Eutrema salsugineum]
Length=627

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI+ VINYDFP  +EDYVHRIGRTGRAGA G AFTFF   ++K A +L+KIL+ A Q
Sbjct  476  DVKDIRAVINYDFPNGVEDYVHRIGRTGRAGATGQAFTFFGDQDSKHASDLIKILEGANQ  535

Query  472  IVPPQLSALAC  440
             VPPQ+  +A 
Sbjct  536  RVPPQIREMAT  546



>ref|XP_010248506.1| PREDICTED: ATP-dependent RNA helicase-like protein DB10 [Nelumbo 
nucifera]
Length=877

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +LV++L+ A Q
Sbjct  480  DIKDIRVVINYDFPTGIEDYVHRIGRTGRAGATGVAYTFFCDQDAKYASDLVRVLEGANQ  539

Query  472  IVPPQLSALA  443
             VPP++  +A
Sbjct  540  RVPPEIRDMA  549



>ref|XP_003618186.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=619

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI+ V+N+DFPT +EDYVHRIGRTGRAGA G A+TFF   +AK A +L+KIL+ A Q
Sbjct  473  DVKDIRVVVNFDFPTGVEDYVHRIGRTGRAGATGIAYTFFGDQDAKHASDLIKILEGANQ  532

Query  472  IVPPQLSALAC  440
             VPP+L  L+ 
Sbjct  533  RVPPELRELSS  543



>dbj|BAF00715.1| DRH1 DEAD box protein - like [Arabidopsis thaliana]
Length=450

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI+ V+NYDFP  +EDYVHRIGRTGRAGA G A+TFF   +AK A +L+KIL+ A Q
Sbjct  275  DVKDIRVVVNYDFPNGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKHASDLIKILEGANQ  334

Query  472  IVPPQLSALAC  440
             VPPQ+  +A 
Sbjct  335  KVPPQVREMAT  345



>ref|XP_764197.1| RNA helicase [Theileria parva strain Muguga]
 gb|EAN31914.1| RNA helicase, putative [Theileria parva]
Length=635

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DV+D+K VINYDFP  +EDYVHRIGRTGRAG KG+++TF T    K ARELVK++++A Q
Sbjct  521  DVRDVKYVINYDFPGQIEDYVHRIGRTGRAGMKGSSYTFLTPDKFKSARELVKLMREANQ  580

Query  472  IVPPQLSALA  443
             +PP+L  LA
Sbjct  581  EIPPELQKLA  590



>gb|KIM24458.1| hypothetical protein M408DRAFT_75932 [Serendipita vermifera MAFF 
305830]
Length=493

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKD+  VINYDFP   EDY+HRIGRTGRAG  GTA+T+ T  N+K A ELV IL++A Q
Sbjct  372  DVKDVGYVINYDFPNNCEDYIHRIGRTGRAGKFGTAYTYLTTENSKIAHELVAILREAKQ  431

Query  472  IVPPQLSALA  443
            +VPPQL  ++
Sbjct  432  VVPPQLEEMS  441



>ref|XP_001690022.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
 gb|EDP09760.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
Length=513

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDIK V+NYD P   EDYVHRIGRTGRAGA GTA++FFT+G+A+ AR++V ++Q+AGQ
Sbjct  419  DVKDIKVVVNYDMPKTAEDYVHRIGRTGRAGATGTAYSFFTNGDARLARQVVDVMQEAGQ  478

Query  472  IVPPQLSAL  446
              PP+L  +
Sbjct  479  QPPPELMQM  487



>tpg|DAA42421.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=1298

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 46/70 (66%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            D+KDI+ VINYDFPT +EDYVHRIGRTGRAGA G ++TFF+  + K+A +LVK+LQ A Q
Sbjct  909  DIKDIRVVINYDFPTGIEDYVHRIGRTGRAGATGVSYTFFSEQDWKYACDLVKLLQGANQ  968

Query  472  IVPPQLSALA  443
            +VPPQL  +A
Sbjct  969  LVPPQLQDMA  978



>ref|NP_001190309.1| DEAD-box ATP-dependent RNA helicase 46 [Arabidopsis thaliana]
 sp|Q9LYJ9.2|RH46_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 46 [Arabidopsis 
thaliana]
 gb|AED92055.1| DEAD-box ATP-dependent RNA helicase 46 [Arabidopsis thaliana]
Length=645

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI+ V+NYDFP  +EDYVHRIGRTGRAGA G A+TFF   +AK A +L+KIL+ A Q
Sbjct  470  DVKDIRVVVNYDFPNGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKHASDLIKILEGANQ  529

Query  472  IVPPQLSALAC  440
             VPPQ+  +A 
Sbjct  530  KVPPQVREMAT  540



>gb|AAY84883.1| DEAD-box ATPase-RNA-helicase [Triticum aestivum]
Length=381

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF   ++K+A +LVKIL+ A Q
Sbjct  201  DVKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGIAYTFFCDQDSKYASDLVKILEGANQ  260

Query  472  IVPPQLSAL  446
             V P+L A+
Sbjct  261  NVSPELRAM  269



>emb|CDM81987.1| unnamed protein product [Triticum aestivum]
Length=650

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  652  DVKDIKCVINYDFPTXLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQ  473
            DVKDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF   ++K+A +LVKIL++A Q
Sbjct  470  DVKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGIAYTFFCDQDSKYASDLVKILERANQ  529

Query  472  IVPPQLSAL  446
             V P+L A+
Sbjct  530  NVSPELRAM  538



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250