BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF045H23

Length=553
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009591201.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    195   1e-55   Nicotiana tomentosiformis
ref|XP_009588089.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...    194   1e-55   Nicotiana tomentosiformis
ref|XP_009760674.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    194   2e-55   Nicotiana sylvestris
ref|XP_004242803.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    194   2e-55   Solanum lycopersicum
ref|XP_006362449.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    193   5e-55   Solanum tuberosum [potatoes]
ref|XP_002265238.2|  PREDICTED: probable tyrosine--tRNA ligase, m...    187   3e-53   Vitis vinifera
emb|CDP19091.1|  unnamed protein product                                187   9e-53   Coffea canephora [robusta coffee]
gb|KDP41896.1|  hypothetical protein JCGZ_26914                         185   4e-52   Jatropha curcas
ref|XP_010110726.1|  Tyrosine--tRNA ligase                              183   1e-51   Morus notabilis
ref|XP_002512791.1|  tyrosyl-tRNA synthetase, putative                  181   1e-50   
ref|XP_007022036.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...    180   2e-50   
ref|XP_004303944.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    180   2e-50   Fragaria vesca subsp. vesca
gb|KCW55733.1|  hypothetical protein EUGRSUZ_I01565                     179   7e-50   Eucalyptus grandis [rose gum]
ref|XP_006375482.1|  hypothetical protein POPTR_0014s13650g             175   7e-50   
ref|XP_010028900.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    179   1e-49   Eucalyptus grandis [rose gum]
ref|XP_004146892.1|  PREDICTED: tyrosine--tRNA ligase-like              178   1e-49   Cucumis sativus [cucumbers]
ref|XP_004166614.1|  PREDICTED: tyrosine--tRNA ligase-like              177   2e-49   
ref|XP_008453844.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    177   2e-49   
ref|XP_010683748.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial    177   2e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007222608.1|  hypothetical protein PRUPE_ppa004925mg             177   4e-49   Prunus persica
ref|XP_003544330.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    176   9e-49   Glycine max [soybeans]
gb|KEH32330.1|  tyrosyl-tRNA synthetase                                 176   9e-49   Medicago truncatula
ref|XP_008218548.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    176   9e-49   Prunus mume [ume]
ref|XP_010927782.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    176   1e-48   Elaeis guineensis
gb|KHN08832.1|  Tyrosine--tRNA ligase                                   176   1e-48   Glycine soja [wild soybean]
ref|XP_004500343.1|  PREDICTED: tyrosine--tRNA ligase-like              176   1e-48   Cicer arietinum [garbanzo]
ref|XP_006645923.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    175   1e-48   
gb|EMT07165.1|  Tyrosyl-tRNA synthetase                                 176   2e-48   
ref|XP_011033705.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial    175   2e-48   Populus euphratica
ref|XP_008339493.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    174   3e-48   
ref|XP_008339494.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    174   3e-48   
dbj|BAK00149.1|  predicted protein                                      175   3e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS54027.1|  Tyrosyl-tRNA synthetase                                 177   4e-48   Triticum urartu
ref|XP_006468947.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    173   7e-48   Citrus sinensis [apfelsine]
ref|XP_010276894.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    174   8e-48   Nelumbo nucifera [Indian lotus]
ref|XP_004299915.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    173   9e-48   Fragaria vesca subsp. vesca
ref|XP_006446866.1|  hypothetical protein CICLE_v10015023mg             173   9e-48   Citrus clementina [clementine]
gb|KDO63480.1|  hypothetical protein CISIN_1g037749mg                   173   1e-47   Citrus sinensis [apfelsine]
ref|XP_003574045.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    173   1e-47   Brachypodium distachyon [annual false brome]
gb|KEH34424.1|  tyrosyl-tRNA synthetase                                 173   1e-47   Medicago truncatula
ref|XP_008361702.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    172   1e-47   
ref|XP_009355255.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    172   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_009355254.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    172   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_009348746.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    172   3e-47   Pyrus x bretschneideri [bai li]
gb|KHN40972.1|  Tyrosine--tRNA ligase                                   167   3e-47   Glycine soja [wild soybean]
ref|XP_009348745.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    172   3e-47   Pyrus x bretschneideri [bai li]
ref|NP_001043131.1|  Os01g0500900                                       172   3e-47   
ref|NP_001141566.1|  hypothetical protein                               171   4e-47   Zea mays [maize]
gb|KJB12925.1|  hypothetical protein B456_002G045400                    171   5e-47   Gossypium raimondii
ref|XP_003519285.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    171   5e-47   Glycine max [soybeans]
ref|XP_008347911.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    171   5e-47   
gb|EAZ12037.1|  hypothetical protein OsJ_01916                          172   6e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007022035.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...    171   8e-47   
ref|XP_008801775.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    171   1e-46   Phoenix dactylifera
ref|XP_002447960.1|  hypothetical protein SORBIDRAFT_06g018870          170   1e-46   
ref|XP_004982893.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    169   2e-46   Setaria italica
ref|XP_011071261.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    170   2e-46   
ref|XP_007022034.1|  Tyrosyl-tRNA synthetase isoform 1                  170   2e-46   
gb|EYU42284.1|  hypothetical protein MIMGU_mgv1a005712mg                168   6e-46   Erythranthe guttata [common monkey flower]
ref|XP_008783116.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    168   1e-45   Phoenix dactylifera
ref|XP_009414004.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    168   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU24457.1|  hypothetical protein MIMGU_mgv1a005745mg                166   3e-45   Erythranthe guttata [common monkey flower]
emb|CAN64191.1|  hypothetical protein VITISV_016956                     170   3e-45   Vitis vinifera
ref|XP_007142062.1|  hypothetical protein PHAVU_008G249300g             164   1e-44   Phaseolus vulgaris [French bean]
ref|XP_010500039.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    164   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010500171.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    164   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010463686.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    164   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002884331.1|  tRNA synthetase class I family protein             164   3e-44   Arabidopsis lyrata subsp. lyrata
gb|EPS58486.1|  hypothetical protein M569_16327                         162   4e-44   Genlisea aurea
emb|CDX74240.1|  BnaA03g28070D                                          161   3e-43   
ref|XP_009134705.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    161   3e-43   Brassica rapa
ref|XP_009134703.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    161   3e-43   Brassica rapa
ref|XP_006297370.1|  hypothetical protein CARUB_v10013389mg             161   4e-43   
ref|NP_186915.1|  tyrosyl-tRNA synthetase                               161   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485586.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    161   4e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006408394.1|  hypothetical protein EUTSA_v10020578mg             159   1e-42   Eutrema salsugineum [saltwater cress]
ref|XP_009118453.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    159   1e-42   Brassica rapa
ref|XP_010549888.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial    159   2e-42   Tarenaya hassleriana [spider flower]
ref|XP_006826574.1|  hypothetical protein AMTR_s00138p00020780          148   1e-38   Amborella trichopoda
ref|XP_002992920.1|  hypothetical protein SELMODRAFT_136175             142   2e-36   
ref|XP_002980036.1|  hypothetical protein SELMODRAFT_111886             142   2e-36   Selaginella moellendorffii
emb|CBI22389.3|  unnamed protein product                                135   3e-34   Vitis vinifera
ref|XP_005848281.1|  hypothetical protein CHLNCDRAFT_48743              134   2e-33   Chlorella variabilis
gb|KIZ02509.1|  tyrosyl-tRNA synthetase                                 125   2e-32   Monoraphidium neglectum
ref|XP_001699082.1|  hypothetical protein CHLREDRAFT_139405             130   4e-32   Chlamydomonas reinhardtii
ref|XP_002955541.1|  hypothetical protein VOLCADRAFT_83275              128   2e-31   Volvox carteri f. nagariensis
ref|XP_003059850.1|  predicted protein                                  126   5e-31   Micromonas pusilla CCMP1545
ref|XP_002504529.1|  predicted protein                                  126   8e-31   Micromonas commoda
ref|XP_005650588.1|  tyrosyl-tRNA synthetase                            124   6e-30   Coccomyxa subellipsoidea C-169
ref|XP_001751567.1|  predicted protein                                  119   3e-28   
ref|XP_001416448.1|  Tyrosyl-tRNA synthetase, probable                  111   2e-25   Ostreococcus lucimarinus CCE9901
ref|WP_032125960.1|  tyrosyl-tRNA synthetase                            109   7e-25   Candidatus Protochlamydia massiliensis
ref|WP_039359281.1|  tyrosyl-tRNA synthetase                            105   2e-23   Candidatus Protochlamydia amoebophila
ref|WP_042279297.1|  tyrosyl-tRNA synthetase                            105   2e-23   Candidatus Protochlamydia sp. R18
ref|WP_011175719.1|  tyrosyl-tRNA synthetase                            105   3e-23   Candidatus Protochlamydia amoebophila
gb|KIC71389.1|  Tyrosine--tRNA ligase                                   104   4e-23   Candidatus Protochlamydia amoebophila
ref|XP_003075033.1|  TyrS Tyrosyl-tRNA synthetase, probable (IC)        103   1e-22   Ostreococcus tauri
ref|WP_013182397.1|  tyrosyl-tRNA synthetase                            100   7e-22   Waddlia chondrophila
ref|WP_042103652.1|  tyrosyl-tRNA synthetase                          99.8    2e-21   Parachlamydiaceae bacterium HS-T3
ref|WP_006340872.1|  tyrosyl-tRNA synthetase                          97.4    2e-20   Parachlamydia acanthamoebae
ref|XP_010229641.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...  97.4    3e-20   
ref|WP_013943141.1|  tyrosyl-tRNA synthetase                          92.4    8e-19   Simkania negevensis
emb|CDZ80947.1|  Tyrosine--tRNA ligase                                91.7    2e-18   Candidatus Rubidus massiliensis
ref|XP_005713019.1|  tyrosine--tRNA ligase, mitochondrial or chlo...  92.0    3e-18   Chondrus crispus [carageen]
ref|WP_039384881.1|  tyrosyl-tRNA synthetase                          90.5    5e-18   Neochlamydia sp. TUME1
ref|WP_042240888.1|  tyrosyl-tRNA synthetase                          90.1    6e-18   Neochlamydia sp. S13
gb|KIC73976.1|  Tyrosine--tRNA ligase                                 89.4    1e-17   Neochlamydia sp. EPS4
ref|WP_039376683.1|  tyrosyl-tRNA synthetase                          86.7    1e-16   
ref|XP_005538192.1|  tyrosine--tRNA ligase, mitochondrial or chlo...  86.7    2e-16   Cyanidioschyzon merolae strain 10D
ref|XP_007509051.1|  tyrosyl-tRNA synthetase                          83.6    2e-15   Bathycoccus prasinos
gb|AFG55783.1|  hypothetical protein 0_14069_01                       79.7    3e-15   Pinus taeda
gb|AFG55790.1|  hypothetical protein 0_14069_01                       79.7    3e-15   Pinus taeda
gb|AEW07904.1|  hypothetical protein 0_14069_01                       79.7    3e-15   Pinus radiata
gb|AFG55784.1|  hypothetical protein 0_14069_01                       79.7    3e-15   Pinus taeda
ref|XP_011397334.1|  Tyrosine-tRNA ligase                             82.4    5e-15   Auxenochlorella protothecoides
ref|XP_009516786.1|  hypothetical protein PHYSODRAFT_552811           80.9    1e-14   Phytophthora sojae
ref|WP_022848286.1|  tyrosyl-tRNA synthetase                          80.1    3e-14   Anaerolineaceae bacterium oral taxon 439
ref|XP_008910914.1|  tyrosine-tRNA ligase                             78.2    1e-13   Phytophthora parasitica INRA-310
gb|ETI39233.1|  tyrosine-tRNA ligase                                  78.2    1e-13   Phytophthora parasitica P1569
ref|WP_041017153.1|  tyrosyl-tRNA synthetase                          75.9    7e-13   Criblamydia sequanensis
ref|XP_002907836.1|  tyrosyl-tRNA synthetase, putative                75.5    1e-12   Phytophthora infestans T30-4
ref|WP_022864835.1|  tyrosyl-tRNA synthetase                          75.1    1e-12   Varibaculum cambriense
ref|WP_040313631.1|  tyrosyl-tRNA synthetase                          75.1    1e-12   Actinomyces cardiffensis
gb|ENO19082.1|  tyrosine--tRNA ligase                                 74.7    2e-12   Actinomyces cardiffensis F0333
ref|XP_009837943.1|  tyrosine-tRNA ligase                             74.3    3e-12   Aphanomyces astaci
ref|WP_029668640.1|  tyrosyl-tRNA synthetase                          73.6    4e-12   
dbj|BAI65246.1|  tyrosyl-tRNA synthetase                              71.6    4e-12   Rothia mucilaginosa DY-18
ref|WP_044150629.1|  tyrosyl-tRNA synthetase                          71.6    4e-12   
ref|WP_013600598.1|  tyrosyl-tRNA synthetase                          73.6    5e-12   Pseudarthrobacter phenanthrenivorans
ref|XP_005707106.1|  tyrosyl-tRNA synthetase                          73.6    5e-12   Galdieria sulphuraria
ref|WP_021271485.1|  tyrosyl-tRNA synthetase                          73.2    6e-12   Bacteriovorax sp. BSW11_IV
ref|WP_024058184.1|  tyrosyl-tRNA synthetase                          73.2    7e-12   Varibaculum cambriense
ref|XP_004334902.1|  tyrosine-tRNA ligase                             73.2    7e-12   Acanthamoeba castellanii str. Neff
gb|KDO34878.1|  tyrosyl-tRNA synthetase                               72.0    1e-11   Saprolegnia parasitica CBS 223.65
ref|WP_018200080.1|  tyrosyl-tRNA synthetase                          71.6    2e-11   
ref|WP_021275481.1|  tyrosyl-tRNA synthetase                          71.6    2e-11   Bacteriovorax sp. Seq25_V
ref|XP_008605106.1|  tyrosyl-tRNA synthetase                          71.2    3e-11   Saprolegnia diclina VS20
ref|WP_043455304.1|  tyrosyl-tRNA synthetase                          71.2    3e-11   Pseudarthrobacter phenanthrenivorans
ref|WP_008470064.1|  tyrosyl-tRNA synthetase                          70.9    3e-11   Lactobacillus hominis
ref|WP_041569078.1|  tyrosyl-tRNA synthetase                          70.9    4e-11   Chloracidobacterium thermophilum
gb|AEP11643.1|  tyrosyl-tRNA synthetase                               70.5    5e-11   Chloracidobacterium thermophilum B
ref|WP_028912082.1|  tyrosyl-tRNA synthetase                          70.5    5e-11   Prevotella sp. MA2016
ref|WP_021949404.1|  tyrosyl-tRNA synthetase                          70.1    7e-11   
ref|WP_039240672.1|  tyrosyl-tRNA synthetase                          70.1    8e-11   Arthrobacter sp. MWB30
ref|WP_037233127.1|  tyrosyl-tRNA synthetase                          70.1    8e-11   Rothia aeria
ref|WP_024366580.1|  tyrosyl-tRNA synthetase                          70.1    8e-11   Arthrobacter sp. TB 26
gb|KDQ21806.1|  hypothetical protein BOTBODRAFT_99200                 70.1    9e-11   Botryobasidium botryosum FD-172 SS1
ref|WP_024963599.1|  tyrosyl-tRNA synthetase                          69.3    1e-10   Trueperella pyogenes
ref|WP_006889016.1|  tyrosyl-tRNA synthetase                          69.3    1e-10   Rothia
gb|ERT67692.1|  tyrosine--tRNA ligase                                 69.3    1e-10   Rothia aeria F0184
emb|CCQ46715.1|  tyrosyl-tRNA synthetase                              69.3    1e-10   Pseudarthrobacter siccitolerans
ref|WP_024332044.1|  tyrosyl-tRNA synthetase                          69.3    1e-10   
ref|WP_025295943.1|  tyrosyl-tRNA synthetase                          68.9    1e-10   Trueperella pyogenes
ref|WP_010528768.1|  tyrosyl-tRNA synthetase                          69.3    1e-10   Thermophagus xiamenensis
ref|WP_034510938.1|  tyrosyl-tRNA synthetase                          68.9    2e-10   Actinomyces sp. S4-C9
ref|WP_042457579.1|  tyrosyl-tRNA synthetase                          68.9    2e-10   Streptacidiphilus jiangxiensis
ref|WP_037604940.1|  tyrosyl-tRNA synthetase                          68.9    2e-10   Streptacidiphilus rugosus
ref|WP_017197962.1|  tyrosyl-tRNA synthetase                          68.9    2e-10   Arthrobacter sp. M2012083
ref|XP_008868076.1|  tyrosine-tRNA ligase                             68.9    2e-10   Aphanomyces invadans
ref|WP_018779124.1|  tyrosyl-tRNA synthetase                          68.6    2e-10   Arthrobacter sp. 161MFSha2.1
ref|WP_007000220.1|  tyrosyl-tRNA synthetase                          68.6    2e-10   Actinobaculum massiliense
ref|WP_016445042.1|  tyrosyl-tRNA synthetase                          68.2    2e-10   Actinomyces europaeus
ref|WP_017176881.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   Actinomyces timonensis
ref|WP_016998371.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   
ref|WP_013132266.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   Thermobispora bispora
ref|WP_018771549.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   Arthrobacter sp. 162MFSha1.1
ref|WP_006823030.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   Corynebacterium
ref|WP_028931561.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   Pseudonocardia asaccharolytica
gb|AAP58586.1|  putative tyrosyl-tRNA synthetase                      68.2    3e-10   uncultured Acidobacteria bacterium
ref|WP_021267070.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   Bacteriovorax sp. BAL6_X
ref|WP_003798662.1|  tyrosyl-tRNA synthetase                          67.8    4e-10   Arthrobacter globiformis
ref|WP_036788433.1|  tyrosyl-tRNA synthetase                          67.8    4e-10   Porphyromonas canoris
ref|WP_037274388.1|  tyrosyl-tRNA synthetase                          67.8    4e-10   Kibdelosporangium aridum
ref|WP_036865421.1|  tyrosyl-tRNA synthetase                          67.8    4e-10   Porphyromonas sp. COT-108 OH2963
ref|WP_036847792.1|  tyrosyl-tRNA synthetase                          67.8    4e-10   Porphyromonas sp. COT-108 OH1349
ref|WP_036910525.1|  tyrosyl-tRNA synthetase                          67.8    4e-10   Prevotella
ref|WP_015936720.1|  tyrosyl-tRNA synthetase                          67.8    5e-10   Pseudarthrobacter chlorophenolicus
ref|WP_042380116.1|  tyrosyl-tRNA synthetase                          67.4    5e-10   Streptacidiphilus melanogenes
ref|WP_041818421.1|  tyrosyl-tRNA synthetase                          67.4    5e-10   Lactobacillus johnsonii
ref|WP_014921325.1|  tyrosyl-tRNA synthetase                          67.4    6e-10   Arthrobacter sp. Rue61a
ref|WP_028851238.1|  tyrosyl-tRNA synthetase                          67.4    6e-10   Thermocrispum municipale
gb|AHA96684.1|  tyrosyl-tRNA synthase                                 67.4    6e-10   Lactobacillus johnsonii N6.2
ref|WP_028903046.1|  MULTISPECIES: tyrosyl-tRNA synthetase            67.4    6e-10   Prevotella
ref|WP_013559196.1|  tyrosyl-tRNA synthetase                          67.0    6e-10   Anaerolinea thermophila
ref|WP_026541624.1|  tyrosyl-tRNA synthetase                          67.0    6e-10   Paenarthrobacter nicotinovorans
ref|WP_018763582.1|  tyrosyl-tRNA synthetase                          67.0    6e-10   Arthrobacter sp. 135MFCol5.1
ref|WP_026547366.1|  tyrosyl-tRNA synthetase                          67.0    6e-10   Paenarthrobacter nicotinovorans
ref|WP_013064850.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Prevotella ruminicola
ref|WP_021277367.1|  tyrosine--tRNA ligase domain protein             64.7    7e-10   
ref|WP_014243863.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Halobacteriovorax marinus
ref|WP_033150736.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Prevotella
ref|WP_004355960.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Prevotella disiens
ref|WP_028906618.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Prevotella ruminicola
ref|WP_018657964.1|  tyrosyl-tRNA synthetase                          67.0    8e-10   Actinomadura flavalba
ref|WP_005507143.1|  tyrosyl-tRNA synthetase                          67.0    8e-10   Rothia
ref|WP_005507861.1|  tyrosyl-tRNA synthetase                          67.0    8e-10   Rothia
ref|WP_044496576.1|  tyrosine--tRNA ligase                            67.0    8e-10   Lactobacillus johnsonii
ref|WP_004898658.1|  tyrosyl-tRNA synthetase                          66.6    8e-10   
gb|AAS08157.1|  tyrosyl-tRNA synthetase                               66.6    8e-10   Lactobacillus johnsonii NCC 533
ref|WP_016335378.1|  tyrosyl-tRNA synthetase                          66.6    9e-10   Amycolatopsis keratiniphila
ref|WP_005987818.1|  tyrosyl-tRNA synthetase                          66.6    9e-10   Actinomyces graevenitzii
ref|WP_028271895.1|  tyrosyl-tRNA synthetase                          66.6    9e-10   Arthrobacter sp. UNC362MFTsu5.1
ref|WP_022513249.1|  tyrosyl-tRNA synthetase                          66.6    9e-10   
ref|WP_014790868.1|  tyrosyl-tRNA synthetase                          66.6    9e-10   Ornithobacterium rhinotracheale
ref|WP_044496612.1|  tyrosyl-tRNA synthetase                          66.6    1e-09   Nesterenkonia massiliensis
ref|WP_038511529.1|  tyrosyl-tRNA synthetase                          66.6    1e-09   Amycolatopsis japonica
ref|WP_021314877.1|  tyrosyl-tRNA synthetase                          66.6    1e-09   Lactobacillus gasseri
ref|WP_030504916.1|  tyrosyl-tRNA synthetase                          66.6    1e-09   Microbispora rosea
ref|WP_003650704.1|  tyrosyl-tRNA synthetase                          66.6    1e-09   Lactobacillus gasseri
ref|WP_020629629.1|  tyrosyl-tRNA synthetase                          66.6    1e-09   Amycolatopsis alba
ref|WP_021604636.1|  tyrosyl-tRNA synthetase                          66.6    1e-09   Actinomyces graevenitzii
ref|WP_028266666.1|  tyrosyl-tRNA synthetase                          66.6    1e-09   Arthrobacter sp. MA-N2
gb|ABJ59589.1|  tyrosyl-tRNA synthetase                               66.2    1e-09   Lactobacillus gasseri ATCC 33323 = JCM 1131
ref|WP_030266695.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Streptacidiphilus jeojiense
ref|WP_013398793.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Rothia dentocariosa
ref|WP_006256112.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Alloprevotella tannerae
ref|WP_042427072.1|  tyrosyl-tRNA synthetase                          65.9    1e-09   Streptacidiphilus anmyonensis
ref|WP_006947867.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Prevotella marshii
ref|WP_023925721.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Prevotella nigrescens
ref|WP_024991409.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Prevotella pleuritidis
ref|WP_021584875.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Prevotella pleuritidis
ref|WP_004362948.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Prevotella nigrescens
ref|WP_005163244.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Amycolatopsis azurea
ref|WP_009199613.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Actinomyces sp. oral taxon 848
ref|WP_025000389.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Prevotella aurantiaca
ref|WP_021474284.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Arthrobacter
ref|WP_014709256.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Prevotella intermedia
ref|WP_028905488.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Prevotella intermedia
ref|WP_039155571.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   
ref|WP_017614427.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Nocardiopsis salina
ref|WP_004366699.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Prevotella nigrescens
ref|WP_003649560.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Lactobacillus paragasseri
ref|WP_034321665.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Amycolatopsis lurida
ref|WP_034277502.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Amycolatopsis halophila
ref|WP_037345658.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Amycolatopsis
ref|WP_012892535.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Streptosporangium roseum
ref|WP_007028024.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Amycolatopsis decaplanina
ref|WP_035732891.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   
ref|WP_021852743.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   
gb|AJC07291.1|  tyrosyl-tRNA synthase                                 65.5    2e-09   
ref|WP_007324558.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Rhodopirellula baltica
ref|WP_014567013.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Lactobacillus johnsonii
ref|WP_027449259.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Prevotella brevis
ref|WP_021853510.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Prevotella
ref|WP_011774354.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Paenarthrobacter aurescens
ref|WP_025065363.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Prevotella enoeca
ref|WP_004806341.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   
ref|WP_018921741.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Salsuginibacillus kocurii
ref|WP_004896025.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Lactobacillus johnsonii
ref|WP_012825381.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Haliangium ochraceum
ref|WP_008674495.1|  tyrosyl-tRNA synthetase                          65.5    3e-09   Rhodopirellula sallentina
ref|WP_011691372.1|  tyrosyl-tRNA synthetase                          65.5    3e-09   Arthrobacter sp. FB24
ref|WP_007573255.1|  tyrosyl-tRNA synthetase                          65.5    3e-09   Prevotella multisaccharivorax
ref|WP_043536564.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Actinomyces polynesiensis
gb|EKY16477.1|  tyrosine--tRNA ligase                                 65.1    3e-09   Actinomyces sp. oral taxon 181 str. F0379
ref|WP_005439705.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Saccharomonospora azurea
ref|WP_005448890.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Saccharomonospora azurea
ref|WP_036886463.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Prevotella bivia
ref|WP_011122161.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Rhodopirellula baltica
ref|WP_004338209.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Prevotella bivia
ref|WP_007332625.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Rhodopirellula baltica
ref|WP_003848988.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Corynebacterium ammoniagenes
ref|WP_008661113.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Rhodopirellula europaea
gb|EJU04247.1|  hypothetical protein DACRYDRAFT_48409                 65.1    3e-09   Dacryopinax primogenitus
ref|WP_026980036.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Flavobacterium suncheonense
ref|WP_043622222.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Nonomuraea candida
ref|WP_036863366.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Prevotella bivia
emb|CCA26043.1|  unnamed protein product                              65.1    4e-09   Albugo laibachii Nc14
ref|WP_008824157.1|  tyrosyl-tRNA synthetase                          65.1    4e-09   Prevotella histicola
ref|WP_042198650.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Kibdelosporangium sp. MJ126-NF4
ref|WP_024820416.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Arthrobacter sp. 31Y
ref|WP_026538365.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Arthrobacter sp. 9MFCol3.1
ref|WP_034251080.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Actinomyces sp. oral taxon 181
ref|WP_020806596.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Lactobacillus
ref|WP_027017834.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Corynebacterium
ref|WP_023019532.1|  MULTISPECIES: tyrosyl-tRNA synthetase            64.7    4e-09   Corynebacterium
ref|WP_021352198.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Corynebacterium pseudodiphtheriticum
ref|WP_021842733.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   
ref|WP_021964934.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   
ref|WP_036867594.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   
ref|WP_042369585.1|  tyrosyl-tRNA synthetase                          64.7    5e-09   
ref|WP_020645475.1|  tyrosyl-tRNA synthetase                          64.7    5e-09   
ref|WP_022016119.1|  tyrosyl-tRNA synthetase                          64.7    5e-09   
ref|WP_012845555.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   
ref|WP_027454742.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   
ref|WP_003099613.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   
ref|WP_028846608.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   
ref|WP_003716179.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   
ref|WP_028927384.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   
ref|WP_014523269.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   
ref|WP_019127035.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   
ref|WP_013670661.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   
ref|WP_006043715.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   
ref|WP_014366981.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   
ref|WP_043480242.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   
ref|WP_035809282.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   
ref|WP_021897094.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   
ref|WP_028277280.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   
ref|WP_031426654.1|  tyrosyl-tRNA synthetase                          64.3    6e-09   
ref|WP_003655654.1|  tyrosyl-tRNA synthetase                          63.9    6e-09   
ref|WP_026466510.1|  tyrosyl-tRNA synthetase                          63.9    7e-09   
ref|WP_013227826.1|  tyrosyl-tRNA synthetase                          63.9    7e-09   
ref|WP_013515994.1|  tyrosyl-tRNA synthetase                          63.9    7e-09   
ref|WP_018774401.1|  tyrosyl-tRNA synthetase                          63.9    8e-09   
ref|WP_012911063.1|  tyrosyl-tRNA synthetase                          63.9    8e-09   
ref|WP_017981997.1|  tyrosyl-tRNA synthetase                          63.5    9e-09   
ref|WP_003657064.1|  tyrosyl-tRNA synthetase                          63.5    9e-09   
ref|WP_044851982.1|  tyrosyl-tRNA synthetase                          63.5    9e-09   
ref|WP_023576069.1|  tyrosyl-tRNA synthetase                          63.5    9e-09   
ref|WP_029722869.1|  tyrosyl-tRNA synthetase                          63.5    9e-09   
ref|WP_009103310.1|  tyrosyl-tRNA synthetase                          63.5    9e-09   
ref|WP_028274405.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_037313083.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_006908464.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_025067875.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_022286111.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_023589348.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_012852510.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_023058571.1|  MULTISPECIES: tyrosyl-tRNA synthetase            63.5    1e-08   
ref|WP_011956798.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_036831526.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_004354427.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_036856724.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_018296313.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_016188948.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_007174743.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_020871768.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_042409186.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
ref|WP_022873629.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
gb|EKD32119.1|  hypothetical protein ACD_77C00174G0009                63.2    1e-08   
ref|WP_005989039.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
gb|AAZ56076.1|  tyrosyl-tRNA synthetase                               63.5    1e-08   
ref|WP_038993706.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_004350641.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_031072446.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_016896392.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_014558675.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_027930652.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
emb|CBT75367.1|  tyrosine--tRNA ligase                                63.2    1e-08   
ref|WP_013241818.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_026866815.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_020420432.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_024989478.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_004384512.1|  MULTISPECIES: tyrosyl-tRNA synthetase            63.2    1e-08   
ref|WP_041649506.1|  tyrosyl-tRNA synthetase                          63.2    2e-08   
ref|WP_036873075.1|  tyrosyl-tRNA synthetase                          63.2    2e-08   
ref|WP_003795411.1|  tyrosyl-tRNA synthetase                          63.2    2e-08   
ref|WP_010417949.1|  tyrosyl-tRNA synthetase                          63.2    2e-08   
ref|WP_031544395.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_018911465.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_026859655.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_003143076.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_040280422.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
gb|EAQ78434.1|  tyrosyl-tRNA synthetase                               62.8    2e-08   
ref|WP_040353255.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_009079585.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_035455359.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_035794877.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_023392472.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_008447361.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
dbj|GAF41443.1|  tyrosyl-tRNA synthetase                              62.8    2e-08   
ref|WP_021927795.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_030173661.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_024936535.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_025780404.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_022430966.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_020556141.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_014655359.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_007902436.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_007338393.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_012398612.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_022146920.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_033296256.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_013838509.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_039206777.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_023577906.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_044079621.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_044075099.1|  tyrosyl-tRNA synthetase                          62.4    3e-08   
ref|WP_022317024.1|  MULTISPECIES: tyrosyl-tRNA synthetase            62.4    3e-08   
ref|WP_044065228.1|  MULTISPECIES: tyrosyl-tRNA synthetase            62.4    3e-08   
ref|WP_026763124.1|  tyrosyl-tRNA synthetase                          62.4    3e-08   
ref|WP_004328414.1|  MULTISPECIES: tyrosyl-tRNA synthetase            62.4    3e-08   
ref|WP_006953261.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_013911393.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_014517766.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_035280995.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_020547072.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_034466497.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_010662327.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_007367905.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_036893143.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_016457404.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_009012990.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_006281183.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_036960728.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_031523987.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   
ref|WP_020660335.1|  tyrosyl-tRNA synthetase                          62.0    4e-08   
ref|WP_004006304.1|  tyrosyl-tRNA synthetase                          62.0    4e-08   
ref|WP_027453266.1|  tyrosyl-tRNA synthetase                          62.0    4e-08   
ref|WP_043780313.1|  tyrosyl-tRNA synthetase                          62.0    4e-08   
ref|WP_030431057.1|  tyrosyl-tRNA synthetase                          62.0    4e-08   
ref|WP_027367168.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_042166486.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_026404207.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_010313559.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_011677971.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_022310931.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_035175588.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_020672041.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_025252737.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_025895947.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_013439025.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_014564560.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_002877898.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
gb|ETK30431.1|  tyrosyl-tRNA synthetase                               61.6    5e-08   
gb|EHE91484.1|  Tyrosine--tRNA ligase                                 61.6    5e-08   
ref|WP_036333822.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_011543583.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_013265033.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_023572950.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_016395907.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_037370307.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_026460182.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
ref|WP_017832867.1|  tyrosyl-tRNA synthetase                          61.6    5e-08   
gb|EHE88055.1|  Tyrosine--tRNA ligase                                 61.6    5e-08   
ref|WP_021756583.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_022663249.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
gb|EXX57162.1|  tyrosine--tRNA ligase MSY1                            61.2    5e-08   
ref|WP_027013520.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_005529362.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_023635620.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_022157479.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_014259706.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_026316880.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_020502358.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_028897025.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_020621555.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_043571577.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_010468888.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_016776545.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_015786857.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_035929596.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_033435726.1|  tyrosyl-tRNA synthetase                          61.2    7e-08   
ref|WP_014157010.1|  MULTISPECIES: tyrosyl-tRNA synthetase            60.8    7e-08   
gb|EEB62423.1|  tyrosine--tRNA ligase                                 61.2    7e-08   
gb|EPD45513.1|  tyrosyl-tRNA synthetase                               61.2    7e-08   
ref|WP_031264683.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
ref|WP_015415854.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
ref|WP_009612411.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
gb|ESA01810.1|  hypothetical protein GLOINDRAFT_39208                 61.2    7e-08   
ref|WP_040361883.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
ref|WP_031129511.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
ref|WP_041314757.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
ref|WP_026065790.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
ref|WP_042389357.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_017884472.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_033317774.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_035105512.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_026420795.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_040106654.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_004361041.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_026448992.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_036865681.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_004271262.1|  tyrosyl-tRNA synthetase                          60.8    9e-08   
ref|WP_021671318.1|  tyrosyl-tRNA synthetase                          60.8    9e-08   
ref|WP_036925066.1|  tyrosyl-tRNA synthetase                          60.8    9e-08   
ref|WP_009381144.1|  tyrosyl-tRNA synthetase                          60.8    9e-08   
ref|WP_009347608.1|  tyrosyl-tRNA synthetase                          60.8    9e-08   
ref|WP_039099666.1|  tyrosyl-tRNA synthetase                          60.8    9e-08   
emb|CCH33827.1|  Tyrosyl-tRNA synthetase                              60.8    9e-08   
ref|WP_005327884.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_034999926.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_027944975.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_043585078.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
emb|CDH56280.1|  tyrosine-trna ligase                                 60.5    1e-07   
ref|WP_027953064.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_026424349.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_004039387.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
gb|EPB83669.1|  tyrosyl-tRNA synthetase                               60.5    1e-07   
ref|WP_005845230.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_018464157.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_039675558.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_041468091.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_011743273.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_043828458.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_018659753.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_008611445.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_026287364.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_018662449.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_005457874.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_039775270.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_027445654.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_031165781.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
dbj|BAE81349.1|  tyrosyl tRNA synthetase                              60.1    1e-07   
ref|WP_006061976.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
gb|AIN82350.1|  tyrosine--tRNA ligase                                 60.1    1e-07   
ref|WP_025069924.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_005323249.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_038268842.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_038629019.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   



>ref|XP_009591201.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
tomentosiformis]
Length=522

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+ +DQVL
Sbjct  394  QRRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNYDQVL  453

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +IS+LDL VSSGLLESK AARRMLKQGGLYLNNA+VD E+KKIE DDIVD KV+LLSAGK
Sbjct  454  NISILDLYVSSGLLESKSAARRMLKQGGLYLNNAKVDGESKKIEADDIVDDKVILLSAGK  513

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  514  KNKMVVRIS  522



>ref|XP_009588089.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Nicotiana tomentosiformis]
Length=521

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+ +DQVL
Sbjct  393  QRRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMKYDQVL  452

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +I +LDL VS GLLESK AARRMLKQGGLYLNN +VDSE+KKIE DDIVD KV+LLSAGK
Sbjct  453  NIPILDLYVSGGLLESKSAARRMLKQGGLYLNNGKVDSESKKIEADDIVDDKVILLSAGK  512

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  513  KNKMVVRIS  521



>ref|XP_009760674.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
sylvestris]
Length=522

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+ +DQVL
Sbjct  394  QRRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNYDQVL  453

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +I +LDL VSSGLLESK AARRMLKQGGLYLNNA+VD E+KKIE DDIVD KV+LLSAGK
Sbjct  454  NIPILDLYVSSGLLESKSAARRMLKQGGLYLNNAKVDGESKKIEADDIVDDKVILLSAGK  513

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  514  KNKMVVRIS  522



>ref|XP_004242803.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Solanum 
lycopersicum]
Length=521

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+ ++QVL
Sbjct  393  QRRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNYEQVL  452

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             I +LDL VSSGLLESK AARRMLKQGGLYLNNA+VDSE+KKIE DDIVD KV+LLSAGK
Sbjct  453  DIPILDLYVSSGLLESKSAARRMLKQGGLYLNNAKVDSESKKIEADDIVDDKVILLSAGK  512

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  513  KNKMVVRIS  521



>ref|XP_006362449.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Solanum tuberosum]
Length=522

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLDWKTIEGIA+DVPSCS+  +QVL
Sbjct  394  QRRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNHEQVL  453

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +I +LDL VSSGLLESK AARRMLKQGGLYLNNA+VDSE+KKIE DDIVD KV+LLSAGK
Sbjct  454  NIPILDLYVSSGLLESKSAARRMLKQGGLYLNNAKVDSESKKIEADDIVDDKVILLSAGK  513

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  514  KNKMVVRIS  522



>ref|XP_002265238.2| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Vitis 
vinifera]
Length=485

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEE TRFVHGQEGLDEALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +D+VL
Sbjct  358  QRRLAEEATRFVHGQEGLDEALKATEALRPG-AETKLDWKTIEGIAKDVPSCSLSYDEVL  416

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S+LDLS+S+GLLESK AARR+LKQGGLYLNN R+DSEAK+IE +DIVDGKVLLLSAGK
Sbjct  417  NLSLLDLSISTGLLESKSAARRLLKQGGLYLNNNRIDSEAKRIEAEDIVDGKVLLLSAGK  476

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  477  KNKVVVRIS  485



>emb|CDP19091.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   187 bits (475),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEE+TRFVHGQEGLDEALKATEALRPG A TKLD KTIEGI  DVPSCSLP+DQVL
Sbjct  398  QRRLAEEITRFVHGQEGLDEALKATEALRPGAA-TKLDAKTIEGIGEDVPSCSLPYDQVL  456

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            S+S+LDLSVSSGLLESK AARR+LKQGGLYLNN+RVDSEAKKIE +DI+DGKV+LLSAGK
Sbjct  457  SLSLLDLSVSSGLLESKSAARRLLKQGGLYLNNSRVDSEAKKIEANDIIDGKVILLSAGK  516

Query  193  KNKMVVRIS  167
            KNKMVVR+S
Sbjct  517  KNKMVVRVS  525



>gb|KDP41896.1| hypothetical protein JCGZ_26914 [Jatropha curcas]
Length=509

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 123/129 (95%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL EALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +DQVL
Sbjct  382  QRRLAEEVTRFVHGEDGLSEALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYDQVL  440

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DLSVS+GLLESK AARR+LKQGGLYLNN+RVDSE+K++E +DIVDGKVLLLSAGK
Sbjct  441  NLSLVDLSVSAGLLESKSAARRLLKQGGLYLNNSRVDSESKRVEAEDIVDGKVLLLSAGK  500

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  501  KNKVVVRIS  509



>ref|XP_010110726.1| Tyrosine--tRNA ligase [Morus notabilis]
 gb|EXC27891.1| Tyrosine--tRNA ligase [Morus notabilis]
Length=481

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG+EGL EALKATEALRPG A+TKLDWKTIEGIA DVPSCSL + + +
Sbjct  354  QRRLAEEVTRFVHGEEGLREALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYAEAI  412

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++DLSVS+GLLESK AARR+LKQGGLYLNNARVDSE+K++E DDIVDGKVLLLSAGK
Sbjct  413  GLSLVDLSVSAGLLESKSAARRLLKQGGLYLNNARVDSESKRVEADDIVDGKVLLLSAGK  472

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  473  KNKVVVRIS  481



>ref|XP_002512791.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF49294.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
Length=492

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQ+GL EA+KATEALRPG A+TKLDWKTIEGIA DVPSCSL +DQVL
Sbjct  365  QRRLAEEVTRFVHGQDGLLEAIKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYDQVL  423

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DLSV++GL++SK AARR+LKQGGLYLNN+RVDSE+K++E  DIV+GKVLLLSAGK
Sbjct  424  NLSLVDLSVTAGLIDSKSAARRLLKQGGLYLNNSRVDSESKRVESQDIVEGKVLLLSAGK  483

Query  193  KNKMVVRIS  167
            KNK++VRIS
Sbjct  484  KNKVIVRIS  492



>ref|XP_007022036.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 ref|XP_007022037.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13561.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13562.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
Length=491

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEE+TRFVHG++GL+EALKATEALRPG ++TKLDWKTIEGIA DVPSC+LP++QV+
Sbjct  364  QQRLAEEITRFVHGEDGLNEALKATEALRPG-SETKLDWKTIEGIAEDVPSCTLPYNQVV  422

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DLSV SGL ESK AARR+LKQGGLYLNN RVD+E K+IE +DIVDGKVLLLSAGK
Sbjct  423  NLSIVDLSVCSGLFESKSAARRLLKQGGLYLNNNRVDNEIKRIEAEDIVDGKVLLLSAGK  482

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  483  KNKVVVRIS  491



>ref|XP_004303944.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLDWKT++ I+ DVPSCS P+ QVL
Sbjct  352  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWKTMQAISEDVPSCSFPYHQVL  410

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +SV+DLSVSSGL +SK AARR+LKQGGLYLNN+RVDSE+K+IE  D+VDGK+LLLSAGK
Sbjct  411  DLSVVDLSVSSGLFDSKSAARRLLKQGGLYLNNSRVDSESKRIEPQDVVDGKLLLLSAGK  470

Query  193  KNKMVVRIS  167
            KNK++VRIS
Sbjct  471  KNKVLVRIS  479



>gb|KCW55733.1| hypothetical protein EUGRSUZ_I01565, partial [Eucalyptus grandis]
Length=479

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL EALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +D VL
Sbjct  352  QRRLAEEVTRFVHGEDGLQEALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLNYDDVL  410

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++DLSV +GL+ESK AARR+LKQGG+YLNN RVD E+K+IE +DIVDGKVLLLSAGK
Sbjct  411  NCSLVDLSVLAGLMESKSAARRLLKQGGMYLNNGRVDGESKRIEAEDIVDGKVLLLSAGK  470

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  471  KNKVVVRIS  479



>ref|XP_006375482.1| hypothetical protein POPTR_0014s13650g [Populus trichocarpa]
 gb|ERP53279.1| hypothetical protein POPTR_0014s13650g [Populus trichocarpa]
Length=329

 Score =   175 bits (444),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAE+VT FVHG++GL+EALKATEALRPG A+TKLDWKT EGIA DVPSCSL  DQVL
Sbjct  202  QRRLAEQVTLFVHGEDGLNEALKATEALRPG-AETKLDWKTFEGIAEDVPSCSLASDQVL  260

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +IS++DLSVSSGLL+SK AARR+LKQGGLYLNN+RVDSE K+IE  DIVDGKVLLLSAGK
Sbjct  261  NISLIDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSETKRIEPQDIVDGKVLLLSAGK  320

Query  193  KNKMVVRIS  167
            KNK++VRI+
Sbjct  321  KNKVIVRIT  329



>ref|XP_010028900.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
Length=506

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL EALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +D VL
Sbjct  379  QRRLAEEVTRFVHGEDGLQEALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLNYDDVL  437

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++DLSV +GL+ESK AARR+LKQGG+YLNN RVD E+K+IE +DIVDGKVLLLSAGK
Sbjct  438  NCSLVDLSVLAGLMESKSAARRLLKQGGMYLNNGRVDGESKRIEAEDIVDGKVLLLSAGK  497

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  498  KNKVVVRIS  506



>ref|XP_004146892.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus]
 gb|KGN53185.1| hypothetical protein Csa_4G025150 [Cucumis sativus]
Length=493

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL EALKATEAL+PG A+TKLDWKTIEGIA DVP CSL +DQVL
Sbjct  366  QRRLAEEVTRFVHGEDGLREALKATEALKPG-AETKLDWKTIEGIAEDVPCCSLEYDQVL  424

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++SV+DLSV+SGLLESK AARR+LKQGGLYLNN RVDSE+K++E  DIVDGKVLLLSAGK
Sbjct  425  NLSVVDLSVTSGLLESKSAARRLLKQGGLYLNNGRVDSESKRVEAVDIVDGKVLLLSAGK  484

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  485  KNKVVVRIS  493



>ref|XP_004166614.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus]
Length=493

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL EALKATEAL+PG A+TKLDWKTIEGIA DVP CSL +DQVL
Sbjct  366  QRRLAEEVTRFVHGEDGLREALKATEALKPG-AETKLDWKTIEGIAEDVPCCSLEYDQVL  424

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++SV+DLSV+SGLLESK AARR+LKQGGLYLNN RVDSE+K++E  DI+DGKVLLLSAGK
Sbjct  425  NLSVVDLSVTSGLLESKSAARRLLKQGGLYLNNGRVDSESKRVEAVDIIDGKVLLLSAGK  484

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  485  KNKVVVRIS  493



>ref|XP_008453844.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Cucumis 
melo]
Length=493

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG+ GL EALKATEAL+PG A+TKLDWKTIEGIA DVP CSL +DQVL
Sbjct  366  QRRLAEEVTRFVHGENGLSEALKATEALKPG-AETKLDWKTIEGIAEDVPCCSLEYDQVL  424

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++SV+DLSV++GLLESK AARR+LKQGGLYLNN RVDSE+K++E  D++DGKVLLLSAGK
Sbjct  425  NLSVVDLSVTTGLLESKSAARRLLKQGGLYLNNGRVDSESKRVEAVDVIDGKVLLLSAGK  484

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  485  KNKVVVRIS  493



>ref|XP_010683748.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683749.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683750.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683751.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q RLAEE+TRFVHG+EGL EA+KATEALRPG A+TKLDWKTIEGIA DVPSCSL +D VL
Sbjct  371  QIRLAEELTRFVHGEEGLKEAIKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYDDVL  429

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DLSV SGLLES+ A RRMLKQGGLYLNN R+D+E+K+IE DDIVDGKVLLLSAGK
Sbjct  430  NLSIVDLSVLSGLLESRSAVRRMLKQGGLYLNNTRIDNESKRIEVDDIVDGKVLLLSAGK  489

Query  193  KNKMVVRIS  167
            KNKMVVR+S
Sbjct  490  KNKMVVRVS  498



>ref|XP_007222608.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
 gb|EMJ23807.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
Length=485

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQ+GLDEALKATEALRPG ADTKLDWKTI+ I+ DVPSCS P++QVL
Sbjct  355  QRRLAEEVTRFVHGQDGLDEALKATEALRPG-ADTKLDWKTIQAISEDVPSCSFPYNQVL  413

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++DLSVSSGLL+SK AARR+LKQGGLYLNN+RVD+E K++E  DIVDGK+LLLSAGK
Sbjct  414  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDNENKRVEPQDIVDGKLLLLSAGK  473

Query  193  KNKMVVRI  170
            KNK++V+I
Sbjct  474  KNKVLVQI  481



>ref|XP_003544330.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=490

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL EALKATEALRPG ++TKLDWKTIEGIA DVPSCSL +D VL
Sbjct  363  QRRLAEEVTRFVHGEDGLAEALKATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDAVL  421

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DLSVSSGL ESK AARR+LKQGGLYLNN RVDSE+K+IE  DIVDGKVLLLSAGK
Sbjct  422  NLSLVDLSVSSGLFESKSAARRLLKQGGLYLNNNRVDSESKRIEAADIVDGKVLLLSAGK  481

Query  193  KNKMVVRIS  167
            KNK++VRI+
Sbjct  482  KNKVLVRIA  490



>gb|KEH32330.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=482

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL EAL+ATEALRPG ++TKLDWKTIEGIA DVPSCSL +D+VL
Sbjct  355  QRRLAEEVTRFVHGEDGLSEALRATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDEVL  413

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++DLSVSSGL +SK AARR+LKQGG+YLNN+RVDSE K+IE  DIVDGKVLLLSAGK
Sbjct  414  NQSLVDLSVSSGLFDSKSAARRLLKQGGVYLNNSRVDSENKRIEAADIVDGKVLLLSAGK  473

Query  193  KNKMVVRIS  167
            KNK++VRI+
Sbjct  474  KNKVLVRIA  482



>ref|XP_008218548.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218549.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218550.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
Length=485

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLA+EVTRFVHGQ+GLDEALKATEALRPG ADTKLDWKTI+ I+ DVPSCS P++QVL
Sbjct  355  QRRLAQEVTRFVHGQDGLDEALKATEALRPG-ADTKLDWKTIQAISEDVPSCSFPYNQVL  413

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++DLSVSSGLL+SK AARR+LKQGGLYLNN+RVD+E K++E  DIVDGK+LLLSAGK
Sbjct  414  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDNENKRVEPQDIVDGKLLLLSAGK  473

Query  193  KNKMVVRI  170
            KNK++V+I
Sbjct  474  KNKVLVQI  481



>ref|XP_010927782.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Elaeis 
guineensis]
Length=544

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG+EGL EALKATE LRPG A+TKLDW+TIEGIA DVPSC L +DQVL
Sbjct  417  QRRLAEEVTRFVHGEEGLAEALKATETLRPG-AETKLDWETIEGIAEDVPSCCLAYDQVL  475

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++DLSVS+GLL SK AARR++KQGGLYLNN RVD+EAK IE  DIVDGK+LLLSAGK
Sbjct  476  NSSLVDLSVSTGLLSSKSAARRLMKQGGLYLNNRRVDNEAKMIEAGDIVDGKLLLLSAGK  535

Query  193  KNKMVVRIS  167
            KNK+V+RIS
Sbjct  536  KNKIVIRIS  544



>gb|KHN08832.1| Tyrosine--tRNA ligase [Glycine soja]
Length=482

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL EALKATEALRPG ++TKLDWKTIEGIA DVPSCSL +D VL
Sbjct  355  QRRLAEEVTRFVHGEDGLAEALKATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDAVL  413

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DLSVSSGL ESK AARR+LKQGGLYLNN RVDSE+K+IE  DIVDGKVLLLSAGK
Sbjct  414  NLSLVDLSVSSGLFESKSAARRLLKQGGLYLNNNRVDSESKRIEAADIVDGKVLLLSAGK  473

Query  193  KNKMVVRIS  167
            KNK++VRI+
Sbjct  474  KNKVLVRIA  482



>ref|XP_004500343.1| PREDICTED: tyrosine--tRNA ligase-like [Cicer arietinum]
Length=501

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL+EA+KATEALRPG ++TKLDWKTIEGIA DVPSCSL +D+VL
Sbjct  374  QRRLAEEVTRFVHGEDGLNEAIKATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDEVL  432

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++DLSVSSGL +SK AARR+LKQGGLYLNN+RVD+E K++E  DIVDGKVLLLSAGK
Sbjct  433  NQSLVDLSVSSGLFDSKSAARRLLKQGGLYLNNSRVDNENKRVEAADIVDGKVLLLSAGK  492

Query  193  KNKMVVRIS  167
            KNK++VRI+
Sbjct  493  KNKVLVRIA  501



>ref|XP_006645923.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Oryza brachyantha]
Length=485

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSLP+DQVL
Sbjct  358  QRRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVL  416

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL+VS+GLL SK A RR++KQGGLYLNN R+DSE K +EE D+V+GKVLLLSAGK
Sbjct  417  KSPLVDLAVSTGLLASKSAVRRLIKQGGLYLNNIRIDSEDKLVEEGDVVNGKVLLLSAGK  476

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  477  KNKMVVRIS  485



>gb|EMT07165.1| Tyrosyl-tRNA synthetase [Aegilops tauschii]
Length=512

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQEGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSL +DQVL
Sbjct  385  QRRLAEEVTRFVHGQEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLRYDQVL  443

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL+ S+GLL SK AARR++KQGGLYLNN ++DSE K +EE DIVDGKVLLLSAGK
Sbjct  444  KSPLVDLAASTGLLASKSAARRLIKQGGLYLNNMKIDSEDKLVEEGDIVDGKVLLLSAGK  503

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  504  KNKMVVRIS  512



>ref|XP_011033705.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Populus euphratica]
Length=502

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAE+VT FVHG++GL+EALKATEALRPG A+TKLDWKT EGIA DVPSCSL  DQVL
Sbjct  375  QRRLAEQVTLFVHGEDGLNEALKATEALRPG-AETKLDWKTFEGIAEDVPSCSLASDQVL  433

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +IS++DLSVSSGLL+SK AARR+LKQGGLYLNN+RVDSE K+IE  DIVDGKVLLLSAGK
Sbjct  434  NISLIDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSETKRIEPQDIVDGKVLLLSAGK  493

Query  193  KNKMVVRIS  167
            KNK++VRI+
Sbjct  494  KNKVIVRIT  502



>ref|XP_008339493.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Malus domestica]
Length=486

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQ+GLDEALKATEA+RPG AD KLDW TI+ I+ DVPSCS P+ QVL
Sbjct  357  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADXKLDWNTIKAISEDVPSCSFPYHQVL  415

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++DLSVSSGLL+SK AARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGK
Sbjct  416  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGK  475

Query  193  KNKMVVRIS  167
            KNK++V+IS
Sbjct  476  KNKVLVQIS  484



>ref|XP_008339494.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Malus domestica]
Length=482

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQ+GLDEALKATEA+RPG AD KLDW TI+ I+ DVPSCS P+ QVL
Sbjct  353  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADXKLDWNTIKAISEDVPSCSFPYHQVL  411

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++DLSVSSGLL+SK AARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGK
Sbjct  412  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGK  471

Query  193  KNKMVVRIS  167
            KNK++V+IS
Sbjct  472  KNKVLVQIS  480



>dbj|BAK00149.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVT FVHGQEGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSLP+DQVL
Sbjct  385  QRRLAEEVTLFVHGQEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVL  443

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL+ S+GLL SK A RR++KQGGLYLNN ++DSE K +EE DIVDGKVLLLSAGK
Sbjct  444  KSPLVDLAASTGLLASKSAVRRLIKQGGLYLNNKKIDSEDKLVEEGDIVDGKVLLLSAGK  503

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  504  KNKMVVRIS  512



>gb|EMS54027.1| Tyrosyl-tRNA synthetase [Triticum urartu]
Length=796

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQEG++EALKATEALRPG A T+LD +TIEGIA DVPSCSLP+DQVL
Sbjct  669  QRRLAEEVTRFVHGQEGVEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVL  727

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL+ S+GLL SK A RR++KQGGLYLNN ++DSE K +EE DIVDGKVLLLSAGK
Sbjct  728  KSPLVDLAASTGLLASKSAVRRLIKQGGLYLNNKKIDSEDKLVEEGDIVDGKVLLLSAGK  787

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  788  KNKMVVRIS  796



>ref|XP_006468947.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Citrus sinensis]
Length=493

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVTRFVHG++GL+EA+KATEALRPG A+TKLDWKTIE IA DVPSCSL +DQVL
Sbjct  366  QQRLAEEVTRFVHGEDGLNEAVKATEALRPG-AETKLDWKTIEAIAEDVPSCSLAYDQVL  424

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DLSVS+GL ESK AARR+LKQGG+YLNN RVDSE+K+IE  DIVD KVLLLSAGK
Sbjct  425  NVSLVDLSVSAGLFESKSAARRLLKQGGVYLNNNRVDSESKRIEPQDIVDDKVLLLSAGK  484

Query  193  KNKMVVRIS  167
            KNK+VVRI+
Sbjct  485  KNKVVVRIA  493



>ref|XP_010276894.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nelumbo 
nucifera]
Length=531

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG+EGL EALKATEALRPG A+T LDWKTIEGIA DVPSC+L + QVL
Sbjct  404  QRRLAEEVTRFVHGEEGLLEALKATEALRPG-AETVLDWKTIEGIAEDVPSCTLDYKQVL  462

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++DLSVS+GLLESK AARR+LKQGGLYLNN RV+SE + IE  DI+DGKVLLLSAGK
Sbjct  463  NASLVDLSVSTGLLESKSAARRLLKQGGLYLNNIRVESEIRSIEVGDIIDGKVLLLSAGK  522

Query  193  KNKMVVRIS  167
            KNKM+VRIS
Sbjct  523  KNKMIVRIS  531



>ref|XP_004299915.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
 ref|XP_011464831.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   173 bits (438),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQ GLDEALKATEA+RPG ADT LDW T++ I+ DVPSCS P+ QVL
Sbjct  357  QRRLAEEVTRFVHGQNGLDEALKATEAMRPG-ADTNLDWNTMQAISEDVPSCSFPYHQVL  415

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             + V+DLSVSSGL ++K AARR+LKQGGLY+NN RV+SE+K+IE  DIVDGK+LLLSAGK
Sbjct  416  DLPVVDLSVSSGLFDTKSAARRLLKQGGLYMNNLRVESESKRIEPQDIVDGKLLLLSAGK  475

Query  193  KNKMVVRIS  167
            KNK++VRIS
Sbjct  476  KNKVLVRIS  484



>ref|XP_006446866.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
 gb|ESR60106.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
Length=493

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVT FVHG++GL+EA+KATEALRPG A+TKLDWKTIE IA DVPSCSL +DQVL
Sbjct  366  QRRLAEEVTHFVHGEDGLNEAVKATEALRPG-AETKLDWKTIEAIAEDVPSCSLAYDQVL  424

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DLSVS+GL ESK AARR+LKQGG+YLNN RVDSE+K+IE  DIVD KVLLLSAGK
Sbjct  425  NVSLVDLSVSAGLFESKSAARRLLKQGGVYLNNNRVDSESKRIEPQDIVDDKVLLLSAGK  484

Query  193  KNKMVVRIS  167
            KNK+VVRI+
Sbjct  485  KNKVVVRIA  493



>gb|KDO63480.1| hypothetical protein CISIN_1g037749mg [Citrus sinensis]
Length=495

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVT FVHG++GL+EA+KATEALRPG A+TKLDWKTIE IA DVPSCSL +DQVL
Sbjct  368  QRRLAEEVTHFVHGEDGLNEAVKATEALRPG-AETKLDWKTIEAIAEDVPSCSLAYDQVL  426

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DL+VS+GL ESK AARR+LKQGG+YLNN RVDSE+K+IE  DIVD KVLLLSAGK
Sbjct  427  NVSLVDLAVSAGLFESKSAARRLLKQGGVYLNNNRVDSESKRIEPQDIVDDKVLLLSAGK  486

Query  193  KNKMVVRIS  167
            KNK+VVRI+
Sbjct  487  KNKVVVRIA  495



>ref|XP_003574045.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brachypodium 
distachyon]
Length=512

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LAEEVTRFVHGQEGL+EALKAT+ALRPG A T+LD +TIEGIA DVPSCSLP+DQVL
Sbjct  385  QRILAEEVTRFVHGQEGLEEALKATQALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVL  443

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL+ S+GLL SK A RR++KQGGLYLNN ++DSE K +EE DIVDGKVLLLSAGK
Sbjct  444  KSPLVDLAASTGLLASKSAVRRLIKQGGLYLNNIKIDSEDKLVEEGDIVDGKVLLLSAGK  503

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  504  KNKMVVRIS  512



>gb|KEH34424.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=500

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVT+FVHG++GL+EAL+ATEALRPG ++TKLDWKTIEGIA DVPSCSL +D VL
Sbjct  373  QRRLAEEVTKFVHGEDGLNEALRATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDDVL  431

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++DLSVSSGL +SK AARR+LKQGG+YLNN+RVDSE K+IE  DIVDGKVLLLSAGK
Sbjct  432  NQSLVDLSVSSGLFDSKSAARRLLKQGGVYLNNSRVDSENKRIEVADIVDGKVLLLSAGK  491

Query  193  KNKMVVRIS  167
            KNK++VRI+
Sbjct  492  KNKVLVRIA  500



>ref|XP_008361702.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQ+GLDEALKATEA+RPG AD KLDW TI+ I+ DVP CS P+ QVL
Sbjct  353  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADXKLDWNTIKAISEDVPXCSFPYHQVL  411

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++DLSVSSGLL+SK AARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGK
Sbjct  412  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGK  471

Query  193  KNKMVVRIS  167
            KNK++V+IS
Sbjct  472  KNKVLVQIS  480



>ref|XP_009355255.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355256.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355257.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355258.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLDW  I+ I+ DVPSCS P+ +VL
Sbjct  353  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNAIKAISEDVPSCSFPYHEVL  411

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S+LDLSVSSGLL+SK AARR+LKQGGLYLNN++VDSE K+IE +DIVDGK+LLLSAGK
Sbjct  412  NLSILDLSVSSGLLDSKSAARRLLKQGGLYLNNSKVDSENKRIEPEDIVDGKLLLLSAGK  471

Query  193  KNKMVVRIS  167
            KNK++V+IS
Sbjct  472  KNKVLVQIS  480



>ref|XP_009355254.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLDW  I+ I+ DVPSCS P+ +VL
Sbjct  357  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNAIKAISEDVPSCSFPYHEVL  415

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S+LDLSVSSGLL+SK AARR+LKQGGLYLNN++VDSE K+IE +DIVDGK+LLLSAGK
Sbjct  416  NLSILDLSVSSGLLDSKSAARRLLKQGGLYLNNSKVDSENKRIEPEDIVDGKLLLLSAGK  475

Query  193  KNKMVVRIS  167
            KNK++V+IS
Sbjct  476  KNKVLVQIS  484



>ref|XP_009348746.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348747.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348748.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348749.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q RLAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLDW TI+ I+ DVPSCS P+ QVL
Sbjct  353  QCRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNTIKAISEDVPSCSFPYHQVL  411

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++DLSVSSGLL+SK AARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGK
Sbjct  412  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGK  471

Query  193  KNKMVVRIS  167
            KNK++V+I+
Sbjct  472  KNKVLVQIN  480



>gb|KHN40972.1| Tyrosine--tRNA ligase [Glycine soja]
Length=279

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 115/129 (89%), Gaps = 2/129 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEG-LDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQv  377
            QRRLAEEVTRFVHG++G L EALKATEALRPG ++TKLDWKTIEGIA DVP CSL +D V
Sbjct  151  QRRLAEEVTRFVHGEDGFLAEALKATEALRPG-SETKLDWKTIEGIAEDVPCCSLAYDAV  209

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
            L++S++DL VSSGL ESK AARR+LKQGGLYLNN RVD+E K+IE  DIVDGKVLLLSAG
Sbjct  210  LNLSLVDLLVSSGLFESKSAARRLLKQGGLYLNNNRVDNEGKRIEAADIVDGKVLLLSAG  269

Query  196  KKNKMVVRI  170
            KKNK++VRI
Sbjct  270  KKNKVLVRI  278



>ref|XP_009348745.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q RLAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLDW TI+ I+ DVPSCS P+ QVL
Sbjct  357  QCRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNTIKAISEDVPSCSFPYHQVL  415

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++DLSVSSGLL+SK AARR+LKQGGLYLNN+RVDSE K+IE  DIVDGK+LLLSAGK
Sbjct  416  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGK  475

Query  193  KNKMVVRIS  167
            KNK++V+I+
Sbjct  476  KNKVLVQIN  484



>ref|NP_001043131.1| Os01g0500900 [Oryza sativa Japonica Group]
 dbj|BAB64064.1| putative tyrosine-tRNA ligase [Oryza sativa Japonica Group]
 dbj|BAF05045.1| Os01g0500900 [Oryza sativa Japonica Group]
 gb|EAY74203.1| hypothetical protein OsI_02083 [Oryza sativa Indica Group]
 dbj|BAG90095.1| unnamed protein product [Oryza sativa Japonica Group]
Length=497

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSC LP+ QVL
Sbjct  370  QRRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCFLPYGQVL  428

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL+VS+GLL SK A RR++KQGGLYLNN R+DSE K +EE D+VDGKVLLLSAGK
Sbjct  429  KSPLVDLAVSTGLLASKSAVRRLIKQGGLYLNNIRIDSEDKLVEEGDVVDGKVLLLSAGK  488

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  489  KNKMVVRIS  497



>ref|NP_001141566.1| hypothetical protein [Zea mays]
 gb|ACF86629.1| unknown [Zea mays]
 tpg|DAA37471.1| TPA: hypothetical protein ZEAMMB73_107188 [Zea mays]
Length=496

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSL +DQV 
Sbjct  369  QKRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDAQTIEGIADDVPSCSLAYDQVF  427

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL+VS+GLL SK A +R++KQGGLYLNN R+DSE K +EE DIVDGKVLLLSAGK
Sbjct  428  KSPLIDLAVSTGLLTSKSAVKRLIKQGGLYLNNVRIDSEDKLVEEGDIVDGKVLLLSAGK  487

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  488  KNKMVVRIS  496



>gb|KJB12925.1| hypothetical protein B456_002G045400 [Gossypium raimondii]
Length=491

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 120/129 (93%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAEE+TRFVHG++GL EALKATEALRPG ++TKLDW+TIEGIA DVPS SLP+ +VL
Sbjct  364  QRKLAEEITRFVHGEDGLTEALKATEALRPG-SETKLDWETIEGIAEDVPSRSLPYTEVL  422

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DLSVSSGL ESK AARR+LKQGG+YLNN RVD+E+K+IE +DIVDGKVLLLSAGK
Sbjct  423  NLSIVDLSVSSGLFESKSAARRLLKQGGIYLNNNRVDNESKRIEAEDIVDGKVLLLSAGK  482

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  483  KNKVVVRIS  491



>ref|XP_003519285.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=496

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 115/128 (90%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL EALKATEALRPG ++TKLDWKTIEGIA DVP CSL +D VL
Sbjct  369  QRRLAEEVTRFVHGEDGLAEALKATEALRPG-SETKLDWKTIEGIAEDVPCCSLAYDAVL  427

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DL VSSGL ESK AARR+LKQGGLYLNN RVD+E K+IE  DIVDGKVLLLSAGK
Sbjct  428  NLSLVDLLVSSGLFESKSAARRLLKQGGLYLNNNRVDNEGKRIEAADIVDGKVLLLSAGK  487

Query  193  KNKMVVRI  170
            KNK++VRI
Sbjct  488  KNKVLVRI  495



>ref|XP_008347911.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347912.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347913.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365305.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365306.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365307.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLDW TI+ I+ DVPSCS  + QVL
Sbjct  353  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNTIKAISEDVPSCSFLYHQVL  411

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S+LDLSVSSGLL+SK AARR+LKQGGLYLNN++VDSE K+IE +DIVDGK+LLLSAGK
Sbjct  412  DLSILDLSVSSGLLDSKSAARRLLKQGGLYLNNSKVDSENKRIEPEDIVDGKLLLLSAGK  471

Query  193  KNKMVVRIS  167
            KNK++V+IS
Sbjct  472  KNKVLVQIS  480



>gb|EAZ12037.1| hypothetical protein OsJ_01916 [Oryza sativa Japonica Group]
Length=545

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSC LP+ QVL
Sbjct  418  QRRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCFLPYGQVL  476

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL+VS+GLL SK A RR++KQGGLYLNN R+DSE K +EE D+VDGKVLLLSAGK
Sbjct  477  KSPLVDLAVSTGLLASKSAVRRLIKQGGLYLNNIRIDSEDKLVEEGDVVDGKVLLLSAGK  536

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  537  KNKMVVRIS  545



>ref|XP_007022035.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
 gb|EOY13560.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
Length=486

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 115/123 (93%), Gaps = 1/123 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEE+TRFVHG++GL+EALKATEALRPG ++TKLDWKTIEGIA DVPSC+LP++QV+
Sbjct  364  QQRLAEEITRFVHGEDGLNEALKATEALRPG-SETKLDWKTIEGIAEDVPSCTLPYNQVV  422

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DLSV SGL ESK AARR+LKQGGLYLNN RVD+E K+IE +DIVDGKVLLLSAGK
Sbjct  423  NLSIVDLSVCSGLFESKSAARRLLKQGGLYLNNNRVDNEIKRIEAEDIVDGKVLLLSAGK  482

Query  193  KNK  185
            KNK
Sbjct  483  KNK  485



>ref|XP_008801775.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=544

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG+EGL EALKATE LRPG A+TKLDW+TIEGIA DVPSCSL + QVL
Sbjct  417  QRRLAEEVTRFVHGEEGLAEALKATETLRPG-AETKLDWETIEGIAEDVPSCSLAYGQVL  475

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++DLSVS+GLL SK AARR++KQGGLYLNN RVD+E K IE  DIVD KVLLLSAGK
Sbjct  476  NSSLVDLSVSTGLLSSKSAARRLMKQGGLYLNNRRVDNEEKVIEAGDIVDEKVLLLSAGK  535

Query  193  KNKMVVRI  170
            KNKMV+RI
Sbjct  536  KNKMVIRI  543



>ref|XP_002447960.1| hypothetical protein SORBIDRAFT_06g018870 [Sorghum bicolor]
 gb|EES12288.1| hypothetical protein SORBIDRAFT_06g018870 [Sorghum bicolor]
Length=521

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSCSL +DQV 
Sbjct  394  QKRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDAQTIEGIADDVPSCSLAYDQVF  452

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL+VS+GLL SK A +R++KQGGLYLNN R+DSE K +E+ DIVDGKVLLLSAGK
Sbjct  453  KSPLVDLAVSTGLLTSKSAVKRLIKQGGLYLNNVRIDSEDKLVEDGDIVDGKVLLLSAGK  512

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  513  KNKMVVRIS  521



>ref|XP_004982893.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Setaria italica]
Length=494

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVTRFVHG+EGL EALKATEALRPG A T+LD +TIEGIA DVPSCSL +DQVL
Sbjct  367  QKRLAEEVTRFVHGEEGLVEALKATEALRPG-AQTQLDAQTIEGIADDVPSCSLAYDQVL  425

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL+VS+GLL SK A +R++KQGGLYLNN R+DSE K +EE DIVDGKVLLLSAGK
Sbjct  426  KSPLVDLAVSTGLLASKSAVKRLIKQGGLYLNNIRIDSEDKLVEEGDIVDGKVLLLSAGK  485

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  486  KNKMVVRIS  494



>ref|XP_011071261.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Sesamum 
indicum]
Length=503

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG+EGLDEALKAT+ALRPG A+TKLDWKTIE IA DVPS SL  DQVL
Sbjct  340  QRRLAEEVTRFVHGEEGLDEALKATQALRPG-AETKLDWKTIETIAEDVPSISLQQDQVL  398

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S+LDLSV +GLLESK AARR+LKQGGLYLNN R+DSEAK+IE +DIVDGKV+LLSAGK
Sbjct  399  NLSLLDLSVRTGLLESKSAARRLLKQGGLYLNNNRIDSEAKRIEPNDIVDGKVILLSAGK  458

Query  193  KNKMV  179
            KNKM+
Sbjct  459  KNKMI  463



>ref|XP_007022034.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
 gb|EOY13559.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
Length=542

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 115/123 (93%), Gaps = 1/123 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEE+TRFVHG++GL+EALKATEALRPG ++TKLDWKTIEGIA DVPSC+LP++QV+
Sbjct  420  QQRLAEEITRFVHGEDGLNEALKATEALRPG-SETKLDWKTIEGIAEDVPSCTLPYNQVV  478

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DLSV SGL ESK AARR+LKQGGLYLNN RVD+E K+IE +DIVDGKVLLLSAGK
Sbjct  479  NLSIVDLSVCSGLFESKSAARRLLKQGGLYLNNNRVDNEIKRIEAEDIVDGKVLLLSAGK  538

Query  193  KNK  185
            KNK
Sbjct  539  KNK  541



>gb|EYU42284.1| hypothetical protein MIMGU_mgv1a005712mg [Erythranthe guttata]
Length=473

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAEEVTRFVHG+EGL+EA+KAT ALRPG ++TKLDW +IE IA DVPS SL  DQVL
Sbjct  346  QRKLAEEVTRFVHGEEGLEEAMKATMALRPG-SETKLDWNSIESIAEDVPSVSLGKDQVL  404

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S+LDLSV SGLL+SK AARRMLKQGGLYLNN RVDSE ++IE DDIVDGKV+LLSAGK
Sbjct  405  NLSLLDLSVCSGLLDSKSAARRMLKQGGLYLNNNRVDSEGRRIEIDDIVDGKVILLSAGK  464

Query  193  KNKMVVRIS  167
            KNKM+VRIS
Sbjct  465  KNKMIVRIS  473



>ref|XP_008783116.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
 ref|XP_008783117.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=543

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL EALKATE LRPG A+TKLDW+TIEGIA DVPSCSL + QVL
Sbjct  416  QRRLAEEVTRFVHGEDGLTEALKATETLRPG-AETKLDWETIEGIAEDVPSCSLAYGQVL  474

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++DLSVS+GLL SK AARR+++QGGLYLNN RVD+EAK IE  DIVD K+LLLSAGK
Sbjct  475  NSSLVDLSVSTGLLSSKSAARRLMEQGGLYLNNRRVDNEAKVIEAGDIVDEKILLLSAGK  534

Query  193  KNKMVVRI  170
            KNKMV++I
Sbjct  535  KNKMVIKI  542



>ref|XP_009414004.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Musa 
acuminata subsp. malaccensis]
Length=535

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL EALKATEALRPG A+T+LD +TIEGI+ DVPSCSL + QVL
Sbjct  408  QRRLAEEVTRFVHGEDGLAEALKATEALRPG-AETRLDAETIEGISEDVPSCSLAYYQVL  466

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++DLSVS+GLL +K A RR++KQGGLYLNN RVD+E K++EE DI+DGK+LLLSAGK
Sbjct  467  NSSLIDLSVSTGLLSTKSAVRRLMKQGGLYLNNKRVDTEEKRVEEADIIDGKILLLSAGK  526

Query  193  KNKMVVRIS  167
            KNKMVVRIS
Sbjct  527  KNKMVVRIS  535



>gb|EYU24457.1| hypothetical protein MIMGU_mgv1a005745mg [Erythranthe guttata]
Length=472

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAEEVTRFVHG+EGL+EA+KAT ALRPG ++TKLDW +IE IA DVPS SL  D+VL
Sbjct  345  QRKLAEEVTRFVHGEEGLEEAMKATMALRPG-SETKLDWNSIESIAEDVPSVSLEKDRVL  403

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S+LDLSV SGLL+SK AARRMLKQGGLYLNN RVDSE ++IE DDIVDGKV+LLSAGK
Sbjct  404  NLSLLDLSVCSGLLDSKSAARRMLKQGGLYLNNNRVDSEGRRIEIDDIVDGKVILLSAGK  463

Query  193  KNKMVVRIS  167
            KNKM+VRIS
Sbjct  464  KNKMIVRIS  472



>emb|CAN64191.1| hypothetical protein VITISV_016956 [Vitis vinifera]
Length=868

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 112/119 (94%), Gaps = 1/119 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEE TRFVHGQEGLDEALKATEALRPG A+TKLDWKTIEGIA DVPSCSL +D+VL
Sbjct  358  QRRLAEEATRFVHGQEGLDEALKATEALRPG-AETKLDWKTIEGIAKDVPSCSLSYDEVL  416

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
            ++S+LDLS+S+GLLESK AARR+LKQGGLYLNN R+DSEAK+IE +DIVDGKVLLLSAG
Sbjct  417  NLSLLDLSISTGLLESKSAARRLLKQGGLYLNNNRIDSEAKRIEAEDIVDGKVLLLSAG  475



>ref|XP_007142062.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
 gb|ESW14056.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
Length=478

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLA+EVT FVHG++GL EAL+ATEAL+PG+  TKLDWK+IEGIA D+PSCSLP++ VL
Sbjct  351  QQRLAKEVTLFVHGEDGLAEALQATEALKPGSG-TKLDWKSIEGIAEDLPSCSLPYEDVL  409

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            ++S++DLSVSSGL ESK AARR+LKQGGLYLNN+RVD+E K+IE  DIVDGKVLLLSAGK
Sbjct  410  NLSLVDLSVSSGLFESKSAARRLLKQGGLYLNNSRVDNEGKRIEAADIVDGKVLLLSAGK  469

Query  193  KNKMVVRIS  167
            KNK++VRI+
Sbjct  470  KNKVLVRIA  478



>ref|XP_010500039.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010500108.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
Length=511

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V 
Sbjct  384  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVS  442

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              S++DLSVS+GL ESK AARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGK
Sbjct  443  GSSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGK  502

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  503  KNKVVVRIS  511



>ref|XP_010500171.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Camelina sativa]
Length=505

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V 
Sbjct  378  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVS  436

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              S++DLSVS+GL ESK AARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGK
Sbjct  437  GSSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGK  496

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  497  KNKVVVRIS  505



>ref|XP_010463686.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010463687.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V 
Sbjct  384  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVS  442

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              S++DLSVS+GL ESK AARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGK
Sbjct  443  GSSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGK  502

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  503  KNKVVVRIS  511



>ref|XP_002884331.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60590.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V 
Sbjct  384  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVS  442

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++DLSVS+GL ESK AARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGK
Sbjct  443  GLSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGK  502

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  503  KNKVVVRIS  511



>gb|EPS58486.1| hypothetical protein M569_16327, partial [Genlisea aurea]
Length=428

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q RLAEE+TRFVHG+EGL EA+KAT AL PGN +T L W++IEGIA DVPSC L  +QVL
Sbjct  302  QIRLAEELTRFVHGEEGLAEAVKATRALNPGN-ETNLRWESIEGIAGDVPSCRLNRNQVL  360

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++DLSV++GL+ES+ AARR+LKQGGLYLNN RVD+E KKIE+DDIVDGK+LLLSAGK
Sbjct  361  NSSLVDLSVATGLVESRSAARRLLKQGGLYLNNVRVDNEGKKIEDDDIVDGKILLLSAGK  420

Query  193  KNKMVVRI  170
            KNKMVVRI
Sbjct  421  KNKMVVRI  428



>emb|CDX74240.1| BnaA03g28070D [Brassica napus]
Length=500

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+P+CSLP D+V 
Sbjct  373  QMKLAEEVTRFVHGEEGLKEAMKATEALRPG-AETKLDWNLIERIAEDIPTCSLPVDRVA  431

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++D+SVS+GL ESK AARRMLKQGG+Y+NN RVD E K++EE DIV+GK L+LS+GK
Sbjct  432  GVSIVDVSVSAGLFESKSAARRMLKQGGVYMNNERVDDENKRVEEGDIVEGKGLVLSSGK  491

Query  193  KNKMVVRIS  167
            KNK+V+RIS
Sbjct  492  KNKVVIRIS  500



>ref|XP_009134705.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134706.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134707.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
Length=500

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+P+CSLP D+V 
Sbjct  373  QMKLAEEVTRFVHGEEGLKEAMKATEALRPG-AETKLDWNLIERIAEDIPTCSLPVDRVA  431

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++D+SVS+GL ESK AARRMLKQGG+Y+NN RVD E K++EE DIV+GK L+LS+GK
Sbjct  432  GVSIVDVSVSAGLFESKSAARRMLKQGGVYMNNERVDDENKRVEEGDIVEGKGLVLSSGK  491

Query  193  KNKMVVRIS  167
            KNK+V+RIS
Sbjct  492  KNKVVIRIS  500



>ref|XP_009134703.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Brassica rapa]
Length=520

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+P+CSLP D+V 
Sbjct  393  QMKLAEEVTRFVHGEEGLKEAMKATEALRPG-AETKLDWNLIERIAEDIPTCSLPVDRVA  451

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++D+SVS+GL ESK AARRMLKQGG+Y+NN RVD E K++EE DIV+GK L+LS+GK
Sbjct  452  GVSIVDVSVSAGLFESKSAARRMLKQGGVYMNNERVDDENKRVEEGDIVEGKGLVLSSGK  511

Query  193  KNKMVVRIS  167
            KNK+V+RIS
Sbjct  512  KNKVVIRIS  520



>ref|XP_006297370.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
 gb|EOA30268.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
Length=548

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE I+ D+PSCSLP D+VL
Sbjct  421  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERISEDIPSCSLPIDRVL  479

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++DLSVS+GL ESK AARRMLKQGG Y+NN RVD E +++EE+DIV+GK L+LSAGK
Sbjct  480  GLSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENRRVEEEDIVEGKGLVLSAGK  539

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  540  KNKVVVRIS  548



>ref|NP_186915.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AAF32473.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 dbj|BAD95182.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|ABK32110.1| At3g02660 [Arabidopsis thaliana]
 gb|AEE73845.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
Length=511

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSLP D+V 
Sbjct  384  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVS  442

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++DLSVS+GL ESK AARRMLKQGG Y+NN RVD E K+++E+DIV+G+ L+LSAGK
Sbjct  443  GLSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVDEEDIVEGRGLVLSAGK  502

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  503  KNKVVVRIS  511



>ref|XP_010485586.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010485587.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+PSCSL  D+V 
Sbjct  384  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLSIDRVS  442

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              S++DLSVS+GL ESK AARRMLKQGG Y+NN RVD E K++EE+DIV+GK L+LSAGK
Sbjct  443  GSSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGK  502

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  503  KNKVVVRIS  511



>ref|XP_006408394.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 ref|XP_006408395.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49847.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49848.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
Length=499

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q +LA EVTRFVHG+EGL EA+KATEALRPG A+TKL+W  IE IA D+PSCSLP D+V 
Sbjct  372  QIKLAAEVTRFVHGEEGLKEAIKATEALRPG-AETKLEWNLIERIAEDIPSCSLPIDRVS  430

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              SV+DLSVS+GL ESK AA+RMLKQGG+Y+NNARVD E K++EE DI+DGK L+LS+GK
Sbjct  431  GFSVVDLSVSAGLFESKSAAKRMLKQGGIYMNNARVDDENKRVEEADIIDGKGLVLSSGK  490

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  491  KNKVVVRIS  499



>ref|XP_009118453.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118460.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118468.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118475.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
Length=503

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q +LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLDW  IE IA D+P+CSLP D+V 
Sbjct  376  QMKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPTCSLPIDRVS  434

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +S++D+SVS+GL ESK AARR LKQGG+Y+NN RVD E K++EE+DIV+GK L+LS+GK
Sbjct  435  GVSIVDVSVSAGLFESKSAARRTLKQGGVYMNNQRVDDENKRVEEEDIVEGKGLVLSSGK  494

Query  193  KNKMVVRIS  167
            KNK+V+RIS
Sbjct  495  KNKVVIRIS  503



>ref|XP_010549888.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Tarenaya hassleriana]
Length=516

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q++LAEEVTRFVHG+EGL EA++ATEALRPG  +TKLDWK IE IA D+PSCSL  ++VL
Sbjct  388  QKKLAEEVTRFVHGEEGLREAIRATEALRPGT-ETKLDWKMIEKIAEDIPSCSLAKEEVL  446

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++D++VSSGLLES+ AARRM+KQGG+YLNN RV+ E+K++ +DDIV+GKVLLLSAGK
Sbjct  447  NSSIIDIAVSSGLLESRSAARRMMKQGGIYLNNERVEEESKRVGDDDIVEGKVLLLSAGK  506

Query  193  KNKMVVRIS  167
            KNK+VVRIS
Sbjct  507  KNKIVVRIS  515



>ref|XP_006826574.1| hypothetical protein AMTR_s00138p00020780 [Amborella trichopoda]
 gb|ERM93811.1| hypothetical protein AMTR_s00138p00020780 [Amborella trichopoda]
Length=495

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 111/128 (87%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL EA+KATEAL+PG ++ KLD K IE I +DVPSC L + +VL
Sbjct  366  QRRLAEEVTRFVHGKDGLLEAVKATEALKPG-SEAKLDSKIIEEIGADVPSCCLDYHEVL  424

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++DLSV+SGLLESK AARR++KQGGLYLNN RV+ E   +EE+DIVDGKVLLLSAGK
Sbjct  425  NRSLVDLSVASGLLESKSAARRLMKQGGLYLNNKRVNGEDILVEEEDIVDGKVLLLSAGK  484

Query  193  KNKMVVRI  170
            KNKMV++I
Sbjct  485  KNKMVIKI  492



>ref|XP_002992920.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
 gb|EFJ06009.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
Length=467

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 100/128 (78%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL+EALK T+AL PG+  T LDW  IE I+ DVPSC+L    V+
Sbjct  341  QRRLAEEVTRFVHGEDGLEEALKVTQALSPGST-TTLDWTAIEAISRDVPSCTLD-SSVV  398

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               V+DL VS GL  SK  ARR++KQGG+Y+NNA+VD E   + E DI+DGK+LLLSAGK
Sbjct  399  VGPVVDLCVSCGLAPSKAVARRLIKQGGIYMNNAKVDDERLLVAESDIIDGKMLLLSAGK  458

Query  193  KNKMVVRI  170
            KNKMVVRI
Sbjct  459  KNKMVVRI  466



>ref|XP_002980036.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
 gb|EFJ18906.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
Length=467

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 100/128 (78%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG++GL+EALK T+AL PG+  T LDW  IE I+ DVPSC+L    ++
Sbjct  341  QRRLAEEVTRFVHGEDGLEEALKVTQALAPGST-TTLDWTAIEAISKDVPSCTLD-SSIV  398

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               V+DL VS GL  SK  ARR++KQGG+Y+NNA+VD E   + E DI+DGK+LLLSAGK
Sbjct  399  VGPVVDLCVSCGLAPSKAVARRLIKQGGIYMNNAKVDDERLLVAESDIIDGKMLLLSAGK  458

Query  193  KNKMVVRI  170
            KNKMVVRI
Sbjct  459  KNKMVVRI  466



>emb|CBI22389.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 97/104 (93%), Gaps = 1/104 (1%)
 Frame = -1

Query  478  EALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvldlsvssglleSKFAARRMLK  299
            + +RPG A+TKLDWKTIEGIA DVPSCSL +D+VL++S+LDLS+S+GLLESK AARR+LK
Sbjct  297  DVVRPG-AETKLDWKTIEGIAKDVPSCSLSYDEVLNLSLLDLSISTGLLESKSAARRLLK  355

Query  298  QGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMVVRIS  167
            QGGLYLNN R+DSEAK+IE +DIVDGKVLLLSAGKKNK+VVRIS
Sbjct  356  QGGLYLNNNRIDSEAKRIEAEDIVDGKVLLLSAGKKNKVVVRIS  399



>ref|XP_005848281.1| hypothetical protein CHLNCDRAFT_48743 [Chlorella variabilis]
 gb|EFN56179.1| hypothetical protein CHLNCDRAFT_48743 [Chlorella variabilis]
Length=440

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG+EGL +ALKATEAL PG A TKLD  ++E  A D PS SLP DQV+
Sbjct  313  QRRLAEEVTRFVHGEEGLRQALKATEALAPGAA-TKLDADSLEAAAGDAPSASLPRDQVV  371

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               + D+ V+ G+  SK A RRM+K GG+ +NN +VD E   + EDD++DG+++L++AGK
Sbjct  372  GAPLADVMVAVGMQPSKAAVRRMIKGGGVRVNNEKVDDELAALGEDDLIDGRLVLIAAGK  431

Query  193  KNKMVVRIS  167
            KNKM+VR++
Sbjct  432  KNKMLVRVA  440



>gb|KIZ02509.1| tyrosyl-tRNA synthetase [Monoraphidium neglectum]
Length=155

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAE +T FVHG EGL  ALKATEALRPG A T+LD  T+E IA D P+CSL  +QV 
Sbjct  28   QRRLAEALTEFVHGPEGLATALKATEALRPGAA-TELDAATLEAIAGDAPTCSLKREQVE  86

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++D+ V+SG+L SK   RRM+K GG+YLNNA+V  + + +   D++DG++ LL+ GK
Sbjct  87   GQLLVDVVVASGMLPSKGEVRRMVKNGGVYLNNAKVADDKRALTPADLIDGRLALLACGK  146

Query  193  KNKMVVRI  170
            KNKM+VR+
Sbjct  147  KNKMLVRV  154



>ref|XP_001699082.1| hypothetical protein CHLREDRAFT_139405 [Chlamydomonas reinhardtii]
 gb|EDO98937.1| predicted protein [Chlamydomonas reinhardtii]
Length=492

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVTRFVHG+EGL +ALKATEAL+PG A T+LD  T+E +A D PS SLP   V 
Sbjct  364  QKRLAEEVTRFVHGEEGLAQALKATEALKPGAA-TQLDAATLEEVAGDAPSASLPRASVA  422

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               + D+ V+  L  SK AAR+++K GG+YLNNA+V  E   +  +D++DG++LL++AGK
Sbjct  423  GAPLADVMVAIKLQPSKSAARKLIKGGGVYLNNAKVVEELYVVRPEDLIDGRLLLVAAGK  482

Query  193  KNKMVVRI  170
            KNKM+VRI
Sbjct  483  KNKMLVRI  490



>ref|XP_002955541.1| hypothetical protein VOLCADRAFT_83275 [Volvox carteri f. nagariensis]
 gb|EFJ43394.1| hypothetical protein VOLCADRAFT_83275 [Volvox carteri f. nagariensis]
Length=520

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG+EGL +A+KATEAL+PG A T+LD  T+E +A D PS +L    V 
Sbjct  391  QRRLAEEVTRFVHGEEGLAQAIKATEALKPGAA-TQLDAATLETVAGDAPSATLTRGSVE  449

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             + + D+ V+  L  SK AAR+++K GG+YLNNA+V  E   ++  D++DG++LL++AGK
Sbjct  450  GVPLADILVAVKLQPSKSAARKLIKGGGVYLNNAKVSEELYTVKPSDLIDGRLLLIAAGK  509

Query  193  KNKMVVRIS  167
            KNKM+VR++
Sbjct  510  KNKMLVRVA  518



>ref|XP_003059850.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55802.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=430

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVTRFVHG+ GL +ALKATE L+PG ADT LD  T+E +A D+PS  L   +V+
Sbjct  304  QKRLAEEVTRFVHGEAGLSQALKATEGLKPG-ADTVLDADTLEALAGDIPSAELSLGEVV  362

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              +V+D+  ++GL +SK  A+R++K GG  +NN +V+ E K IEE D+VDG+VLLL+AGK
Sbjct  363  GRTVVDVMAATGLQKSKGEAKRLIKGGGARVNNVKVEDEGKVIEEGDVVDGRVLLLAAGK  422

Query  193  KNKMVVRI  170
            KNK++VR+
Sbjct  423  KNKLLVRV  430



>ref|XP_002504529.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65787.1| predicted protein [Micromonas sp. RCC299]
Length=506

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVTRFVHG+EGL +ALKATE L+PG ADT LD  T+E +A D+P+  L  D+V+
Sbjct  379  QKRLAEEVTRFVHGKEGLTQALKATEGLKPG-ADTVLDAATLEALAGDIPTAELARDEVV  437

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              +V+D+  ++GL +SK  A+RM+K GG  LNN +V+ E   I EDD+++G+VLLL+AGK
Sbjct  438  GKTVVDVMAATGLQKSKGEAKRMIKGGGARLNNVKVEDEEATIGEDDVIEGRVLLLAAGK  497

Query  193  KNKMVVRI  170
            KNK++VR+
Sbjct  498  KNKLLVRV  505



>ref|XP_005650588.1| tyrosyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE26044.1| tyrosyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=450

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LA EVTRFVHGQ GLD+AL AT+AL PG +DTKLD  T+E +A   P+  LP  QVL
Sbjct  322  QRLLASEVTRFVHGQLGLDQALNATQALAPG-SDTKLDIDTLEAVAGSAPTVELPAGQVL  380

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              ++ D+ V+  L ESK A RR++K GG+ +NN +V  E +++ EDD +DG++ L++AGK
Sbjct  381  GQTLADIMVAIKLQESKSAGRRLIKGGGVRVNNQKVSDEQRRLSEDDFIDGRLALIAAGK  440

Query  193  KNKMVVRIS  167
            KNKM++RIS
Sbjct  441  KNKMLLRIS  449



>ref|XP_001751567.1| predicted protein [Physcomitrella patens]
 gb|EDQ83884.1| predicted protein [Physcomitrella patens]
Length=502

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 103/129 (80%), Gaps = 2/129 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVTRFVHG++GL EALKAT+AL P  A   LD +T+E IA DVPSCS+ +  V+
Sbjct  375  QKRLAEEVTRFVHGEQGLTEALKATQALAP-GAAAALDSQTLEAIAQDVPSCSISYS-VV  432

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++D+SVS+GLL+SK A RR++KQGGLYLNN +V+ E K +  +DI+D K+ LLSAGK
Sbjct  433  GKPLVDVSVSTGLLQSKAAVRRLIKQGGLYLNNVKVEDEGKTMVAEDIIDDKIFLLSAGK  492

Query  193  KNKMVVRIS  167
            KN++VVR++
Sbjct  493  KNRLVVRVT  501



>ref|XP_001416448.1| Tyrosyl-tRNA synthetase, probable [Ostreococcus lucimarinus CCE9901]
 gb|ABO94741.1| Tyrosyl-tRNA synthetase, probable [Ostreococcus lucimarinus CCE9901]
Length=484

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 92/129 (71%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVTRFVHG +GL+EA  AT  L+PG ADT LD   +  +   VPS +LP  QVL
Sbjct  357  QRRLAEEVTRFVHGVQGLEEAQAATSVLKPG-ADTDLDVTALTALEGIVPSATLPMQQVL  415

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             IS++ L+V  GL  SK A +R+++ GGL LNN +V S+   +   DIVDG++LLL+AGK
Sbjct  416  GISLVQLAVDVGLQPSKGATKRLIQGGGLRLNNIKVLSDEATVSMADIVDGRLLLLAAGK  475

Query  193  KNKMVVRIS  167
            KNK+++ ++
Sbjct  476  KNKLLISVT  484



>ref|WP_032125960.1| tyrosyl-tRNA synthetase [Chlamydia sp. 'Diamant']
Length=424

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEE+TR VHG EGL  A+K TE + PG + TKLD + +E +A+D+PSC + FD V+
Sbjct  296  QKRLAEEITRMVHGGEGLKTAIKVTEGIAPG-SQTKLDAEMLESLAADMPSCEMAFDSVV  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +  ++DL V +GL  SK  A+R+L+ GG+Y+NN +++ E   + ++ ++  +++LL+AGK
Sbjct  355  NKKLIDLLVEAGLQASKGDAKRLLRNGGVYINNEKIEDENCVVGDNYLISNRLILLAAGK  414

Query  193  KNKMVVRI  170
            KNKM++R+
Sbjct  415  KNKMLIRL  422



>ref|WP_039359281.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia amoebophila]
Length=425

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEE+TR VHG+EGL  A+K TE + PG + T L+   +E +A+D+PSC +  + VL
Sbjct  296  QKRLAEEITRLVHGEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVL  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +  ++DL   + L  SK  ARR+L+ GG+Y+NN +++ E   I  + ++  +++LL+AGK
Sbjct  355  NKKLIDLLAETKLQTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGK  414

Query  193  KNKMVVRI  170
            KNKM++R+
Sbjct  415  KNKMIIRL  422



>ref|WP_042279297.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia sp. R18]
Length=425

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEE+TR VHG+EGL  A+K TE + PG + T L+   +E +A+D+PSC +  + VL
Sbjct  296  QKRLAEEITRLVHGEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVL  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +  ++DL   + L  SK  ARR+L+ GG+Y+NN +++ E   I  + ++  +++LL+AGK
Sbjct  355  NKKLIDLLAETKLQTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGK  414

Query  193  KNKMVVRI  170
            KNKM++R+
Sbjct  415  KNKMIIRL  422



>ref|WP_011175719.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia amoebophila]
 sp|Q6MC06.1|SYY_PARUW RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Candidatus Protochlamydia amoebophila 
UWE25]
 emb|CAF23893.1| probable tyrosine-tRNA ligase [Candidatus Protochlamydia amoebophila 
UWE25]
Length=425

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEE+TR VHG+EGL  A+K TE + PG + T L+   +E +A+D+PSC +  + VL
Sbjct  296  QKRLAEEITRLVHGEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVL  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +  ++DL V + L  SK  ARR+L+ GG+Y+NN +++ E   I  + ++  +++LL+AGK
Sbjct  355  NKKLIDLLVETKLQTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGK  414

Query  193  KNKMVVRI  170
            KNKM++R+
Sbjct  415  KNKMIIRL  422



>gb|KIC71389.1| Tyrosine--tRNA ligase [Candidatus Protochlamydia amoebophila]
Length=437

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEE+TR VHG+EGL  A+K TE + PG + T L+   +E +A+D+PSC +  + VL
Sbjct  308  QKRLAEEITRLVHGEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVL  366

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +  ++DL   + L  SK  ARR+L+ GG+Y+NN +++ E   I  + ++  +++LL+AGK
Sbjct  367  NKKLIDLLAETKLQTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGK  426

Query  193  KNKMVVRI  170
            KNKM++R+
Sbjct  427  KNKMIIRL  434



>ref|XP_003075033.1| TyrS Tyrosyl-tRNA synthetase, probable (IC) [Ostreococcus tauri]
 emb|CAL52305.2| Aminoacyl-tRNA synthetase, class Ic [Ostreococcus tauri]
Length=488

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA EVTRFVHGQ+GLDEA++ATE+LRPG  +T LD   +E  +  +PS ++    V+
Sbjct  358  QQILAAEVTRFVHGQDGLDEAIRATESLRPGT-ETVLDAAALELASDTIPSVAISRVAVV  416

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               V D+ V SGLLESK AA+RML+ GG+ +NN +V  E + I E DI+   +LLL+AGK
Sbjct  417  DNLVTDVVVVSGLLESKGAAKRMLRNGGIRVNNNKVTDETRTIVEGDIIGDNMLLLAAGK  476

Query  193  KNKMVVRI  170
            KNK+++R+
Sbjct  477  KNKLLIRL  484



>ref|WP_013182397.1| tyrosyl-tRNA synthetase [Waddlia chondrophila]
 gb|ADI38686.1| Tyrosyl-tRNA synthetase [Waddlia chondrophila WSU 86-1044]
 emb|CCB90919.1| tyrosyl-tRNA synthetase [Waddlia chondrophila 2032/99]
Length=427

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLA EVT+ VHG +GL  ALK TEA +PG  +T L+ + +E IA D+PS +   ++++
Sbjct  296  QKRLAAEVTQMVHGDQGLKTALKVTEAAKPGR-ETDLNAEVLESIAHDMPSETFKAEEIV  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +  ++D+ V +GL ESK  ARR+++ GG YLNN ++  E      DD VDG+++LL+ GK
Sbjct  355  NNKLIDVVVLTGLQESKGQARRLIRNGGCYLNNKKMTEENHVFTADDFVDGRLILLAVGK  414

Query  193  KNKMVVRIS*PI  158
            KNK ++R+  P+
Sbjct  415  KNKKLIRLDKPV  426



>ref|WP_042103652.1| tyrosyl-tRNA synthetase [Parachlamydiaceae bacterium HS-T3]
Length=420

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 87/128 (68%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVTR VHG+EGL  A+K T+A +PG A T L  + +E ++ D+PS  LP   ++
Sbjct  293  QKRLAEEVTRIVHGEEGLQTAIKVTQAAKPG-AQTDLSLEALEMLSRDMPSIQLPLADLV  351

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +  ++D+   SGL  SK  AR+++K GG YLNN +V      I+  D++  K+LLL+ GK
Sbjct  352  NKKIVDVLALSGLQSSKSEARKLIKNGGFYLNNHQVLDIDAAIQPSDLIGEKMLLLAVGK  411

Query  193  KNKMVVRI  170
            KNK++V++
Sbjct  412  KNKLLVKV  419



>ref|WP_006340872.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|EFB41848.1| hypothetical protein pah_c022o146 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB86267.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae UV-7]
Length=430

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 85/129 (66%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAEEVTR VHG+EGL  ALK TE   PG A T LD + +  +A D+P+ ++  + +L
Sbjct  296  QRKLAEEVTRIVHGEEGLRIALKVTEGAAPGAA-TALDAEVLNNLADDMPNYTVSMENIL  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +  ++D+        SK   R+++K GG+YLNN R++ E   +    ++DG ++L++ GK
Sbjct  355  NRRLVDVVSEITPERSKGDLRKLIKNGGVYLNNLRIEEENYILTPKALIDGNLMLIAFGK  414

Query  193  KNKMVVRIS  167
            KNK++VR+S
Sbjct  415  KNKILVRVS  423



>ref|XP_010229641.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Brachypodium distachyon]
Length=473

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  380
            QR LAEE+TRFVHGQEGL+EALKAT+ALRPG A T+LD +TIEGIA DVPSCSLP+DQ
Sbjct  385  QRILAEEITRFVHGQEGLEEALKATQALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQ  441



>ref|WP_013943141.1| tyrosyl-tRNA synthetase [Simkania negevensis]
 emb|CCB88674.1| tyrosyl-tRNA synthetase [Simkania negevensis Z]
Length=424

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 84/129 (65%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVTRFVHG+EG+  AL+ T A+ PG ++  LD + +E IA D+P  +L   +VL
Sbjct  296  QKRLAEEVTRFVHGEEGVQIALRVTAAIAPG-SNASLDPEILEEIARDMPHVALDVSEVL  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
                 D+   +G + SK  A R+++ GG YLNN +V+  A  I +  ++  K ++L +GK
Sbjct  355  DQKYTDVITKAGFVTSKSEAARLIQNGGAYLNNEKVEDPAFTITKKHLIGNKYVMLGSGK  414

Query  193  KNKMVVRIS  167
            K KM+++I+
Sbjct  415  KKKMLIKIA  423



>emb|CDZ80947.1| Tyrosine--tRNA ligase [Chlamydia sp. 'Rubis']
Length=419

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 87/129 (67%), Gaps = 1/129 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLA  +T  VHG+  L  ALK T+ + PG A T+LD +T++ ++ D+ SC L + +V+
Sbjct  291  QKRLAHVMTELVHGENNLQLALKVTQGIAPG-AITQLDSQTLQALSKDLGSCQLSYKEVV  349

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +  +LDL V SGL  SK  AR+ +  GG+YLNN ++  E   + +  ++DG +LLLS GK
Sbjct  350  NHKILDLLVKSGLQPSKTQARKSMTSGGIYLNNEKITDEEAVLLDKHLIDGNMLLLSFGK  409

Query  193  KNKMVVRIS  167
            KNK+VV+++
Sbjct  410  KNKIVVQLN  418



>ref|XP_005713019.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Chondrus 
crispus]
 emb|CDF33216.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Chondrus 
crispus]
Length=510

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVTR VHG++G+  AL AT A  PG+    L  + +E I++D+PS ++    V+
Sbjct  383  QKRLAEEVTRMVHGEKGVVSALAATAAAAPGSKAV-LSVEALEAISADMPSATMTRADVV  441

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               +LDL V SGL +SK  ARR++K GG YLNN ++ +E   I E+D+V GK++LL+AGK
Sbjct  442  GGGILDLMVQSGLQKSKGEARRLIKGGGAYLNNGKITTEKLSISEEDLVGGKLILLAAGK  501

Query  193  KNKMVVRI  170
            KNK+VVR+
Sbjct  502  KNKLVVRV  509



>ref|WP_039384881.1| tyrosyl-tRNA synthetase [Neochlamydia sp. TUME1]
 gb|KIC75964.1| Tyrosine--tRNA ligase [Neochlamydia sp. TUME1]
Length=424

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 85/128 (66%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLA+EVTR VHG+E L  AL  TEA  PG A   LD  T+E +A ++PS  L    V+
Sbjct  296  QKRLAKEVTRIVHGEENLKIALGVTEAAAPG-AKANLDATTLELMAQNMPSRILNNKTVI  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +  +L+L    GLL SK  ARR+ + GG+YLNN +V+ E   I+ DD++  +++LL+ GK
Sbjct  355  NAKLLELICQVGLLPSKSEARRLARNGGIYLNNNKVEDENYIIQPDDLIANRLMLLAVGK  414

Query  193  KNKMVVRI  170
            KNK+++ I
Sbjct  415  KNKILISI  422



>ref|WP_042240888.1| tyrosyl-tRNA synthetase [Neochlamydia sp. S13]
Length=424

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 85/128 (66%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLA+EVTR VHG+E L  AL  TEA  PG A   LD  T+E +A ++PS  L    V+
Sbjct  296  QKRLAKEVTRIVHGEENLKIALGVTEAAAPG-AKANLDAPTLELMAQNMPSRILNNKTVI  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +  +L+L    GLL SK  ARR+ + GG+YLNN +V+ E   I+ DD++  +++LL+ GK
Sbjct  355  NAKLLELICQVGLLPSKSEARRLARNGGIYLNNNKVEDENYIIQPDDLIANRLMLLAVGK  414

Query  193  KNKMVVRI  170
            KNK+++ I
Sbjct  415  KNKILISI  422



>gb|KIC73976.1| Tyrosine--tRNA ligase [Neochlamydia sp. EPS4]
Length=424

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 84/128 (66%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLA+EVTR VHG+E L  AL  TEA  PG A   LD  T+E +A ++PS  L    V+
Sbjct  296  QKRLAKEVTRIVHGEENLKIALGVTEAAAPG-AKANLDAPTLELMAQNMPSRILNNKTVI  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +  +L+L    GLL SK  ARR+ + GG+YLNN +V+ E   I+ DD++   ++LL+ GK
Sbjct  355  NAKLLELICQVGLLPSKSEARRLARNGGIYLNNNKVEDENYIIQPDDLIANHLMLLAVGK  414

Query  193  KNKMVVRI  170
            KNK+++ I
Sbjct  415  KNKILISI  422



>ref|WP_039376683.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|KIA77993.1| Tyrosine--tRNA ligase [Parachlamydia acanthamoebae]
Length=437

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAEEVTR VHG+EGL  ALK TE   PG A T LD + +  +A D+P+ ++  + +L
Sbjct  296  QRKLAEEVTRIVHGEEGLRIALKVTEGAAPGAA-TALDAEVLNNLADDMPNYTVSMENIL  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +  ++D+        SK   R+++K GG+YLNN R++ E   +    ++DG ++L++ GK
Sbjct  355  NRRLVDVVSEITPERSKGDLRKLIKNGGVYLNNLRIEEENYILTPKALIDGNLMLIAFGK  414

Query  193  KNKMV  179
            K K +
Sbjct  415  KIKYL  419



>ref|XP_005538192.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82156.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Cyanidioschyzon 
merolae strain 10D]
Length=522

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 88/137 (64%), Gaps = 8/137 (6%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPG--------NADTKLDWKTIEGIASDVPSC  398
            Q+ LA EVTR VHG +G++ AL AT    PG        N  T+L    +E ++S +P  
Sbjct  384  QKLLAMEVTRIVHGDKGVETALAATAVAAPGHVPGGEHTNGSTRLRADVLEAVSSSLPGA  443

Query  397  SLPFDQvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGK  218
            +LP   ++ + ++D+ V +GL +SK  ARR++  GG Y+N+ +V    + IE  D+++G+
Sbjct  444  TLPRTALVGVPLVDVMVRAGLQKSKGEARRLIANGGAYVNDEKVSDSGRTIEATDLIEGR  503

Query  217  VLLLSAGKKNKMVVRIS  167
            +LLL+AGKKNKM+VR+S
Sbjct  504  LLLLAAGKKNKMLVRVS  520



>ref|XP_007509051.1| tyrosyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO19508.1| tyrosyl-tRNA synthetase [Bathycoccus prasinos]
Length=486

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 85/128 (66%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q RLAEEVTRFVHG+ GL +A+ AT+ L PG +DT+LD   +E +   VP+       ++
Sbjct  358  QVRLAEEVTRFVHGEVGLQKAITATKGLLPG-SDTELDIDVLESLIDVVPTAICARTDII  416

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             I ++D++V  GL +SK   RRM+  GG+ +NN +V   +  I  ++++ G++LL+S GK
Sbjct  417  GIPIVDVAVKVGLRKSKAEVRRMIDGGGVRINNKKVLDVSTCISPEELIAGRMLLISMGK  476

Query  193  KNKMVVRI  170
            KNK ++++
Sbjct  477  KNKFLIQV  484



>gb|AFG55783.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  380
            QR+LAEEVT FVHG+EGL EAL+ATEAL PG+  T LDWKTI+ IA++VPS  L +D+
Sbjct  83   QRKLAEEVTCFVHGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPSFLLSYDE  139



>gb|AFG55790.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55791.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55792.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55793.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55795.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55797.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  380
            QR+LAEEVT FVHG+EGL EAL+ATEAL PG+  T LDWKTI+ IA++VPS  L +D+
Sbjct  83   QRKLAEEVTCFVHGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPSFLLSYDE  139



>gb|AEW07904.1| hypothetical protein 0_14069_01, partial [Pinus radiata]
 gb|AFG55785.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55786.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55788.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55789.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55794.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55796.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55798.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55799.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  380
            QR+LAEEVT FVHG+EGL EAL+ATEAL PG+  T LDWKTI+ IA++VPS  L +D+
Sbjct  83   QRKLAEEVTCFVHGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPSFLLSYDE  139



>gb|AFG55784.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55787.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQ  380
            QR+LAEEVT FVHG+EGL EAL+ATEAL PG+  T LDWKTI+ IA++VPS  L +D+
Sbjct  83   QRKLAEEVTCFVHGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPSFLLSYDE  139



>ref|XP_011397334.1| Tyrosine-tRNA ligase [Auxenochlorella protothecoides]
 gb|KFM24446.1| Tyrosine-tRNA ligase [Auxenochlorella protothecoides]
Length=476

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 80/123 (65%), Gaps = 1/123 (1%)
 Frame = -1

Query  535  EVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIE-GIASDVPSCSLPFDQvlsisvl  359
            EVTRFVHG+EGL  AL AT AL PG+++  +D +T+E  +A   P  ++  +  L   ++
Sbjct  350  EVTRFVHGEEGLRGALAATRALAPGSSEGSVDLQTLEAAVAGGAPKFAVDREAALGGPLI  409

Query  358  dlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMV  179
            DL V  G   SK AARR+++  GL +NN  V  E + +  DD+VDG+++++S GKK K+V
Sbjct  410  DLLVRVGAQPSKGAARRLVQGRGLRVNNKVVTDEGRGLAADDLVDGRLVMVSLGKKKKLV  469

Query  178  VRI  170
            + +
Sbjct  470  LEL  472



>ref|XP_009516786.1| hypothetical protein PHYSODRAFT_552811 [Phytophthora sojae]
 gb|EGZ29511.1| hypothetical protein PHYSODRAFT_552811 [Phytophthora sojae]
Length=428

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 83/128 (65%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LAE++T  +HGQEGL  AL ATE L  G     L  + +  +A D P  +L    V+
Sbjct  301  QKVLAEDITAMMHGQEGLKAALDATELLF-GKKSGPLTAEEMLRMAGDAPMSALSRADVV  359

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              S++DL+V  G  +SK   RR++K GG+YLNN RV+SEA ++E  +++DGK+L+L  G+
Sbjct  360  DQSLVDLAVRIGAAKSKAECRRLIKGGGVYLNNERVESEALRVEAANLLDGKLLVLRIGR  419

Query  193  KNKMVVRI  170
            +N  +V++
Sbjct  420  RNNFIVQV  427



>ref|WP_022848286.1| tyrosyl-tRNA synthetase [Chloroflexi bacterium oral taxon 439]
Length=430

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 80/137 (58%), Gaps = 14/137 (10%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSL------  392
            QR LAEE+T  +HGQ+ LD+A +AT AL  G+ D  L    I+ I +DVPS ++      
Sbjct  298  QRALAEEMTYLMHGQKALDKARQATSALFGGDID-GLSADDIQDIFADVPSKTIRPAELS  356

Query  391  --PFDQvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGK  218
              P D         LS +SG L+SK  ARR + +GG+YLNN R D+ A  +   D ++G 
Sbjct  357  GAPVD-----LAAFLSETSGFLKSKGEARRAIAEGGIYLNNHRADNAAAIVTRSDFIEGA  411

Query  217  VLLLSAGKKNKMVVRIS  167
             L+L  GKKN  +VR+S
Sbjct  412  FLVLRRGKKNYFLVRLS  428



>ref|XP_008910914.1| tyrosine-tRNA ligase [Phytophthora parasitica INRA-310]
 gb|ETN03687.1| tyrosine-tRNA ligase [Phytophthora parasitica INRA-310]
Length=428

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LAE++T  +HGQEGL  AL ATE L  G     L  + +  +A D P   L    V+
Sbjct  301  QKVLAEDITVMMHGQEGLKAALDATELLF-GKKQGPLTAEEMLQMAGDAPMTILSRTDVV  359

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              S++DL+V  G ++SK   RR++K GG+YLNN RV+SEA ++E  +++D KVL++  G+
Sbjct  360  DQSLVDLAVRIGAVKSKAECRRLIKGGGVYLNNERVESEALRVEPSNLLDDKVLMVRVGR  419

Query  193  KNKMVVRI  170
            +N  +V++
Sbjct  420  RNNFIVQV  427



>gb|ETI39233.1| tyrosine-tRNA ligase [Phytophthora parasitica P1569]
 gb|ETK79440.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETL32852.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETL86112.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETM39261.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETO67974.1| tyrosine-tRNA ligase [Phytophthora parasitica P1976]
 gb|ETP09145.1| tyrosine-tRNA ligase [Phytophthora parasitica CJ01A1]
 gb|ETP37177.1| tyrosine-tRNA ligase [Phytophthora parasitica P10297]
Length=428

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LAE++T  +HGQEGL  AL ATE L  G     L  + +  +A D P   L    V+
Sbjct  301  QKVLAEDITVMMHGQEGLKAALDATELLF-GKKQGPLTAEEMLQMAGDAPMTILSRTDVV  359

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              S++DL+V  G ++SK   RR++K GG+YLNN RV+SEA ++E  +++D KVL++  G+
Sbjct  360  DQSLVDLAVRIGAVKSKAECRRLIKGGGVYLNNERVESEALRVEPSNLLDDKVLMVRVGR  419

Query  193  KNKMVVRI  170
            +N  +V++
Sbjct  420  RNNFIVQV  427



>ref|WP_041017153.1| tyrosyl-tRNA synthetase [Criblamydia sequanensis]
 emb|CDR33719.1| Tyrosyl-tRNA synthetase [Criblamydia sequanensis CRIB-18]
Length=420

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 90/127 (71%), Gaps = 3/127 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q++LAEEVTRFVHG+EGL++AL AT+A  PG ++T LD  ++E    D+P    P + ++
Sbjct  293  QKKLAEEVTRFVHGEEGLEKALLATKAAAPG-SETVLDADSLEIAMKDMPYFE-P-ELLV  349

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL   SGL  SK AARR++++GG+ LNN +++ E K I+ +D++  + ++++ GK
Sbjct  350  GSKLIDLIADSGLRPSKSAARRLIREGGVSLNNKKINDEEKVIQTEDLIGNRFVVVTLGK  409

Query  193  KNKMVVR  173
            K KM+V+
Sbjct  410  KQKMLVK  416



>ref|XP_002907836.1| tyrosyl-tRNA synthetase, putative [Phytophthora infestans T30-4]
 gb|EEY64400.1| tyrosyl-tRNA synthetase, putative [Phytophthora infestans T30-4]
Length=428

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 80/127 (63%), Gaps = 1/127 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LAEE+T  +HGQEGL  AL ATE L  G     L  + +  +A D P   L    V+
Sbjct  301  QKVLAEEITVMMHGQEGLKAALDATEMLF-GKKTGPLTSEEMLCMAGDAPMTVLSRADVI  359

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + S++DL+V  G  +SK   RR++K GG+YLNN RV+S A +I + +++D KVL++  G+
Sbjct  360  NQSLVDLAVRIGATKSKAECRRLIKSGGVYLNNERVESAALRIGKSNLLDDKVLVVRVGR  419

Query  193  KNKMVVR  173
            +N  +V+
Sbjct  420  RNNFIVQ  426



>ref|WP_022864835.1| tyrosyl-tRNA synthetase [Varibaculum cambriense]
Length=421

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 75/122 (61%), Gaps = 3/122 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA EVTR VHGQE LD+ L ATEAL       ++D KT++G  + +PS ++   +  
Sbjct  295  QKALAAEVTRLVHGQEALDQVLAATEALWGSGDLRQVDGKTLKGATAHLPSATVEIGK--  352

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              +++DL +++G  + + AA R +K GG YLNN ++    + I  +D++ G ++L   GK
Sbjct  353  -TNLVDLLIAAGFEKGRGAAMRTIKNGGAYLNNQKITDPDRTITSEDVLPGSLVLFRKGK  411

Query  193  KN  188
            +N
Sbjct  412  RN  413



>ref|WP_040313631.1| tyrosyl-tRNA synthetase [Actinomyces cardiffensis]
Length=420

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 74/129 (57%), Gaps = 3/129 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA EVTR VHG+E LD  L AT AL  G     +D +T+    SD+P   L   +  
Sbjct  295  QKALAAEVTRLVHGEEELDRVLAATNALWGGGDLHAIDEQTLSSATSDLPQACLKLGE--  352

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              +++D  V +GL + K AARR L  GG YLNN +V+ E   I  +D++ G  +L+  G+
Sbjct  353  -ATIIDALVETGLEKGKSAARRTLASGGAYLNNIKVEDEDAPICVEDLLAGSRVLVRKGR  411

Query  193  KNKMVVRIS  167
            +N  VV +S
Sbjct  412  RNLAVVELS  420



>gb|ENO19082.1| tyrosine--tRNA ligase [Actinomyces cardiffensis F0333]
Length=423

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 74/129 (57%), Gaps = 3/129 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA EVTR VHG+E LD  L AT AL  G     +D +T+    SD+P   L   +  
Sbjct  298  QKALAAEVTRLVHGEEELDRVLAATNALWGGGDLHAIDEQTLSSATSDLPQACLKLGE--  355

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              +++D  V +GL + K AARR L  GG YLNN +V+ E   I  +D++ G  +L+  G+
Sbjct  356  -ATIIDALVETGLEKGKSAARRTLASGGAYLNNIKVEDEDAPICVEDLLAGSRVLVRKGR  414

Query  193  KNKMVVRIS  167
            +N  VV +S
Sbjct  415  RNLAVVELS  423



>ref|XP_009837943.1| tyrosine-tRNA ligase [Aphanomyces astaci]
 gb|ETV72715.1| tyrosine-tRNA ligase [Aphanomyces astaci]
Length=439

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 72/129 (56%), Gaps = 3/129 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LAE  TR +HG+  L  A  A + L  G+ D       ++ +A D P  SL  + V 
Sbjct  308  QQILAEHTTRMIHGEVALKAAQVAAKVLFGGSLDGV---DAVDILAIDAPRSSLALELVR  364

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               V+D+      + +K   RR++K GG+Y+NN RVDS+A  IE   +++G+ +L+  GK
Sbjct  365  GKRVVDVLALIRAVPTKAEGRRLIKAGGVYINNVRVDSDAAVIEASQVIEGRAVLVRVGK  424

Query  193  KNKMVVRIS  167
            +N  V+ IS
Sbjct  425  RNYHVLHIS  433



>ref|WP_029668640.1| tyrosyl-tRNA synthetase [Candidatus Ancillula trichonymphae]
Length=418

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 77/129 (60%), Gaps = 4/129 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAEEVT+FVHG+E   +A++A++AL    +  K+D  TI    S + +        +
Sbjct  294  QRKLAEEVTKFVHGREAFVQAVEASDALFGRGSIEKIDEATIIAAISGLETSEANLGDKI  353

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            S   ++  +S+   +     R+ L  GG+Y+NN +V+S  + IE  DI++G+V+LL  GK
Sbjct  354  SEQFVNTKLSASFNDY----RKTLSAGGVYVNNKKVESLDRAIENTDILNGQVVLLRKGK  409

Query  193  KNKMVVRIS  167
            KN   VRI+
Sbjct  410  KNIAAVRIT  418



>dbj|BAI65246.1| tyrosyl-tRNA synthetase [Rothia mucilaginosa DY-18]
Length=211

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 71/128 (55%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA  VT  VHG E  D+A+ A+EAL        LD  T+E + +++PS  LP D++ 
Sbjct  86   QKTLAYLVTSLVHGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLPADRLD  145

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             ISVL     +        ARR+LK+GG  +N  +V  E   I +DD++ G+  ++  GK
Sbjct  146  MISVLTELGFAKSNSE---ARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGK  202

Query  193  KNKMVVRI  170
            KN+  V +
Sbjct  203  KNQGAVEL  210



>ref|WP_044150629.1| tyrosyl-tRNA synthetase, partial [Rothia mucilaginosa]
Length=211

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 71/128 (55%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA  VT  VHG E  D+A+ A+EAL        LD  T+E + +++PS  LP D++ 
Sbjct  86   QKTLAYLVTSLVHGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLPADRLD  145

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             ISVL     +        ARR+LK+GG  +N  +V  E   I +DD++ G+  ++  GK
Sbjct  146  MISVLTELGFAKSNSE---ARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGK  202

Query  193  KNKMVVRI  170
            KN+  V +
Sbjct  203  KNQGAVEL  210



>ref|WP_013600598.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans]
 gb|ADX72661.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans Sphe3]
Length=438

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 75/132 (57%), Gaps = 5/132 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            QR+LA EVT  VHG E  ++ + A+ AL  GN D T LD  T++   S++PS ++  D++
Sbjct  311  QRKLAYEVTSLVHGVEATEKVIAASAALF-GNGDLTALDKTTLQAATSELPSATVQVDEM  369

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + +L  S  S     K AARR + +GG Y+NN +V      I E +++ G+ LLL  G
Sbjct  370  GIVDLLVASGLSES---KSAARRTVGEGGAYVNNEKVSDPEAVISESELLHGQYLLLRRG  426

Query  196  KKNKMVVRIS*P  161
            KKN   V +  P
Sbjct  427  KKNLATVEVLVP  438



>ref|XP_005707106.1| tyrosyl-tRNA synthetase [Galdieria sulphuraria]
 gb|EME30586.1| tyrosyl-tRNA synthetase [Galdieria sulphuraria]
Length=501

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 81/128 (63%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNA--DTKLDWKTIEGIASDVPSCSLPFDQ  380
            Q+ LAEEVTR VHG EG+  A + T A  PG    ++ LD+ T+  +  ++PS  +  + 
Sbjct  370  QKLLAEEVTRLVHGDEGVKFAQRVTSASSPGRLVEESILDFDTLRQLKDEIPSKEIRKEH  429

Query  379  vlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  200
            +L  S++++ V  G+++SK  A+R +  GG Y+NN RV+   + I ++D+V+  +LLL  
Sbjct  430  LLKKSLIEVLVECGIMKSKSEAKRFIINGGCYINNRRVEELDRSIGQEDLVENSMLLLGI  489

Query  199  GKKNKMVV  176
            GKK K+++
Sbjct  490  GKKQKILL  497



>ref|WP_021271485.1| tyrosyl-tRNA synthetase [Bacteriovorax sp. BSW11_IV]
 gb|EQC46963.1| tyrosine--tRNA ligase [Bacteriovorax sp. BSW11_IV]
Length=423

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 73/131 (56%), Gaps = 6/131 (5%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LAEEV + VHG+EGL+ AL+AT+    G A TK+  K +  I  DVPS  L  D+ L
Sbjct  295  QKTLAEEVVKLVHGEEGLEAALRATKFFF-GEAITKISDKEVAAIFEDVPSVKL--DKAL  351

Query  373  sisvldlsvssglle---SKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  203
                +++           SK  A+R L Q G+ LNN ++D  A K+  D++V    L+L 
Sbjct  352  LEEGIEICELLVQTPLFPSKKEAKRSLDQKGVSLNNNKIDDTAMKVTRDNLVSETSLILR  411

Query  202  AGKKNKMVVRI  170
             GKKN  VVR 
Sbjct  412  KGKKNYCVVRF  422



>ref|WP_024058184.1| tyrosyl-tRNA synthetase [Varibaculum cambriense]
 gb|ETI82476.1| hypothetical protein Q618_VCMC00001G0057 [Varibaculum cambriense 
DORA_20]
Length=421

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 75/128 (59%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA EVTR VHGQE LD+ L ATEAL       ++D  T++G  + +PS  +   +  
Sbjct  295  QKALAAEVTRLVHGQEALDQVLAATEALWGSGDLHQVDGNTLKGATAHLPSAKVEIGK--  352

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              +++DL +++G  + + AA R +K GG YLNN +V    + I  +D++ G ++L   GK
Sbjct  353  -TNLVDLLIAAGFEKGRGAAMRTIKNGGAYLNNQKVTDPDRVITSEDVLPGSLVLFRKGK  411

Query  193  KNKMVVRI  170
            +N  V  +
Sbjct  412  RNLAVAYL  419



>ref|XP_004334902.1| tyrosine-tRNA ligase [Acanthamoeba castellanii str. Neff]
 gb|ELR12889.1| tyrosine-tRNA ligase [Acanthamoeba castellanii str. Neff]
Length=480

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 74/129 (57%), Gaps = 0/129 (0%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LAEEVTR V G++GL  ALKAT  +        L    +  +  DVPS +LP   V+
Sbjct  350  QKVLAEEVTRLVRGEQGLHTALKATRVMFGDEPVDSLPPSELLAVLKDVPSVTLPRSSVV  409

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               +  L V+     SK  ARR++K GG+Y+N+ RV ++  ++  DD++   + +L  GK
Sbjct  410  GQPLSGLMVACRATASKGEARRLVKGGGVYVNSKRVPNDDYQVGPDDVLGDALCVLRVGK  469

Query  193  KNKMVVRIS  167
            K+  +V+++
Sbjct  470  KSYFLVKLT  478



>gb|KDO34878.1| tyrosyl-tRNA synthetase [Saprolegnia parasitica CBS 223.65]
Length=429

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 76/131 (58%), Gaps = 3/131 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ +AE VT  +HG+  L++A +A + L  G+ D  +   T+  I  D P  +L   QV+
Sbjct  302  QQTVAEHVTTLIHGKNALEQAQRAAKVLFGGSCD-GISAATMLSI--DAPKTALAPAQVI  358

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++D+    G +++K   RR++K GGLY+NN RV+S+A   E    ++G+  LL  GK
Sbjct  359  GQKIVDVVGLLGAVKTKAEIRRLIKAGGLYINNVRVESDAAVFESHHAIEGQATLLRTGK  418

Query  193  KNKMVVRIS*P  161
            +N  ++ I+ P
Sbjct  419  RNYHIIHITTP  429



>ref|WP_018200080.1| tyrosyl-tRNA synthetase [Candidatus Hydrogenedens terephthalicus]
Length=427

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 80/129 (62%), Gaps = 2/129 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA E+TR VHG+  L  A++A+EA+  G+   +L+   +E + SDVP    P + + 
Sbjct  298  QKALAREITRMVHGETALQSAIRASEAMFGGDLH-QLELSVLEDVFSDVPHAEAPINYIT  356

Query  373  sisvld-lsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
                L  L +++G+LESK   +R++K GGLY+NN RV  +  ++ E+ ++ G +L++  G
Sbjct  357  ENQFLLDLLINTGILESKGEGKRLIKNGGLYINNERVTEDTLRLNENYLLGGSLLVIRLG  416

Query  196  KKNKMVVRI  170
            KK+  +++ 
Sbjct  417  KKDYRLIQF  425



>ref|WP_021275481.1| tyrosyl-tRNA synthetase [Bacteriovorax sp. Seq25_V]
 gb|EQC43871.1| tyrosine--tRNA ligase [Bacteriovorax sp. Seq25_V]
Length=423

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 70/128 (55%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA EV + VHG+EGL  AL+AT        +   D K I  I  DVPS +L  D + 
Sbjct  296  QKTLASEVVKLVHGEEGLASALRATSFFFGEKIENVTD-KEISSIFEDVPSVTLSKDFLN  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
                L+    + L +SK  ARR ++Q G+ +NN +V +  KK+ +DD+     LL+  GK
Sbjct  355  EGEFLEALAQTPLFKSKGEARRSVEQNGISINNVKVTAVDKKLSKDDLASETALLVKKGK  414

Query  193  KNKMVVRI  170
            KN  V++ 
Sbjct  415  KNYCVIKF  422



>ref|XP_008605106.1| tyrosyl-tRNA synthetase [Saprolegnia diclina VS20]
 gb|EQC41392.1| tyrosyl-tRNA synthetase [Saprolegnia diclina VS20]
Length=429

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 78/131 (60%), Gaps = 3/131 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ +AE VT  +HG++ L++A +A + L  G+ D  +   T+  I  D P  +L   QV+
Sbjct  302  QQTVAEHVTTLIHGKDALEQAQRAAKVLFGGSCD-GISAATMLSI--DAPKTALAPAQVI  358

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               V+D+    G +++K   RR++K GGLY+NN RV+S+A   E    ++G+  L+  GK
Sbjct  359  GQKVVDVVGLLGAVKTKAEIRRLIKAGGLYINNVRVESDAAVFESHHAIEGQATLVRTGK  418

Query  193  KNKMVVRIS*P  161
            +N  +++I+ P
Sbjct  419  RNYHIIQITTP  429



>ref|WP_043455304.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans]
 gb|KIC64694.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans]
Length=437

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 75/132 (57%), Gaps = 5/132 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            QR+LA EVT  VHG E  ++ + A+ AL  GN D + LD  T++   S++PS ++  D++
Sbjct  310  QRKLAFEVTSLVHGVEATEKVIAASAALF-GNGDLSTLDKATLQAATSELPSTTVQVDEM  368

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + +L  S  S     K AARR + +GG Y+NN +V      I E +++ G+ LLL  G
Sbjct  369  GIVDLLVASGLSES---KSAARRTVGEGGAYVNNEKVSDPDAVISESELLHGQYLLLRRG  425

Query  196  KKNKMVVRIS*P  161
            KKN   V +  P
Sbjct  426  KKNLATVEVLVP  437



>ref|WP_008470064.1| tyrosyl-tRNA synthetase [Lactobacillus hominis]
 emb|CCI81347.1| Tyrosyl-tRNA synthetase [Lactobacillus hominis DSM 23910 = CRBIP 
24.179]
Length=420

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 70/128 (55%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVT+FVHGQEGLDEA   TEAL  GN    L    IE    + PS         
Sbjct  296  QRRLAEEVTKFVHGQEGLDEAQFITEALFKGNV-KDLSVAQIEQGFKNAPSTEAT---KE  351

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + +++D  V + +  SK  AR  +K G +Y+N  R +     IE D   DGK +++  GK
Sbjct  352  AKNIVDFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDSAFDGKFVIIRKGK  411

Query  193  KNKMVVRI  170
            K   +VRI
Sbjct  412  KKYTLVRI  419



>ref|WP_041569078.1| tyrosyl-tRNA synthetase [Candidatus Chloracidobacterium thermophilum]
Length=425

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 71/130 (55%), Gaps = 2/130 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLP--FDQ  380
            QR LA  VT FVHG  GL  AL AT  L  G+  T +D  T+  +  D PS  +P     
Sbjct  292  QRSLAAAVTEFVHGAAGLRTALAATNILFGGDPITDIDADTLLAVFHDAPSTEVPAALFA  351

Query  379  vlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  200
                   DL+V++ L+ SK  ARR+++ GGLY NN RV+S   +I  + ++ G+  +L  
Sbjct  352  DDGALPSDLAVAARLVSSKSEARRLIEGGGLYFNNQRVESVHARITRERLIGGQYGVLRK  411

Query  199  GKKNKMVVRI  170
            G +   ++R+
Sbjct  412  GARTYHLLRV  421



>gb|AEP11643.1| tyrosyl-tRNA synthetase [Candidatus Chloracidobacterium thermophilum 
B]
Length=426

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 71/130 (55%), Gaps = 2/130 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLP--FDQ  380
            QR LA  VT FVHG  GL  AL AT  L  G+  T +D  T+  +  D PS  +P     
Sbjct  293  QRSLAAAVTEFVHGAAGLRTALAATNILFGGDPITDIDADTLLAVFHDAPSTEVPAALFA  352

Query  379  vlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  200
                   DL+V++ L+ SK  ARR+++ GGLY NN RV+S   +I  + ++ G+  +L  
Sbjct  353  DDGALPSDLAVAARLVSSKSEARRLIEGGGLYFNNQRVESVHARITRERLIGGQYGVLRK  412

Query  199  GKKNKMVVRI  170
            G +   ++R+
Sbjct  413  GARTYHLLRV  422



>ref|WP_028912082.1| tyrosyl-tRNA synthetase [Prevotella sp. MA2016]
Length=431

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 74/131 (56%), Gaps = 3/131 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFD  383
            Q+RLAEEVT  VH QE LD A++A+  L   +      KLD +T+  +   VP   +  D
Sbjct  300  QKRLAEEVTVMVHSQEALDTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKD  359

Query  382  QvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  203
            Q+   ++  L+  + +  SK   R+M++ GG+ LN  ++  + + I  DD++DGK LL  
Sbjct  360  QLGQPAIELLTTVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITADDLIDGKYLLAQ  419

Query  202  AGKKNKMVVRI  170
             GKKN  ++ +
Sbjct  420  KGKKNYYLLIV  430



>ref|WP_021949404.1| tyrosyl-tRNA synthetase [Prevotella sp. CAG:1124]
 emb|CCY65731.1| tyrosine--tRNA ligase [Prevotella sp. CAG:1124]
Length=486

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 76/131 (58%), Gaps = 3/131 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD---TKLDWKTIEGIASDVPSCSLPFD  383
            QRRLAEEVT  VH +E LD A++A+  L   +      KLD +T+  I   VP   +  D
Sbjct  354  QRRLAEEVTVMVHSREALDAAIEASNILFGKSTKESLLKLDEQTLLDIFEGVPQYEIGRD  413

Query  382  QvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  203
            Q+   +V   + ++ +  SK   R++++ GG+ LN  ++ +  ++I  DD++DGK LL+ 
Sbjct  414  QLGQPAVEIFTQAAAVFASKGEMRKLVQGGGVSLNKEKLTAFDRQITADDLIDGKYLLVQ  473

Query  202  AGKKNKMVVRI  170
             GKKN  +V +
Sbjct  474  RGKKNYYLVIV  484



>ref|WP_039240672.1| tyrosyl-tRNA synthetase [Arthrobacter sp. MWB30]
 gb|KIA73795.1| tyrosyl-tRNA synthetase TyrS [Arthrobacter sp. MWB30]
Length=436

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 81/130 (62%), Gaps = 5/130 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            Q++LA EVT  VHG +  ++ + A+ AL  GN D T LD +T+E   +++PS ++  D  
Sbjct  310  QKKLAYEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATINAD--  366

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + ++DL V+SGL ESK AARR + +GG Y+NN +V      I  D+++ G+ LLL  G
Sbjct  367  -GLGIIDLLVASGLSESKSAARRTVGEGGAYVNNTKVSDPDAVIAPDELLHGRYLLLRRG  425

Query  196  KKNKMVVRIS  167
            KKN   + +S
Sbjct  426  KKNLATIEVS  435



>ref|WP_037233127.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
 gb|KGI99536.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
 gb|KGJ35093.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
Length=434

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 71/128 (55%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLA EVT  VHG E   +A+ A+EAL        LD  T++ + S++PS  L  DQ  
Sbjct  309  QKRLAYEVTALVHGVEATHQAIAASEALFGKGDFAALDESTLQAVMSELPSVELSSDQ--  366

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             + ++ +    G   SK  ARR+LK+GG  +N A+V  E   I  + ++ GK  ++  GK
Sbjct  367  -LDLITVLTELGFASSKSEARRILKEGGASVNGAKVQGEDAVITPEQLLHGKYAIVRRGK  425

Query  193  KNKMVVRI  170
            KN+  + +
Sbjct  426  KNQGAITV  433



>ref|WP_024366580.1| tyrosyl-tRNA synthetase [Arthrobacter sp. TB 26]
Length=437

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 79/130 (61%), Gaps = 5/130 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            QR+LA EVT  VHG +  ++ + A+ AL  GN D T LD  T++   S++PS S+     
Sbjct  310  QRKLAYEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDEATLKAATSELPSASV---DA  365

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + ++DL V++GL ESK AARR + +GG Y+NNA+V      IE   ++ G+ LLL  G
Sbjct  366  AGLGIIDLLVATGLSESKSAARRTVGEGGAYVNNAKVSDPDALIERGQLLHGRYLLLRRG  425

Query  196  KKNKMVVRIS  167
            KKN   V +S
Sbjct  426  KKNLATVEVS  435



>gb|KDQ21806.1| hypothetical protein BOTBODRAFT_99200 [Botryobasidium botryosum 
FD-172 SS1]
Length=473

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 72/128 (56%), Gaps = 0/128 (0%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LA EVT  VHG+EG+ +A   T AL   +         I+ + +D     +P  +VL
Sbjct  344  QRMLASEVTELVHGEEGVKQAEATTRALFDTDPSNVRASDVIKALQNDPRLVLVPAAEVL  403

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               +  LS +     S+  AR++L  GGLYLNN+R+    K +++ D++DG++ +L AGK
Sbjct  404  DEPLTKLSSNFKQTRSRSEARKLLLAGGLYLNNSRIQDVNKVLQQSDLIDGRLAILRAGK  463

Query  193  KNKMVVRI  170
             N +++ +
Sbjct  464  DNHLIIAL  471



>ref|WP_024963599.1| tyrosyl-tRNA synthetase [Trueperella pyogenes]
Length=418

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 69/128 (54%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LAEEVT +VHG E  + A +A+  L        LD +T+    +++PS     +  +
Sbjct  295  QRVLAEEVTTWVHGAEATERAKRASLVLFGKAEPAGLDEQTLRDATAELPSGKASMNDAV  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++ L +  G      AARR +  GGLY+NN ++D   + IEE D++ G ++LL  GK
Sbjct  355  VDVLVSLGLEKGAG----AARRTIAGGGLYINNVKIDDPERVIEEGDVLPGSIVLLRKGK  410

Query  193  KNKMVVRI  170
            KN   + I
Sbjct  411  KNMTAIHI  418



>ref|WP_006889016.1| tyrosyl-tRNA synthetase [Rothia aeria]
 gb|EID50266.1| tyrosine--tRNA ligase [Rothia aeria F0474]
Length=434

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 71/128 (55%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLA EVT  VHG E   +A+ A+EAL        LD  T++ + S++PS  L  DQ  
Sbjct  309  QKRLAYEVTALVHGVEATHQAIAASEALFGKGDFAALDESTLQTVMSELPSVELSSDQ--  366

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             + ++ +    G   SK  ARR+LK+GG  +N A+V  E   I  + ++ GK  ++  GK
Sbjct  367  -LDLITVLTELGFASSKSEARRILKEGGASVNGAKVQGEDAVITAEQLLHGKYAIVRRGK  425

Query  193  KNKMVVRI  170
            KN+  + +
Sbjct  426  KNQGAITV  433



>gb|ERT67692.1| tyrosine--tRNA ligase [Rothia aeria F0184]
Length=439

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 71/128 (55%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLA EVT  VHG E   +A+ A+EAL        LD  T++ + S++PS  L  DQ  
Sbjct  314  QKRLAYEVTALVHGVEATHQAIAASEALFGKGDFAALDESTLQTVMSELPSVELSSDQ--  371

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             + ++ +    G   SK  ARR+LK+GG  +N A+V  E   I  + ++ GK  ++  GK
Sbjct  372  -LDLITVLTELGFASSKSEARRILKEGGASVNGAKVQGEDAVITAEQLLHGKYAIVRRGK  430

Query  193  KNKMVVRI  170
            KN+  + +
Sbjct  431  KNQGAITV  438



>emb|CCQ46715.1| tyrosyl-tRNA synthetase [Arthrobacter siccitolerans]
Length=437

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 82/132 (62%), Gaps = 5/132 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            QR+LA EVT  VHG E  ++ + A+ AL  GN D + LD +T++   S++PS ++  D  
Sbjct  310  QRKLAFEVTALVHGVEATEKVIAASAALF-GNGDLSALDKQTLQAATSELPSTTVQVD--  366

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
             ++ ++DL V+SGL +SK AARR + +GG Y+NN +V      I E +++ G+ LLL  G
Sbjct  367  -ALGIVDLLVASGLSDSKSAARRTVGEGGAYVNNEKVLDPEAVISESELLHGQYLLLRRG  425

Query  196  KKNKMVVRIS*P  161
            KKN   V +  P
Sbjct  426  KKNLATVEVLVP  437



>ref|WP_024332044.1| tyrosyl-tRNA synthetase [Actinomyces neuii]
Length=420

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 5/126 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQv  377
            Q+ LAE VTR VHG +  D+ L ATEAL  G  D K +D KT+      +P+      +V
Sbjct  295  QKALAESVTRLVHGDQATDQVLAATEALW-GKGDLKAIDEKTLASATESLPATHF---EV  350

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
             + SV+DL V +GL   K AARR +K GG YLNN +V+ E + I   D++ G  +L+  G
Sbjct  351  GTSSVVDLLVGTGLERGKGAARRTIKSGGAYLNNVKVEDEDRVISTSDLLSGGKVLIRKG  410

Query  196  KKNKMV  179
            K+N  V
Sbjct  411  KRNLAV  416



>ref|WP_025295943.1| tyrosyl-tRNA synthetase [Trueperella pyogenes]
 gb|AHU89057.1| tyrosyl-tRNA synthetase [Trueperella pyogenes]
 gb|AJC69525.1| tyrosyl-tRNA synthetase [Trueperella pyogenes TP8]
Length=418

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 69/128 (54%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LAEEVT +VHG E  + A +A+  L        LD +T+    +++PS     +  +
Sbjct  295  QRVLAEEVTTWVHGAEATERAKRASLVLFGKAEPAGLDEQTLRDATAELPSGKASVNDAV  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++ L +  G      AARR +  GGLY+NN ++D   + IEE D++ G ++LL  GK
Sbjct  355  VDVLVSLGLEKGAG----AARRTIAGGGLYINNVKIDDPERVIEEGDVLPGSIVLLRKGK  410

Query  193  KNKMVVRI  170
            KN   + I
Sbjct  411  KNMTAIHI  418



>ref|WP_010528768.1| tyrosyl-tRNA synthetase [Thermophagus xiamenensis]
Length=430

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 77/133 (58%), Gaps = 5/133 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGN-ADT--KLDWKTIEGIASDVPSCSLPFD  383
            Q+RLAEEVT+ VHGQ+ L  A+ A++ L   N  DT  KLD +T+  +   VP+ ++   
Sbjct  297  QKRLAEEVTQLVHGQDALQMAVDASQILFGKNVTDTLRKLDERTLLSVFEGVPTFNISRK  356

Query  382  --QvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLL  209
              +     +  ++  + +  SK  ARR LK GGL +N  +V SE KK+   D+++ K LL
Sbjct  357  NLEQGIGVIDLVAGETPIFPSKGEARRTLKGGGLGINKEKVQSEDKKVNSSDLLNDKYLL  416

Query  208  LSAGKKNKMVVRI  170
            +  GKKN  +V +
Sbjct  417  VQKGKKNYYLVIV  429



>ref|WP_034510938.1| tyrosyl-tRNA synthetase [Actinomyces sp. S4-C9]
 gb|KGE99688.1| tyrosyl-tRNA synthetase [Actinomyces sp. S4-C9]
Length=421

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 77/128 (60%), Gaps = 5/128 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA EVT+ VHG+E L   L+AT+AL       K+D  T+    S++P+  + F +  
Sbjct  295  QKALAAEVTKLVHGEETLQRVLEATDALWGSGDLKKVDAATLSAATSELPAGEVAFGE--  352

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIE-EDDIVDGKVLLLSAG  197
              +++D  V++GL + K AAR  +  GG YLNN RV+SE + I  ED + DG V L+  G
Sbjct  353  -ATIVDALVAAGLEKGKRAARTTVSSGGAYLNNERVESEDQIISAEDALADGTV-LIRKG  410

Query  196  KKNKMVVR  173
            ++N  VVR
Sbjct  411  RRNLAVVR  418



>ref|WP_042457579.1| tyrosyl-tRNA synthetase [Streptacidiphilus jiangxiensis]
Length=421

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 77/128 (60%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LAEE+T  VHGQE LD A+ A++AL       +LD +T+    +++PS  +      
Sbjct  295  QRALAEELTVLVHGQEQLDRAVAASKALFGQGELGELDERTLAAAVAELPSAQV----GE  350

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL V++GL  S+ AARR + +GG Y+NNA+++ EA      D++ G+ L+L  GK
Sbjct  351  LGEIVDLFVATGLSASRSAARRTVNEGGAYVNNAKIEDEAALATPADLLHGRWLVLRRGK  410

Query  193  KNKMVVRI  170
            +N   V +
Sbjct  411  RNLAAVEL  418



>ref|WP_037604940.1| tyrosyl-tRNA synthetase [Streptacidiphilus rugosus]
Length=420

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 77/129 (60%), Gaps = 4/129 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LAEE+T  VHGQE LD A+ A++AL       +LD +T+    +++PS  +      
Sbjct  295  QRALAEELTVMVHGQEQLDRAIAASKALFGQGELAELDERTLAAAVAELPSAKV----TE  350

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL V++GL  S+ AARR + +GG Y+NN +V+ EA      D++ G+ L+L  GK
Sbjct  351  LGEIVDLFVATGLSASRSAARRTVGEGGAYVNNTKVEDEAALATPADLLHGRWLVLRRGK  410

Query  193  KNKMVVRIS  167
            +N   V ++
Sbjct  411  RNLAAVELT  419



>ref|WP_017197962.1| tyrosyl-tRNA synthetase [Arthrobacter sp. M2012083]
Length=436

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 81/130 (62%), Gaps = 5/130 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            Q++LA EVT  VHG +  ++ + A+ AL  GN D T LD +T+E   +++PS ++  D  
Sbjct  310  QKKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATVGAD--  366

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + ++DL V+SGL +SK AARR + +GG Y+NN +V      I  D+++ G+ LLL  G
Sbjct  367  -GLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPDAVIARDELLHGRYLLLRRG  425

Query  196  KKNKMVVRIS  167
            KKN   + +S
Sbjct  426  KKNLATIEVS  435



>ref|XP_008868076.1| tyrosine-tRNA ligase [Aphanomyces invadans]
 gb|ETW03847.1| tyrosine-tRNA ligase [Aphanomyces invadans]
Length=434

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 71/130 (55%), Gaps = 5/130 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGI-ASDVPSCSLPFDQv  377
            Q+ LAE  T+ +HG + L  A  A   L  G+    LD  T   I A D P   L + ++
Sbjct  307  QQILAEHATKMIHGSDALKAAQVAANVLFGGS----LDGVTASDILAIDAPRSGLRWSEL  362

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
                 +D+  + G + SK   RR++K GG+Y+NN RVDS+A  I+   IV G+ +L+  G
Sbjct  363  QGKRAVDVLATIGAIPSKAEGRRLIKAGGVYVNNVRVDSDAAVIDASQIVQGRAVLVRVG  422

Query  196  KKNKMVVRIS  167
            K+N  V+ ++
Sbjct  423  KRNYHVIHVT  432



>ref|WP_018779124.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 161MFSha2.1]
Length=436

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 81/130 (62%), Gaps = 5/130 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            Q++LA EVT  VHG +  ++ + A+ AL  GN D T LD +T+E   +++PS ++  D  
Sbjct  310  QKKLAYEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATINAD--  366

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + ++DL V+SGL ESK AARR + +GG Y+NN +V      I  D+++ G+ LLL  G
Sbjct  367  -GLGIIDLLVASGLSESKSAARRTVGEGGAYVNNTKVSDPDAVIARDELLHGRYLLLRRG  425

Query  196  KKNKMVVRIS  167
            KKN   + ++
Sbjct  426  KKNLATIEVA  435



>ref|WP_007000220.1| tyrosyl-tRNA synthetase [Actinobaculum massiliense]
 gb|EKU95914.1| tyrosine-tRNA ligase [Actinobaculum massiliae ACS-171-V-Col2]
Length=424

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LA +VT +VHG E  +    A+ AL  G    +LD  T+    +++PS      Q +
Sbjct  295  QRTLARDVTTWVHGAEATERVEAASRALFGGEELFELDVATLRDAVAELPSTGAEVGQPV  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
                +      G+     AARR +  GGLY+NN +VD +A  +  + I+DG ++LL  GK
Sbjct  355  VELFVGTGQERGIG----AARRTVASGGLYINNQKVDDDAAVLSAEQILDGGLVLLRKGK  410

Query  193  KNKMVVRI  170
            KN  V R+
Sbjct  411  KNLAVARV  418



>ref|WP_016445042.1| tyrosyl-tRNA synthetase [Actinomyces europaeus]
 gb|EPD29409.1| tyrosine-tRNA ligase [Actinomyces europaeus ACS-120-V-Col10b]
Length=421

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 77/128 (60%), Gaps = 5/128 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA EVT+ VHG+E L   L+AT+AL  G    K+D  T+    +++PS  + F +  
Sbjct  295  QKTLAAEVTKLVHGEETLQRVLEATDALWGGGDLKKIDPATLSAATAELPSGKIVFGE--  352

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIE-EDDIVDGKVLLLSAG  197
              +++D  V++GL + K AAR  +  GG YLNN RV++E   I  ED + DG V L+  G
Sbjct  353  -ATIVDALVAAGLEKGKRAARTTVASGGAYLNNERVENEDLIISGEDALADGTV-LIRKG  410

Query  196  KKNKMVVR  173
            ++N  VVR
Sbjct  411  RRNLAVVR  418



>ref|WP_017176881.1| tyrosyl-tRNA synthetase [Actinomyces timonensis]
Length=420

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 67/127 (53%), Gaps = 3/127 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LA EVTR+VHG+  L +A  AT AL      T +D  T+    +D+PS  L   +  
Sbjct  295  QRALAREVTRWVHGEAALAQAEVATAALWGRGDLTGIDEATMAAATADLPSAELVVGEST  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             + +L  +        + AARR +  GG YLNNA+V  E   + E D++ G V+L+  G+
Sbjct  355  IVDLLVGAGLEKG---RGAARRTIAAGGAYLNNAKVTDEEAVVTESDLLAGGVVLVRKGR  411

Query  193  KNKMVVR  173
            +   V R
Sbjct  412  RTLSVAR  418



>ref|WP_016998371.1| tyrosyl-tRNA synthetase [Kocuria atrinae]
Length=434

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 72/128 (56%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA EV   VHG+E   +A+ A+ A+        LD +T+  IA+++P   +  DQ  
Sbjct  309  QKALAYEVNTLVHGEEATRKAIAASAAVFGKGQFADLDEETLAMIAAELPHAEVGADQTS  368

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             + +L  +  S     K AARR+LK+GG+ +NN +V  E   +E +D++ G+ +LL  GK
Sbjct  369  IVDLLVATGLSES---KSAARRILKEGGVSVNNHKVSGEDATLEPEDLLHGRFVLLRRGK  425

Query  193  KNKMVVRI  170
            KN   V +
Sbjct  426  KNLAAVTV  433



>ref|WP_013132266.1| tyrosyl-tRNA synthetase [Thermobispora bispora]
 gb|ADG88733.1| tyrosyl-tRNA synthetase [Thermobispora bispora DSM 43833]
Length=421

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 73/122 (60%), Gaps = 3/122 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LAE+VT  VHG+E L+  + A+ AL       +LD +T+E   ++VP   +P    L
Sbjct  296  QRALAEDVTALVHGREELERVVAASRALFGHGTLQELDERTLEAALNEVPKAKVP---AL  352

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
                +DL  +SG++ESK AARR +++GG YLNN +V  E      DD++ G+ L+L  GK
Sbjct  353  GAPYVDLLAASGIVESKSAARRAVREGGAYLNNVKVTDEDYVPTADDLLHGRFLVLRRGK  412

Query  193  KN  188
            K 
Sbjct  413  KT  414



>ref|WP_018771549.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 162MFSha1.1]
Length=437

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 79/132 (60%), Gaps = 5/132 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            QR+LA EVT  VHG +  ++ + A+ AL  GN D   LD  T++   S++PS ++  D  
Sbjct  310  QRKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLAALDKATLQAATSELPSATVQVD--  366

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + ++DL V+SGL ESK AARR + +GG Y+NN +V      I E +++ G+ LLL  G
Sbjct  367  -GMGIVDLLVASGLSESKSAARRTVGEGGAYVNNEKVSDPEAVISESELLHGQYLLLRRG  425

Query  196  KKNKMVVRIS*P  161
            KKN   V +  P
Sbjct  426  KKNLATVEVLVP  437



>ref|WP_006823030.1| tyrosyl-tRNA synthetase [Corynebacterium casei]
 emb|CCE55574.1| tyrosine--tRNA ligase [Corynebacterium casei UCMA 3821]
 gb|AHI20118.1| tyrosyl-tRNA ligase [Corynebacterium casei LMG S-19264]
Length=421

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 70/127 (55%), Gaps = 2/127 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLA+E+T  VHG++       A +AL      T+LD KT+EG  S+     L  ++  
Sbjct  293  QRRLAQEMTNLVHGEDATKAVELAAQALFGRAELTELDEKTLEGALSETNVAELGAEESF  352

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +I  L ++        K AARR +K+GG Y+NN R++SE     ED+ + G  L++  GK
Sbjct  353  NIVDLLVASGLADS--KGAARRTIKEGGAYVNNERIESEDWAPSEDNFLHGAWLVMRRGK  410

Query  193  KNKMVVR  173
            KN   +R
Sbjct  411  KNFAAIR  417



>ref|WP_028931561.1| tyrosyl-tRNA synthetase [Pseudonocardia asaccharolytica]
Length=426

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 74/129 (57%), Gaps = 2/129 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEE+T  VHG+    + + A++AL       +LD  T++   ++VP+ ++   +  
Sbjct  298  QRRLAEELTTLVHGEHQTRQVVAASQALFGRGELAELDAATLDAAMAEVPTATVRIGERP  357

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +I  L +         + AARR +K+GG Y+NNA+V  EA    E D++ G+ L++  GK
Sbjct  358  TIVDLLVETGLTDS--RGAARRTVKEGGAYVNNAKVADEAWLPGEADLLHGRWLVVRRGK  415

Query  193  KNKMVVRIS  167
            +N   VR++
Sbjct  416  RNMAGVRVA  424



>gb|AAP58586.1| putative tyrosyl-tRNA synthetase [uncultured Acidobacteria bacterium]
Length=422

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 71/129 (55%), Gaps = 2/129 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LA EVTR VHG + + +A  A+E L  G+  T++    +  + ++VPS ++ F    
Sbjct  294  QRELAREVTRLVHGSQAVLDAEAASEKLFRGDV-TQMSVDELLQVFANVPSSTVAFSDDG  352

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
                  ++        K  A+R+++ GGLY+N  R+  E  ++  +D + G+V ++  GK
Sbjct  353  WALADLVTSVGVTKS-KGEAQRLVRAGGLYVNERRIGEEKARLTAEDAIGGQVFVIRKGK  411

Query  193  KNKMVVRIS  167
            K+  +VRIS
Sbjct  412  KDNFLVRIS  420



>ref|WP_021267070.1| tyrosyl-tRNA synthetase [Bacteriovorax sp. BAL6_X]
 gb|EPZ51444.1| tyrosine--tRNA ligase [Bacteriovorax sp. BAL6_X]
Length=421

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 72/128 (56%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEE+   VHG+EG+D ALKAT+       +   D + + GI  DVPS  L   Q+ 
Sbjct  294  QKRLAEEIVTLVHGKEGIDAALKATDFFFGKVIENTTDAE-LAGIFDDVPSVELEKSQLG  352

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             I+ LD+  S+ L +SK  AR+M+ Q G+ +NN +  +    I   D+     L+L  GK
Sbjct  353  EINYLDMLASTPLFKSKGEARKMVSQNGVAINNIKNANVEHIITTSDLASESCLILRKGK  412

Query  193  KNKMVVRI  170
            KN  VV+ 
Sbjct  413  KNYCVVKF  420



>ref|WP_003798662.1| tyrosyl-tRNA synthetase [Arthrobacter globiformis]
 dbj|GAB12490.1| tyrosyl-tRNA synthetase [Arthrobacter globiformis NBRC 12137]
Length=437

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 80/130 (62%), Gaps = 5/130 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            QR+LA EVT  VHG E  ++ + A+ A+  GN D + LD +T+    +++PS S+     
Sbjct  310  QRKLAYEVTALVHGAEATEKVIAASAAVF-GNGDLSVLDEQTLAAATAELPSASV---DG  365

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + ++DL V+SGL +SK AARR++ +GG Y+NNA+V      I    ++ GK LLL  G
Sbjct  366  TGLGIIDLLVASGLSDSKSAARRVVGEGGAYVNNAKVTDPDAVIPPSQLLHGKYLLLRRG  425

Query  196  KKNKMVVRIS  167
            KKN   V++S
Sbjct  426  KKNLATVQVS  435



>ref|WP_036788433.1| tyrosyl-tRNA synthetase [Porphyromonas canoris]
 gb|KGL51208.1| tyrosyl-tRNA synthetase [Porphyromonas canoris]
 gb|KGN93641.1| tyrosyl-tRNA synthetase [Porphyromonas canoris]
Length=431

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 76/136 (56%), Gaps = 8/136 (6%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPF  386
            Q+RLAEEVT  VH +E  + A++A+ A+  GNA     TKLD  T+  +   VPS +LP 
Sbjct  297  QKRLAEEVTCMVHSREAYESAVEAS-AILFGNATREALTKLDEDTLLALFEGVPSATLPM  355

Query  385  DQvl---sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKV  215
            D++       +  L+    +  S+   R++LK GG+ +N  +V+SE   +   D++ GK 
Sbjct  356  DKINGEGINILDLLADEVAMFPSRGELRKLLKSGGVSINKEKVESEGMVLTSSDLLAGKY  415

Query  214  LLLSAGKKNKMVVRIS  167
            +L   GKKN  ++  +
Sbjct  416  ILAQKGKKNYFLITFA  431



>ref|WP_037274388.1| tyrosyl-tRNA synthetase [Rhodococcus rhodnii]
Length=424

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 73/130 (56%), Gaps = 4/130 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPF-DQv  377
            Q+RLAEE T  VHG++   + + A++AL  G    +LD  T++   ++VP+  +   DQ 
Sbjct  297  QKRLAEEFTNLVHGEKETQQVIAASQALFGGGELRELDAGTLDAAMAEVPTGDVRLADQP  356

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + VL  S          AARR + +GG Y+NN R+ ++  +   DD++ GK L++  G
Sbjct  357  TIVEVLVASGLVAGNG---AARRTVSEGGAYVNNTRIGADDWRPTADDLLHGKWLVVRKG  413

Query  196  KKNKMVVRIS  167
            K+N   VR+S
Sbjct  414  KRNTAGVRVS  423



>ref|WP_036865421.1| tyrosyl-tRNA synthetase [Porphyromonas sp. COT-108 OH2963]
 gb|KGN94389.1| tyrosyl-tRNA synthetase [Porphyromonas sp. COT-108 OH2963]
Length=431

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 76/136 (56%), Gaps = 8/136 (6%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPF  386
            Q+RLAEEVT  VH +E  + A++A+ A+  GNA     TKLD  T+  +   VPS +LP 
Sbjct  297  QKRLAEEVTCMVHSREAYESAVEAS-AILFGNATREALTKLDEDTLLALFEGVPSATLPM  355

Query  385  DQvl---sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKV  215
            D++       +  L+    +  S+   R++LK GG+ +N  +V+SE   +   D++ GK 
Sbjct  356  DKINGEGINILDLLADEVAMFPSRGELRKLLKSGGVSINKEKVESEGMVLTSSDLLAGKY  415

Query  214  LLLSAGKKNKMVVRIS  167
            +L   GKKN  ++  +
Sbjct  416  ILAQKGKKNYFLITFA  431



>ref|WP_036847792.1| tyrosyl-tRNA synthetase [Porphyromonas sp. COT-108 OH1349]
 gb|KGN68587.1| tyrosyl-tRNA synthetase [Porphyromonas sp. COT-108 OH1349]
Length=431

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 76/136 (56%), Gaps = 8/136 (6%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPF  386
            Q+RLAEEVT  VH +E  + A++A+ A+  GNA     TKLD  T+  +   VPS +LP 
Sbjct  297  QKRLAEEVTCMVHSREAYESAVEAS-AILFGNATREALTKLDEDTLLALFEGVPSATLPM  355

Query  385  DQvl---sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKV  215
            D++       +  L+    +  S+   R++LK GG+ +N  +V+SE   +   D++ GK 
Sbjct  356  DKINGEGINILDLLADEVAMFPSRGELRKLLKSGGVSINKEKVESEGMVLTSSDLLAGKY  415

Query  214  LLLSAGKKNKMVVRIS  167
            +L   GKKN  ++  +
Sbjct  416  ILAQKGKKNYFLITFA  431



>ref|WP_036910525.1| tyrosyl-tRNA synthetase [Prevotella sp. FD3004]
Length=431

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 74/131 (56%), Gaps = 3/131 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFD  383
            Q+RLAEEVT  VH QE L+ A++A+  L   +      KLD +T   +   VP   +  D
Sbjct  300  QKRLAEEVTVMVHSQEALNTAIEASNILFGKSTKESLEKLDEQTFLDVFDGVPQFEICKD  359

Query  382  QvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  203
            Q+   ++  L+ ++ +  SK   R+M++ GG+ LN  ++  + + I  DD++DGK LL  
Sbjct  360  QLGQPAIELLTTAAPVFPSKGEMRKMVQGGGVSLNKEKITDQNQAITADDLIDGKYLLAQ  419

Query  202  AGKKNKMVVRI  170
             GKKN  ++ +
Sbjct  420  KGKKNYYLLIV  430



>ref|WP_015936720.1| tyrosyl-tRNA synthetase [Arthrobacter chlorophenolicus]
 gb|ACL39499.1| tyrosyl-tRNA synthetase [Arthrobacter chlorophenolicus A6]
Length=437

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 81/132 (61%), Gaps = 5/132 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADT-KLDWKTIEGIASDVPSCSLPFDQv  377
            QR+LA EVT  VHG E  ++ + A+ AL  GN D   LD +T++   S++P+ ++  D  
Sbjct  310  QRKLAFEVTSLVHGVEATEKVIAASAALF-GNGDLGALDKQTLQAATSELPTATVQVD--  366

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
             ++ ++DL V+SGL ESK AARR + +GG Y+NN +V      I E +++ G+ LLL  G
Sbjct  367  -ALGIVDLLVASGLSESKSAARRTVGEGGAYVNNEKVLDPETVIAESELLHGQYLLLRRG  425

Query  196  KKNKMVVRIS*P  161
            KKN   V +  P
Sbjct  426  KKNLATVEVLVP  437



>ref|WP_042380116.1| tyrosyl-tRNA synthetase [Streptacidiphilus melanogenes]
Length=420

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 76/128 (59%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LAEE+T  VHGQ+ LD A+ A++AL      ++LD  T+    +++PS  +      
Sbjct  295  QRALAEELTVLVHGQDQLDRAVAASKALFGQGDLSELDAPTLAAAVAELPSAQV----GE  350

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL V++GL  S+ AARR + +GG Y+NN +V+ EA      D++ G+ L+L  GK
Sbjct  351  LGELVDLFVATGLSASRSAARRTINEGGAYVNNTKVEDEAATAAPADLLHGRWLVLRRGK  410

Query  193  KNKMVVRI  170
            +N   V +
Sbjct  411  RNLAAVEL  418



>ref|WP_041818421.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii]
Length=420

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 71/128 (55%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   
Sbjct  296  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---  351

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK +++  GK
Sbjct  352  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGK  411

Query  193  KNKMVVRI  170
            +   +V+I
Sbjct  412  RKYTLVKI  419



>ref|WP_014921325.1| tyrosyl-tRNA synthetase [Arthrobacter sp. Rue61a]
 gb|AFR28470.1| tyrosyl-tRNA synthetase TyrS [Arthrobacter sp. Rue61a]
Length=436

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 81/130 (62%), Gaps = 5/130 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            Q++LA EVT  VHG +  ++ + A+ AL  GN D T LD +T+E   +++PS ++  D  
Sbjct  310  QKKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATIGAD--  366

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + ++DL V+SGL +SK AARR + +GG Y+NN +V      I  ++++ G+ LLL  G
Sbjct  367  -GLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPDAVIAREELLHGRYLLLRRG  425

Query  196  KKNKMVVRIS  167
            KKN   + +S
Sbjct  426  KKNLATIEVS  435



>ref|WP_028851238.1| tyrosyl-tRNA synthetase [Thermocrispum municipale]
Length=424

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 71/128 (55%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEE+T  VHG +   + + A++AL      + LD  T+E + ++VP+  +      
Sbjct  297  QRRLAEELTTLVHGADQTAQVVAASQALFGKGEFSALDEPTLESVMAEVPTGEVALSDEP  356

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +I  L ++        K AARR +++GG Y+NN ++  E  + E  D + GK L++  GK
Sbjct  357  TIVDLLVAAGLSES--KGAARRTVREGGAYVNNTKISDEEWRPEPADALHGKWLIVRRGK  414

Query  193  KNKMVVRI  170
            +N   VR+
Sbjct  415  RNVAGVRL  422



>gb|AHA96684.1| tyrosyl-tRNA synthase [Lactobacillus johnsonii N6.2]
Length=426

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 71/128 (55%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   
Sbjct  302  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---  357

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK +++  GK
Sbjct  358  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGK  417

Query  193  KNKMVVRI  170
            +   +V+I
Sbjct  418  RKYTLVKI  425



>ref|WP_028903046.1| MULTISPECIES: tyrosyl-tRNA synthetase [Prevotella]
Length=431

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 74/131 (56%), Gaps = 3/131 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFD  383
            Q+RLAEEVT  VH QE L+ A++A+  L   +      KLD +T+  +   VP   +  D
Sbjct  300  QKRLAEEVTVLVHSQEALNTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKD  359

Query  382  QvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  203
            Q+   ++  L+  + +  SK   R+M++ GG+ LN  ++  + + I  +D++DGK LL  
Sbjct  360  QLGQPAIELLTTVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITAEDLIDGKYLLAQ  419

Query  202  AGKKNKMVVRI  170
             GKKN  ++ +
Sbjct  420  KGKKNYYLLIV  430



>ref|WP_013559196.1| tyrosyl-tRNA synthetase [Anaerolinea thermophila]
 dbj|BAJ62803.1| tyrosyl-tRNA synthetase [Anaerolinea thermophila UNI-1]
Length=426

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 76/130 (58%), Gaps = 3/130 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
             R LA  +T+ +HG+  L  A +A++AL  G  +T L    I  I S+VPSC +P  Q+ 
Sbjct  296  HRALARAMTQMIHGETALARAEQASQALFGGELET-LTAAEIADIFSEVPSCEVPRHQLE  354

Query  373  sisvldl--svssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  200
                  +   V++G+ +SK  ARR +++GG+Y+NN RV+   + +   D + G+ ++L  
Sbjct  355  GEGYPLVDLLVTAGVAKSKGEARRNIQEGGIYVNNRRVEDLNRAVHLQDALQGQFVVLRK  414

Query  199  GKKNKMVVRI  170
            G+KN  +VR+
Sbjct  415  GRKNYTLVRL  424



>ref|WP_026541624.1| tyrosyl-tRNA synthetase [Arthrobacter nicotinovorans]
Length=436

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 80/130 (62%), Gaps = 5/130 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQv  377
            Q++LA EVT  VHG +  ++ + A+ AL  GN D   LD +T+E   +++PS ++  D  
Sbjct  310  QKKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLGVLDEQTLEAATAELPSATVAAD--  366

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + ++DL V+SGL +SK AARR + +GG Y+NN +V      I +D ++ G+ LLL  G
Sbjct  367  -GLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPEAVIGQDQLLHGRYLLLRRG  425

Query  196  KKNKMVVRIS  167
            KKN   + +S
Sbjct  426  KKNLATIEVS  435



>ref|WP_018763582.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 135MFCol5.1]
Length=437

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 79/132 (60%), Gaps = 5/132 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            QR+LA EVT  VHG +  ++ + A+ AL  GN D   LD  T++   S++P+ ++  D  
Sbjct  310  QRKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLAALDKATLQAATSELPTTTVQVD--  366

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + ++DL V+SGL ESK AARR + +GG Y+NN +V      I E +++ G+ LLL  G
Sbjct  367  -GMGIVDLLVASGLSESKSAARRTVGEGGAYVNNEKVSDPEAVISESELLHGQYLLLRRG  425

Query  196  KKNKMVVRIS*P  161
            KKN   V +  P
Sbjct  426  KKNLATVEVLVP  437



>ref|WP_026547366.1| tyrosyl-tRNA synthetase [Arthrobacter nicotinovorans]
Length=436

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 80/130 (62%), Gaps = 5/130 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQv  377
            Q++LA EVT  VHG +  ++ + A+ AL  GN D   LD +T+E   +++PS ++  D  
Sbjct  310  QKKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLGVLDEQTLEAATAELPSATVAAD--  366

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + ++DL V+SGL +SK AARR + +GG Y+NN +V      I +D ++ G+ LLL  G
Sbjct  367  -GLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPEAVIGQDQLLHGRYLLLRRG  425

Query  196  KKNKMVVRIS  167
            KKN   + +S
Sbjct  426  KKNLATIEVS  435



>ref|WP_013064850.1| tyrosyl-tRNA synthetase [Prevotella ruminicola]
 gb|ADE82864.1| tyrosine--tRNA ligase [Prevotella ruminicola 23]
Length=431

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 74/131 (56%), Gaps = 3/131 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFD  383
            Q+RLAEEVT  VH +E LD A++A+  L   +      KLD +T+  +   VP   +  D
Sbjct  300  QKRLAEEVTVLVHSKEALDTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKD  359

Query  382  QvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  203
            Q+   ++  L+  + +  SK   R+M++ GG+ LN  ++  + + I  +D++DGK LL  
Sbjct  360  QLGQPAIELLTTVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITAEDLIDGKYLLAQ  419

Query  202  AGKKNKMVVRI  170
             GKKN  ++ +
Sbjct  420  KGKKNYYLLIV  430



>ref|WP_021277367.1| tyrosine--tRNA ligase domain protein, partial [Bacteriovorax 
sp. DB6_IX]
 gb|EQC51535.1| tyrosine--tRNA ligase domain protein, partial [Bacteriovorax 
sp. DB6_IX]
Length=183

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 71/131 (54%), Gaps = 3/131 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSL--PFDQ  380
            Q+ LAEEV + VHG+EGL+ AL+AT        +   D + +  I  DVP+ +L   F +
Sbjct  54   QKALAEEVVKLVHGEEGLEAALRATSFFFGQKIENVTDAQ-LSSIFEDVPAITLEKSFLE  112

Query  379  vlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  200
                  L++   +   +SK  ARR ++Q G+ +NN +V    KKI  +D+     L++  
Sbjct  113  GEGGDYLEMLAQTPFFKSKGEARRSVQQNGVAINNVKVADVEKKITSEDLASETSLIIKK  172

Query  199  GKKNKMVVRIS  167
            GKKN  VV+ +
Sbjct  173  GKKNYCVVKFN  183



>ref|WP_014243863.1| tyrosyl-tRNA synthetase [Bacteriovorax marinus]
 emb|CBW26079.1| putative tyrosyl-tRNA synthetase [Bacteriovorax marinus SJ]
Length=423

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 69/128 (54%), Gaps = 1/128 (1%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA+EVT+ VHGQEGLD AL+AT+       +   D   +  I  D PS  L  + + 
Sbjct  296  QKSLAQEVTKLVHGQEGLDAALRATQFFFGEKIENVSD-ADVASIFEDTPSVELSSEMLN  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               V+D+   + L +SK   RR + Q G+Y+NN  ++   + + + D+     L+L  GK
Sbjct  355  EGGVIDMLSETPLFKSKKEVRRAIDQKGIYINNVAIEGPTQTLSKADLASETALVLRKGK  414

Query  193  KNKMVVRI  170
            KN  VV+ 
Sbjct  415  KNYCVVKF  422



>ref|WP_033150736.1| tyrosyl-tRNA synthetase [Prevotella sp. RM4]
Length=431

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 74/131 (56%), Gaps = 3/131 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFD  383
            Q+RLAEEVT  VH +E LD A++A+  L   +      KLD +T+  +   VP   +  D
Sbjct  300  QKRLAEEVTVLVHSKEALDTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKD  359

Query  382  QvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  203
            Q+   ++  L+  + +  SK   R+M++ GG+ LN  ++  + + I  +D++DGK LL  
Sbjct  360  QLGQPAIELLTTVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITAEDLIDGKYLLAQ  419

Query  202  AGKKNKMVVRI  170
             GKKN  ++ +
Sbjct  420  KGKKNYYLLIV  430



>ref|WP_004355960.1| tyrosyl-tRNA synthetase [Prevotella disiens]
 gb|EFL46699.1| tyrosine--tRNA ligase [Prevotella disiens FB035-09AN]
 gb|ERJ79539.1| tyrosine--tRNA ligase [Prevotella disiens JCM 6334 = ATCC 29426]
 gb|KGF48647.1| tyrosyl-tRNA synthetase [Prevotella disiens DNF00882]
Length=432

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 72/132 (55%), Gaps = 4/132 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD---TKLDWKTIEGIASDVPSCSLPFD  383
            QRRLAEEVTR VH QE LD A+ A+  L   +      +LD +T   +  DVP   +  D
Sbjct  300  QRRLAEEVTRMVHSQEDLDMAIAASNILFGKSTKENLLQLDEQTFNDVFKDVPHYEISKD  359

Query  382  Qvlsisvldlsvssglle-SKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  206
             +   +V   +     +  SK   R+++K GG+ LN  ++ +  + I  +D++DGK LL+
Sbjct  360  LLGQPAVEVFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQVITAEDLIDGKYLLM  419

Query  205  SAGKKNKMVVRI  170
              GKKN  +V +
Sbjct  420  QKGKKNYFLVIV  431



>ref|WP_028906618.1| tyrosyl-tRNA synthetase [Prevotella ruminicola]
Length=431

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 74/131 (56%), Gaps = 3/131 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADT---KLDWKTIEGIASDVPSCSLPFD  383
            Q+RLAEEVT  VH +E LD A++A+  L   +      KLD +T+  +   VP   +  D
Sbjct  300  QKRLAEEVTVLVHSKEALDTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKD  359

Query  382  QvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  203
            Q+   ++  L+  + +  SK   R+M++ GG+ LN  ++  + + I  +D++DGK LL  
Sbjct  360  QLGQPAIELLTTVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITAEDMIDGKYLLAQ  419

Query  202  AGKKNKMVVRI  170
             GKKN  ++ +
Sbjct  420  KGKKNYYLLIV  430



>ref|WP_018657964.1| tyrosyl-tRNA synthetase [Actinomadura flavalba]
Length=426

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 73/122 (60%), Gaps = 2/122 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LAEE+T  VHG +     + A+ AL    +  +LD +T+    ++VP  +LP     
Sbjct  297  QRALAEEMTTLVHGADETARVIAASRALFGQGSLDELDERTLRSALAEVPRAALP--SGA  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               V DL V+SGL +SK  ARR ++QGG YLNNA+V++E      DD++ G+ L+L  GK
Sbjct  355  LPPVADLLVASGLCKSKSEARRAIQQGGAYLNNAKVEAEDAVPAADDLLHGRYLVLRRGK  414

Query  193  KN  188
            +N
Sbjct  415  RN  416



>ref|WP_005507143.1| tyrosyl-tRNA synthetase [Rothia mucilaginosa]
 gb|EHB87738.1| tyrosyl-tRNA synthetase [Rothia mucilaginosa M508]
Length=434

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 70/128 (55%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA  VT  VHG E  D+A+ A+EAL        LD  T+E + +++PS  L  D++ 
Sbjct  309  QKTLAYLVTSLVHGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLSEDRLD  368

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             ISVL     +        ARR+LK+GG  +N  +V  E   I +DD++ G+  ++  GK
Sbjct  369  MISVLTELGFAKSNSE---ARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGK  425

Query  193  KNKMVVRI  170
            KN+  V +
Sbjct  426  KNQGAVEL  433



>ref|WP_005507861.1| tyrosyl-tRNA synthetase [Rothia mucilaginosa]
 gb|EET75880.1| tyrosine--tRNA ligase [Rothia mucilaginosa ATCC 25296]
Length=434

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 70/128 (55%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LA  VT  VHG E  D+A+ A+EAL        LD  T+E + +++PS  L  D++ 
Sbjct  309  QKTLAYLVTSLVHGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLSEDRLD  368

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             ISVL     +        ARR+LK+GG  +N  +V  E   I +DD++ G+  ++  GK
Sbjct  369  MISVLTELGFAKSNSE---ARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGK  425

Query  193  KNKMVVRI  170
            KN+  V +
Sbjct  426  KNQGAVEL  433



>ref|WP_044496576.1| tyrosine--tRNA ligase [Lactobacillus johnsonii]
 sp|Q74LL0.2|SYY_LACJO RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Lactobacillus johnsonii NCC 533]
Length=420

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 71/128 (55%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   
Sbjct  296  QKRLAEEVTKFVHGEEGLKEAQIITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---  351

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK +++  GK
Sbjct  352  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGK  411

Query  193  KNKMVVRI  170
            +   +V+I
Sbjct  412  RKYTLVKI  419



>ref|WP_004898658.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii]
 gb|EGP13423.1| tyrosyl-tRNA synthetase cluster 1 [Lactobacillus johnsonii pf01]
Length=420

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 71/128 (55%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   
Sbjct  296  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---  351

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK +++  GK
Sbjct  352  AKNIVEFLVETKIESSKRQAREDVKNGAIYVNGERQDDIDFIIELDSDFDGKYVIIRKGK  411

Query  193  KNKMVVRI  170
            +   +V+I
Sbjct  412  RKYTLVKI  419



>gb|AAS08157.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii NCC 533]
Length=426

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 71/128 (55%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   
Sbjct  302  QKRLAEEVTKFVHGEEGLKEAQIITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---  357

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK +++  GK
Sbjct  358  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGK  417

Query  193  KNKMVVRI  170
            +   +V+I
Sbjct  418  RKYTLVKI  425



>ref|WP_016335378.1| tyrosyl-tRNA synthetase [Amycolatopsis orientalis]
 gb|AGM07632.1| tyrosyl-tRNA synthetase [Amycolatopsis orientalis HCCB10007]
Length=424

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 78/128 (61%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAEE T  VHG E   + + A++AL       +LD  T++   ++VP+  +  D   
Sbjct  297  QRKLAEEFTTLVHGAEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKV--DPNG  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              +++DL +++GL++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK
Sbjct  355  ESTIVDLLIAAGLVDSKGAARRTVKEGGAYVNNTKIADEEWKPSSDDALHGRWLVVRKGK  414

Query  193  KNKMVVRI  170
            +N   VR+
Sbjct  415  RNVAGVRV  422



>ref|WP_005987818.1| tyrosyl-tRNA synthetase [Actinomyces graevenitzii]
 gb|EHM87143.1| tyrosyl-tRNA synthetase [Actinomyces graevenitzii C83]
Length=423

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 79/131 (60%), Gaps = 5/131 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADT--KLDWKTIEGIASDVPSCSLPFDQ  380
            Q+ LA EVT +VHG++       AT AL  G+AD+  K+D  T+ G  +D+PS  L   +
Sbjct  296  QKALAHEVTTWVHGEQETARVEAATAALWGGDADSLRKIDAFTLAGATADLPSAQL---E  352

Query  379  vlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  200
            V   +++DL V++GL + + AAR+ + QGG YLN  +V  E   I EDD++ G V+L+  
Sbjct  353  VGKSTIIDLLVATGLEKGRGAARKTVAQGGAYLNMRKVSDEDAVITEDDLLAGGVVLVRK  412

Query  199  GKKNKMVVRIS  167
            G++   V R +
Sbjct  413  GRRKLAVARTN  423



>ref|WP_028271895.1| tyrosyl-tRNA synthetase [Arthrobacter sp. UNC362MFTsu5.1]
Length=437

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 75/129 (58%), Gaps = 3/129 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLA EVT  VHG E  ++ + A+ AL  G     LD +T+    +++PS  +  D   
Sbjct  310  QRRLAFEVTSLVHGVEATEKVIAASAALFGGGDLAALDERTLTAATAELPSARVAAD---  366

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             + ++DL V+SGL +SK AARR + +GG Y+NN +V      I   +++ G+ LLL  GK
Sbjct  367  GLGIVDLLVASGLSDSKSAARRTVGEGGAYVNNTKVTDPEAVIPGSELLHGRYLLLRRGK  426

Query  193  KNKMVVRIS  167
            KN   V ++
Sbjct  427  KNLATVEVA  435



>ref|WP_022513249.1| tyrosyl-tRNA synthetase [Dialister sp. CAG:588]
 emb|CDF27526.1| tyrosine--tRNA ligase [Dialister sp. CAG:588]
Length=420

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 75/129 (58%), Gaps = 4/129 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAEEVTRFVHGQEGL+EAL+ TEAL  GN   +L    IEG   +    +L     +
Sbjct  293  QRKLAEEVTRFVHGQEGLNEALRVTEALFSGNVQ-ELSAAEIEGAFRNTKGGTL---HSV  348

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             +++++  VS  +++SK  AR  +  G + +N  ++      I      +GK +++  GK
Sbjct  349  PMNIVEALVSGEVIKSKRQAREDVSNGAIRINGEKITDIEATITAHPNTNGKHIIVKKGK  408

Query  193  KNKMVVRIS  167
            KN  ++++S
Sbjct  409  KNYFLLKVS  417



>ref|WP_014790868.1| tyrosyl-tRNA synthetase [Ornithobacterium rhinotracheale]
 gb|AFL97273.1| tyrosyl-tRNA synthetase [Ornithobacterium rhinotracheale DSM 
15997]
 gb|AIP99335.1| tyrosyl-tRNA synthetase [Ornithobacterium rhinotracheale ORT-UMN 
88]
 gb|KGB66443.1| tyrosyl-tRNA synthetase [Ornithobacterium rhinotracheale H06-030791]
Length=429

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 75/132 (57%), Gaps = 6/132 (5%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADT----KLDWKTIEGIASDVPSCSLPF  386
            QR+LAEEVT  VH +E LD+A++A+E L  G A +    KLD KT   I   VP   +  
Sbjct  299  QRKLAEEVTTMVHSKEELDKAVQASEILF-GKATSENLRKLDEKTFLDIFDGVPQAEITQ  357

Query  385  DQvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  206
              +    +  LS  +  ++SK  ARR L+Q  + +N  ++  E  K+ E+D++ GK +LL
Sbjct  358  ADLNEDLLEILSTKTEFMKSKGEARRALQQNSIAVNKDKI-GEDYKLSENDLISGKYILL  416

Query  205  SAGKKNKMVVRI  170
              GKKN  VV +
Sbjct  417  QKGKKNYFVVIV  428



>ref|WP_044496612.1| tyrosyl-tRNA synthetase [Nesterenkonia sp. NP1]
Length=436

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 3/127 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LA EVT  VHG++ + +A+ A++AL      T++D  T+ GIA++V    LP +   
Sbjct  311  QRTLAWEVTALVHGEDAVRKAIAASDALFGKGEITEIDEPTLRGIAAEVTVAELPAE---  367

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + + +++  ++ L+ SK  ARR ++QGG Y+NN +VD     +E    +  + L++  GK
Sbjct  368  AATGINVLTATELVPSKGEARRAIQQGGAYINNTKVDDGDAVVEASAWLHDQYLVVRRGK  427

Query  193  KNKMVVR  173
            KN  V++
Sbjct  428  KNLAVIK  434



>ref|WP_038511529.1| tyrosyl-tRNA synthetase [Amycolatopsis japonica]
 gb|AIG75731.1| Tyrosine-tRNA ligase [Amycolatopsis japonica]
Length=424

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 79/128 (62%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAE+ T  VHG+E   + + A++AL       +LD  T++   ++VP+  +  D   
Sbjct  297  QRKLAEDFTTLVHGEEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKI--DPNG  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              +++DL +++GL++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK
Sbjct  355  EATIVDLLIAAGLVDSKGAARRTVKEGGAYVNNTKIADEEWKPSSDDALHGRWLVVRKGK  414

Query  193  KNKMVVRI  170
            +N   VR+
Sbjct  415  RNVAGVRV  422



>ref|WP_021314877.1| tyrosyl-tRNA synthetase [Lactobacillus gasseri]
 gb|EQB84886.1| tyrosyl-tRNA synthase [Lactobacillus gasseri 2016]
 gb|KFL95101.1| tyrosine--tRNA ligase [Lactobacillus gasseri SJ-9E-US]
Length=420

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 72/128 (56%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   
Sbjct  296  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---  351

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + ++++  V + +  SK  AR  +K G +Y+N  R +     IE D+  DGK +++  GK
Sbjct  352  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDNDFDGKYVIIRKGK  411

Query  193  KNKMVVRI  170
            +   +V+I
Sbjct  412  RKYTLVKI  419



>ref|WP_030504916.1| tyrosyl-tRNA synthetase [Microbispora rosea]
Length=421

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 71/122 (58%), Gaps = 3/122 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LAE++T  VHG + L   + A+ AL    +  +LD +T+E   ++VP   +P    L
Sbjct  296  QRALAEDLTTLVHGSDELARVIAASRALFGQGSLAELDARTLESALAEVPKAVVP---TL  352

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
                ++L   SGL+ESK AARR +K+GG YLNN ++  E      DD++ G+ L+L  GK
Sbjct  353  GAPYVELLAQSGLVESKSAARRAVKEGGAYLNNTKITDEEYVPSADDLLHGRFLVLRRGK  412

Query  193  KN  188
            K 
Sbjct  413  KT  414



>ref|WP_003650704.1| tyrosyl-tRNA synthetase [Lactobacillus gasseri]
 gb|EEQ26747.1| tyrosine--tRNA ligase [Lactobacillus gasseri 202-4]
Length=420

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 72/128 (56%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   
Sbjct  296  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---  351

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + ++++  V + +  SK  AR  +K G +Y+N  R +     IE D+  DGK +++  GK
Sbjct  352  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDNDFDGKYVIIRKGK  411

Query  193  KNKMVVRI  170
            +   +V+I
Sbjct  412  REYTLVKI  419



>ref|WP_020629629.1| tyrosyl-tRNA synthetase [Amycolatopsis alba]
Length=424

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 79/128 (62%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAE+ T  VHG+E   + + A++AL       +LD  T++   ++VP+  +  D   
Sbjct  297  QRKLAEDFTTLVHGEEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKV--DPNG  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              +++DL +++GL++SK AARR +K+GG Y+NN ++  EA     DD + G+ L++  GK
Sbjct  355  ESTIVDLLIAAGLVDSKGAARRTVKEGGAYVNNTKIADEAWTPSSDDALHGRWLVVRKGK  414

Query  193  KNKMVVRI  170
            +N   VR+
Sbjct  415  RNVAGVRV  422



>ref|WP_021604636.1| tyrosyl-tRNA synthetase [Actinomyces graevenitzii]
 gb|ERH17231.1| tyrosine--tRNA ligase [Actinomyces graevenitzii F0530]
Length=423

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 78/129 (60%), Gaps = 5/129 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADT--KLDWKTIEGIASDVPSCSLPFDQ  380
            Q+ LA EVT +VHG++       AT AL  G+AD+  K+D  T+ G  +D+PS  L   +
Sbjct  296  QKALAHEVTTWVHGEQETARVEAATAALWGGDADSLRKIDAFTLAGATADLPSSQL---E  352

Query  379  vlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  200
            V   +++DL V++GL + + AAR+ + QGG YLN  +V  E   I EDD++ G V+L+  
Sbjct  353  VGKSTIIDLLVATGLEKGRGAARKTVAQGGAYLNMRKVSDEDAVITEDDLLAGGVVLVRK  412

Query  199  GKKNKMVVR  173
            G++   V R
Sbjct  413  GRRKLAVAR  421



>ref|WP_028266666.1| tyrosyl-tRNA synthetase [Arthrobacter sp. MA-N2]
Length=436

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 80/130 (62%), Gaps = 5/130 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            QRRLA EVT  VHG +  ++ + A+ AL  GN D + LD  T+    +++PS S+  D  
Sbjct  310  QRRLAYEVTSLVHGVDATEKVIAASAALF-GNGDLSVLDEVTLASATAELPSASISAD--  366

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + ++DL V+SGL ESK AARR + +GG Y+NN++V      I+  +++ G+ LLL  G
Sbjct  367  -GLGIVDLLVASGLSESKSAARRTVGEGGAYVNNSKVTDPDAVIDRAELLHGRYLLLRRG  425

Query  196  KKNKMVVRIS  167
            KKN   V ++
Sbjct  426  KKNLATVEVT  435



>gb|ABJ59589.1| tyrosyl-tRNA synthetase [Lactobacillus gasseri ATCC 33323 = JCM 
1131]
Length=426

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 72/128 (56%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   
Sbjct  302  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---  357

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + ++++  V + +  SK  AR  +K G +Y+N  R +     IE D+  DGK +++  GK
Sbjct  358  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDNDFDGKYVIIRKGK  417

Query  193  KNKMVVRI  170
            +   +V+I
Sbjct  418  RKYTLVKI  425



>ref|WP_030266695.1| tyrosyl-tRNA synthetase [Streptacidiphilus jeojiense]
Length=422

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 74/123 (60%), Gaps = 4/123 (3%)
 Frame = -1

Query  538  EEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvlsisvl  359
            E+VT  VHGQE LD A+ A++AL      T+LD  T++   +++P   +        S++
Sbjct  300  EDVTTLVHGQEQLDRAIAASKALFGQGDLTELDAATLDAAVAELPQAQV----GELASIV  355

Query  358  dlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGKKNKMV  179
            DL  ++GL+ SK AARR +K+GG YLNNA+V  E     E D++ G+ LLL  GK++   
Sbjct  356  DLLAATGLVPSKSAARRAVKEGGAYLNNAKVTDEEAAPTEADLLHGRWLLLRRGKRSLAA  415

Query  178  VRI  170
            V +
Sbjct  416  VEL  418



>ref|WP_013398793.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
 gb|ADP41072.1| tyrosine--tRNA ligase [Rothia dentocariosa ATCC 17931]
Length=434

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 70/128 (55%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLA EVT  VHG E  ++A+ A+EAL        LD  T++ +  ++PS  L  D+  
Sbjct  309  QKRLAYEVTALVHGVEPTEQAIAASEALFGKGDFAALDESTLQAVMDELPSVELSSDR--  366

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
             + ++      G   SK  ARR+LK+GG  +N  +V  E  +I  + ++ GK  ++  GK
Sbjct  367  -LDLITALTELGFASSKSEARRILKEGGASVNGVKVQGEDARISSEQLLHGKYAIVRRGK  425

Query  193  KNKMVVRI  170
            KN+  + +
Sbjct  426  KNQGAITV  433



>ref|WP_006256112.1| tyrosyl-tRNA synthetase [Alloprevotella tannerae]
 gb|EEX70745.1| tyrosine--tRNA ligase [Prevotella tannerae ATCC 51259]
Length=431

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 76/133 (57%), Gaps = 6/133 (5%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLP-  389
            QRRL EEVT  VHG+E  ++AL ATE L  G A      KLD KT+  + S VP   +  
Sbjct  299  QRRLGEEVTVMVHGREEYEKALAATEILF-GKATKESLLKLDEKTLLAVFSGVPHFEVAR  357

Query  388  FDQvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLL  209
             + V + +V   +  +    SK   R++++ GG+ LN  ++ +  K I E+D++DGK LL
Sbjct  358  AEAVGAKAVDLFAEKTQCFASKGEMRKLVQGGGVSLNKEKLSAFDKTITEEDLLDGKYLL  417

Query  208  LSAGKKNKMVVRI  170
            +  GKKN  ++ +
Sbjct  418  VQRGKKNYYLITV  430



>ref|WP_042427072.1| tyrosyl-tRNA synthetase [Streptacidiphilus anmyonensis]
Length=420

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 75/128 (59%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LAEE+T  VHGQ+ LD A+ A++AL       +LD  T+    +++PS  +      
Sbjct  295  QRALAEELTVLVHGQDQLDRAVAASKALFGQGDLGELDAPTLAAAVAELPSAQV----GE  350

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               ++DL V++GL  S+ AARR + +GG Y+NN +V+ EA      D++ G+ L+L  GK
Sbjct  351  LGELVDLFVATGLSASRSAARRTINEGGAYVNNTKVEDEAATASPADLLHGRWLVLRRGK  410

Query  193  KNKMVVRI  170
            +N   + +
Sbjct  411  RNLAAIEL  418



>ref|WP_006947867.1| tyrosyl-tRNA synthetase [Prevotella marshii]
 gb|EFM02805.1| tyrosine--tRNA ligase [Prevotella marshii DSM 16973 = JCM 13450]
Length=432

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 73/132 (55%), Gaps = 5/132 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPF  386
            QRRLAEEVT  VH  E L  A++A+  L  G A      KL+ +T+  +   VP  +LP 
Sbjct  301  QRRLAEEVTTMVHSPEALAMAVEASNILF-GKATKESLLKLNEQTLLDVFEGVPHFTLPA  359

Query  385  DQvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  206
            D++   +    +    +  SK   R++++ GG+ LN  ++DS  + +   D+++G+ LL+
Sbjct  360  DKLGLSAGELFTTEIPIFTSKGEMRKLVQGGGVSLNKEKLDSFEQPVTAQDLINGRYLLV  419

Query  205  SAGKKNKMVVRI  170
              GKKN  ++ +
Sbjct  420  QRGKKNYYLITV  431



>ref|WP_023925721.1| tyrosyl-tRNA synthetase [Prevotella nigrescens]
 gb|ETD28509.1| tyrosyl-tRNA synthetase [Prevotella nigrescens CC14M]
Length=432

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPF  386
            QRRLAEEVTR VH QE LD A+ A+  L  G A      +LD +T   +  DVP   +  
Sbjct  300  QRRLAEEVTRMVHSQEDLDMAMAASNILF-GKATKENLLQLDEQTFNDVFKDVPHYEVSK  358

Query  385  DQvlsisvldlsvs-sglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLL  209
            D +   +V   +     +  SK   R+++K GG+ LN  ++ +  + I  +D++DGK LL
Sbjct  359  DLLGQPAVDIFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQVITAEDLIDGKYLL  418

Query  208  LSAGKKNKMVVRI  170
            +  GKKN  +V +
Sbjct  419  VQKGKKNYFLVIV  431



>ref|WP_024991409.1| tyrosyl-tRNA synthetase [Prevotella pleuritidis]
Length=432

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 70/127 (55%), Gaps = 6/127 (5%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLP-  389
            QRRLAEEVT  VH +E LD A++A+  L  G A      +LD +T+  +   VP  +L  
Sbjct  300  QRRLAEEVTLMVHSREALDTAIEASNILF-GKATKESLLRLDEQTLLDVFEGVPHFTLAK  358

Query  388  FDQvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLL  209
             D  L    L       +  SK   R+M++ GG+ LN  R++S  + I  DD++DGK LL
Sbjct  359  TDLGLPAVELLTRDDVKVFSSKGEMRKMVQGGGVSLNKERLESFDRLITSDDLIDGKYLL  418

Query  208  LSAGKKN  188
            +  GKKN
Sbjct  419  IQRGKKN  425



>ref|WP_021584875.1| tyrosyl-tRNA synthetase [Prevotella pleuritidis]
 gb|ERJ97850.1| tyrosine--tRNA ligase [Prevotella pleuritidis F0068]
Length=432

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 70/127 (55%), Gaps = 6/127 (5%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLP-  389
            QRRLAEEVT  VH +E LD A++A+  L  G A      +LD +T+  +   VP  +L  
Sbjct  300  QRRLAEEVTLMVHSREALDTAIEASNILF-GKATKESLLRLDEQTLLDVFEGVPHFTLAK  358

Query  388  FDQvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLL  209
             D  L    L       +  SK   R+M++ GG+ LN  R++S  + I  DD++DGK LL
Sbjct  359  TDLGLPAVELLTRDDVKVFSSKGEMRKMVQGGGVSLNKERLESFDRLITSDDLIDGKYLL  418

Query  208  LSAGKKN  188
            +  GKKN
Sbjct  419  IQRGKKN  425



>ref|WP_004362948.1| tyrosyl-tRNA synthetase [Prevotella nigrescens]
 gb|ELX67681.1| tyrosyl-tRNA synthetase [Prevotella nigrescens F0103]
Length=432

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPF  386
            QRRLAEEVTR VH QE LD A+ A+  L  G A      +LD +T   +  DVP   +  
Sbjct  300  QRRLAEEVTRMVHSQEDLDMAMAASNILF-GKATKENLLQLDEQTFNDVFKDVPHYEVSK  358

Query  385  DQvlsisvldlsvs-sglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLL  209
            D +   +V   +     +  SK   R+++K GG+ LN  ++ +  + I  +D++DGK LL
Sbjct  359  DLLGQPAVDIFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQVITAEDLIDGKYLL  418

Query  208  LSAGKKNKMVVRI  170
            +  GKKN  +V +
Sbjct  419  VQKGKKNYFLVIV  431



>ref|WP_005163244.1| tyrosyl-tRNA synthetase [Amycolatopsis azurea]
 gb|EMD24423.1| Tyrosyl-tRNA synthetase [Amycolatopsis azurea DSM 43854]
Length=424

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 79/128 (62%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAE+ T  VHG+E   + + A++AL       +LD  T++   ++VP+  +  D   
Sbjct  297  QRKLAEDFTTLVHGEEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKV--DPNG  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              +++DL ++ GL++SK AARR +K+GG Y+NN ++  EA K   +D + G+ L++  GK
Sbjct  355  ESTIVDLLIAGGLVDSKGAARRTVKEGGAYVNNTKIADEAWKPSAEDALHGRWLVVRKGK  414

Query  193  KNKMVVRI  170
            +N   VR+
Sbjct  415  RNVAGVRV  422



>ref|WP_009199613.1| tyrosyl-tRNA synthetase [Actinomyces sp. oral taxon 848]
 gb|EEZ77493.1| tyrosine--tRNA ligase [Actinomyces sp. oral taxon 848 str. F0332]
Length=420

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 12/132 (9%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVP----SCSLPF  386
            Q+ LAE+VT +VHG +  +    A+ AL  G     LD +T+    +++P    S   P 
Sbjct  296  QKALAEDVTTWVHGADATERVKAASRALFGGGGLESLDARTLADAVAELPRAEGSVGTPL  355

Query  385  DQvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLL  206
             ++   + L+  +         AARR +  GGLYLNN ++D  AK +   D++ G V+LL
Sbjct  356  IELFVATGLEKGLG--------AARRTVASGGLYLNNVKIDDGAKVLGSSDLLPGGVVLL  407

Query  205  SAGKKNKMVVRI  170
              GKKN  VV +
Sbjct  408  RRGKKNLAVVGV  419



>ref|WP_025000389.1| tyrosyl-tRNA synthetase [Prevotella aurantiaca]
Length=432

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPF  386
            QRRLAEEVTR VH QE LD A+ A+  L  G A      +LD +T   +  DVP   +  
Sbjct  300  QRRLAEEVTRMVHSQEDLDMAMAASNILF-GKATKENLLQLDEQTFNDVFKDVPHYEVSK  358

Query  385  DQvlsisvldlsvs-sglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLL  209
            D +   +V   +     +  SK   R+++K GG+ LN  ++ +  + I  +D++DGK LL
Sbjct  359  DLLGQPAVDIFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQVITAEDLIDGKYLL  418

Query  208  LSAGKKNKMVVRI  170
            +  GKKN  +V +
Sbjct  419  VQKGKKNYFLVIV  431



>ref|WP_021474284.1| tyrosyl-tRNA synthetase [Arthrobacter sp. AK-YN10]
 gb|ERI35718.1| tyrosyl-tRNA synthetase [Arthrobacter sp. AK-YN10]
Length=436

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 80/130 (62%), Gaps = 5/130 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            Q++LA EVT  VHG E  ++ + A+ AL  GN D + LD  T+    +++PS ++  D  
Sbjct  310  QKKLAYEVTSLVHGVEATEKVIAASAALF-GNGDLSVLDEPTLAAATAELPSATVGAD--  366

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + ++DL V+SGL +SK AARR + +GG Y+NNA+V      + ++ ++ G+ LLL  G
Sbjct  367  -GLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNAKVSDPDAVVAQEQLLHGRYLLLRRG  425

Query  196  KKNKMVVRIS  167
            KKN   V +S
Sbjct  426  KKNLATVEVS  435



>ref|WP_014709256.1| tyrosyl-tRNA synthetase [Prevotella intermedia]
 gb|AFJ09408.1| tyrosine--tRNA ligase [Prevotella intermedia 17]
Length=432

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPF  386
            QRRLAEEVTR VH QE LD A+ A+  L  G A      +LD +T   +  DVP   +  
Sbjct  300  QRRLAEEVTRMVHSQEDLDMAMAASNILF-GKATKENLLQLDEQTFNDVFKDVPHYEVSK  358

Query  385  DQvlsisvldlsvs-sglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLL  209
            D +   +V   +     +  SK   R+++K GG+ LN  ++ +  + I  +D++DGK LL
Sbjct  359  DLLGQPAVDIFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQVITAEDLIDGKYLL  418

Query  208  LSAGKKNKMVVRI  170
            +  GKKN  +V +
Sbjct  419  VQKGKKNYFLVIV  431



>ref|WP_028905488.1| tyrosyl-tRNA synthetase [Prevotella intermedia]
Length=432

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPF  386
            QRRLAEEVTR VH QE LD A+ A+  L  G A      +LD +T   +  DVP   +  
Sbjct  300  QRRLAEEVTRMVHSQEDLDMAMAASNILF-GKATKENLLQLDEQTFNDVFKDVPHYEVSK  358

Query  385  DQvlsisvldlsvs-sglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLL  209
            D +   +V   +     +  SK   R+++K GG+ LN  ++ +  + I  +D++DGK LL
Sbjct  359  DLLGQPAVDIFNQEGMQIFPSKSEMRKLVKGGGVSLNKEKLQAFDQVITAEDLIDGKYLL  418

Query  208  LSAGKKNKMVVRI  170
            +  GKKN  +V +
Sbjct  419  VQKGKKNYFLVIV  431



>ref|WP_039155571.1| tyrosyl-tRNA synthetase [Lactobacillus gasseri]
Length=420

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 71/128 (55%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   
Sbjct  296  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---  351

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + ++++  V + +  SK  AR  +K G +Y+N  R +     IE D   DGK +++  GK
Sbjct  352  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDSDFDGKYVIIRKGK  411

Query  193  KNKMVVRI  170
            +   +V+I
Sbjct  412  RKYTLVKI  419



>ref|WP_017614427.1| tyrosyl-tRNA synthetase [Nocardiopsis salina]
Length=434

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 77/123 (63%), Gaps = 2/123 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDWKTIEGIASDVPSCSLPFDQv  377
            Q+ LAEE+T  VHG+E   +A+ A+ AL  G AD ++LD +T+E   S+VP         
Sbjct  305  QKALAEELTTLVHGEEECRKAIDASLALF-GRADLSELDGRTLESALSEVPKVETDTPVG  363

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
               SV+DL   SGL  SK AARR +K+GG Y+NNA+V  E  +++ +D++  + ++L  G
Sbjct  364  ELPSVVDLFAESGLTPSKSAARRAIKEGGAYVNNAKVTDEDARLDAEDLLADRFVVLRRG  423

Query  196  KKN  188
            K+N
Sbjct  424  KRN  426



>ref|WP_004366699.1| tyrosyl-tRNA synthetase [Prevotella nigrescens]
 gb|EGQ14566.1| tyrosine--tRNA ligase [Prevotella nigrescens ATCC 33563]
Length=432

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLPF  386
            QRRLAEEVTR VH QE LD A+ A+  L  G A      +LD +T   +  DVP   +  
Sbjct  300  QRRLAEEVTRMVHSQEDLDMAMAASNILF-GKATKENLLQLDEQTFNDVFKDVPHYEVSK  358

Query  385  DQvlsisvldlsvs-sglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLL  209
            D +   +V   +     +  SK   R+++K GG+ LN  R+ +  + I  ++++DGK LL
Sbjct  359  DLLGQPAVDIFNQEGMQIFPSKSEMRKLVKGGGVSLNKERLQAFDQVITAENLIDGKYLL  418

Query  208  LSAGKKNKMVVRI  170
            +  GKKN  +V +
Sbjct  419  VQKGKKNYFLVIV  431



>ref|WP_003649560.1| tyrosyl-tRNA synthetase [Lactobacillus gasseri]
 gb|EFJ69357.1| tyrosine--tRNA ligase [Lactobacillus gasseri JV-V03]
Length=420

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 71/128 (55%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   
Sbjct  296  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVSQIEQALKNAPSAEATHE---  351

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + ++++  V + +  SK  AR  +K G +Y+N  R +     +E D   DGK +++  GK
Sbjct  352  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDVDFIVEPDSDFDGKYVIIRKGK  411

Query  193  KNKMVVRI  170
            +   +V+I
Sbjct  412  RKYTLVKI  419



>ref|WP_034321665.1| tyrosyl-tRNA synthetase [Amycolatopsis lurida]
 gb|KFU76457.1| tyrosyl-tRNA synthetase [Amycolatopsis lurida NRRL 2430]
 gb|AJK58517.1| tyrosyl-tRNA synthetase [Amycolatopsis lurida NRRL 2430]
Length=424

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 79/128 (62%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAE+ T  VHG+E   + + A++AL       +LD  T++   ++VP+  +  D   
Sbjct  297  QRKLAEDFTTLVHGEEATRQVIAASQALFGRGELRELDSATLDAAMAEVPNGKV--DPNG  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              +++DL +++GL++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK
Sbjct  355  ESTIVDLLIAAGLVDSKGAARRTVKEGGAYVNNTKIADEEWKPSADDALHGRWLVVRKGK  414

Query  193  KNKMVVRI  170
            +N   VR+
Sbjct  415  RNVAGVRV  422



>ref|WP_034277502.1| tyrosyl-tRNA synthetase [Amycolatopsis halophila]
Length=426

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 74/129 (57%), Gaps = 2/129 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAEE+T  VHG+E  ++ + A++AL        LD  T++   ++VP+  +      
Sbjct  300  QRKLAEELTTLVHGKEQTEQVIAASQALFGKGELGALDSSTLDAAMAEVPTGEVALGDGP  359

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +I  L L+        K AARR++K+GG Y+NNA+V  +  +   DD++  + L++  GK
Sbjct  360  TIIDLLLAADLVES--KGAARRVIKEGGAYVNNAKVTDDTWQPSRDDLLHDRWLVVRRGK  417

Query  193  KNKMVVRIS  167
            +N   VRI+
Sbjct  418  RNLGGVRIA  426



>ref|WP_037345658.1| tyrosyl-tRNA synthetase [Amycolatopsis sp. MJM2582]
 gb|KFZ78350.1| tyrosyl-tRNA synthetase [Amycolatopsis sp. MJM2582]
Length=424

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 79/128 (62%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAE+ T  VHG+E   + + A++AL       +LD  T++   ++VP+  +  D   
Sbjct  297  QRKLAEDFTTLVHGEEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGKV--DPNG  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              +++DL +++GL++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK
Sbjct  355  ESTIVDLLIAAGLVDSKGAARRTVKEGGAYVNNTKIVDEEWKPSSDDALHGRWLVVRKGK  414

Query  193  KNKMVVRI  170
            +N   VR+
Sbjct  415  RNVAGVRV  422



>ref|WP_012892535.1| tyrosyl-tRNA synthetase [Streptosporangium roseum]
 gb|ACZ88800.1| Tyrosine--tRNA ligase [Streptosporangium roseum DSM 43021]
Length=422

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LAE+VT  VHG + L   + A+ AL    +  +LD +T+    ++VP   +P    L
Sbjct  296  QRTLAEDVTTLVHGADELARVVAASRALFGQGSLEELDARTLGSALAEVPRAEVP---AL  352

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              S +DL   SGL+ESK AARR +K+GG YLNN ++  EA     DD++ G+ L+L  GK
Sbjct  353  GASFVDLLAESGLVESKSAARRAVKEGGAYLNNVKITDEAYVPSADDLLHGRFLVLRRGK  412

Query  193  KNKMVVRIS  167
            ++   V ++
Sbjct  413  RSIGGVEVT  421



>ref|WP_007028024.1| tyrosyl-tRNA synthetase [Amycolatopsis decaplanina]
 gb|EME65067.1| tyrosyl-tRNA ligase [Amycolatopsis decaplanina DSM 44594]
Length=424

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 79/128 (62%), Gaps = 2/128 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR+LAE+ T  VHG+E   + + A++AL       +LD  T++   ++VP+  +  D   
Sbjct  297  QRKLAEDFTTLVHGEEATRQVIAASQALFGRGELRELDSATLDAAMAEVPNGKV--DPNG  354

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
              +++DL +++GL++SK AARR +K+GG Y+NN ++  E  K   DD + G+ L++  GK
Sbjct  355  ESTIVDLLIAAGLVDSKGAARRTVKEGGAYVNNTKIADEEWKPSADDALHGRWLVVRKGK  414

Query  193  KNKMVVRI  170
            +N   VR+
Sbjct  415  RNVAGVRV  422



>ref|WP_035732891.1| tyrosyl-tRNA synthetase [Gulosibacter molinativorax]
Length=440

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 75/129 (58%), Gaps = 4/129 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QR LA  VT  VHG+E  D A+ A+EAL        L+ +T++   +++P+     +  +
Sbjct  315  QRALARAVTVLVHGEEATDNAIAASEALFGQGDLLALNAETLQQAIAELPNT----ESTV  370

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
               +  + V +G +ES  AARR +KQGG+ LNNAR++ E + IE  D++ G V+++  GK
Sbjct  371  GAELSQVLVDTGAVESLSAARRAIKQGGVSLNNARIEDEHRVIESGDLLPGSVIVVRRGK  430

Query  193  KNKMVVRIS  167
            K  +   IS
Sbjct  431  KTLVGATIS  439



>ref|WP_021852743.1| tyrosyl-tRNA synthetase [Prevotella sp. CAG:1058]
 emb|CCX65061.1| tyrosine--tRNA ligase [Prevotella sp. CAG:1058]
Length=433

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 73/131 (56%), Gaps = 3/131 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD---TKLDWKTIEGIASDVPSCSLPFD  383
            QRRLAEEVT  VH +E  D A++A+  L   +      KLD +T+  I   VP   +  D
Sbjct  301  QRRLAEEVTVMVHSREDYDAAVEASNILFGKSTKESLMKLDEQTLLDIFEGVPQFEISRD  360

Query  382  QvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  203
            ++   ++   +  + +  SK   R++++ GG+ LN  ++ +  + I  DD++DGK LL+ 
Sbjct  361  KLGLQAIELFTTEAAVFASKGEMRKLVQGGGVSLNKDKLTAFDRAITADDLIDGKYLLVQ  420

Query  202  AGKKNKMVVRI  170
             GKKN  +V +
Sbjct  421  RGKKNYYLVTV  431



>gb|AJC07291.1| tyrosyl-tRNA synthase [Lactobacillus gasseri 130918]
Length=426

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 71/128 (55%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   
Sbjct  302  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEATHE---  357

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + ++++  V + +  SK  AR  +K G +Y+N  R +     IE D   DGK +++  GK
Sbjct  358  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDSDFDGKYVIIRKGK  417

Query  193  KNKMVVRI  170
            +   +V+I
Sbjct  418  RKYTLVKI  425



>ref|WP_007324558.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica]
 gb|EGF29422.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica WH47]
Length=432

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 68/130 (52%), Gaps = 3/130 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+RLA+ +T  VHG+ G+  A +AT+ L  G      D +  E I +DVPSC +P   + 
Sbjct  302  QKRLAQWLTELVHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALE  360

Query  373  sisvldlsvssglleSKFA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSA  200
               +  +              ARR L +GG+Y+NN RV+   K++  DD+    VL+L  
Sbjct  361  GEGLWIVEALQTAKLCNSGGDARRALSEGGVYVNNTRVEDVQKRLTADDLDGRSVLVLRR  420

Query  199  GKKNKMVVRI  170
            GK+   +++I
Sbjct  421  GKRKYALLKI  430



>ref|WP_014567013.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii]
 gb|AEB92520.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii DPC 6026]
Length=420

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 71/128 (55%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q++LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS     +   
Sbjct  296  QKKLAEEVTKFVHGEEGLKEAQMITEALFSGNIKS-LSVPQIEQALKNAPSAEATHE---  351

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + ++++  + + +  SK  AR  +K G +Y+N  R D     IE D   DGK +++  GK
Sbjct  352  AKNIVEFLIETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGK  411

Query  193  KNKMVVRI  170
            +   +V+I
Sbjct  412  RKYTLVKI  419



>ref|WP_027449259.1| tyrosyl-tRNA synthetase [Prevotella brevis]
Length=433

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 72/131 (55%), Gaps = 3/131 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEAL---RPGNADTKLDWKTIEGIASDVPSCSLPFD  383
            Q+RLAEEVT  VH QE LD A++A+  L       A  KLD +T   +   V    +  D
Sbjct  301  QKRLAEEVTVLVHSQEALDMAIEASNILFGKSTKEALEKLDEQTFLDVFDGVEKFEIAKD  360

Query  382  QvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  203
            Q+   ++  L+  + +  SK   R+M++ GG+ LN  ++  + + I  +D++DGK LL  
Sbjct  361  QLGQPAIEILTTVAPVFPSKGEMRKMVQGGGVSLNKEKLTDQNRAITAEDLIDGKYLLAQ  420

Query  202  AGKKNKMVVRI  170
             GKKN  ++ +
Sbjct  421  KGKKNYYLITV  431



>ref|WP_021853510.1| tyrosyl-tRNA synthetase [Prevotella sp. CAG:255]
 emb|CCX68294.1| tyrosine--tRNA ligase [Prevotella sp. CAG:255]
Length=432

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 74/131 (56%), Gaps = 3/131 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEAL---RPGNADTKLDWKTIEGIASDVPSCSLPFD  383
            QRRLAEEVT  VH +E  D A++A+  L      ++  KLD +T   I   VP   +  D
Sbjct  301  QRRLAEEVTVMVHSREDYDAAVEASNILFGKSTKDSLLKLDEQTFLDIFEGVPQFEVSKD  360

Query  382  QvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLS  203
            ++   +V   +  + +  SK   R++++ GG+ LN  ++ +  ++I  DD++DGK LL+ 
Sbjct  361  KIGLPAVELFTTEAAVFASKGEMRKLVQGGGVSLNKEKLAAFDREITSDDLIDGKYLLVQ  420

Query  202  AGKKNKMVVRI  170
             GKKN  ++ +
Sbjct  421  RGKKNYFLITV  431



>ref|WP_011774354.1| tyrosyl-tRNA synthetase [Arthrobacter aurescens]
 gb|ABM06477.1| tyrosyl-tRNA synthetase [Arthrobacter aurescens TC1]
Length=436

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 80/130 (62%), Gaps = 5/130 (4%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTK-LDWKTIEGIASDVPSCSLPFDQv  377
            Q++LA EVT  VHG +  ++ + A+ AL  GN D   LD +T+E   +++PS ++  D  
Sbjct  310  QKKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLAVLDERTLEAATAELPSATIGAD--  366

Query  376  lsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
              + ++DL V+SGL +SK AARR + +GG Y+NN +V      I  ++++ G+ LLL  G
Sbjct  367  -GLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPDAVIAREELLHGRYLLLRRG  425

Query  196  KKNKMVVRIS  167
            KKN   + +S
Sbjct  426  KKNLATIEVS  435



>ref|WP_025065363.1| tyrosyl-tRNA synthetase [Prevotella enoeca]
Length=433

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 70/127 (55%), Gaps = 6/127 (5%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDWKTIEGIASDVPSCSLP-  389
            QRRLAEEVT  VH +E LD A++A+  L  G A      +LD +T+  +   VP  +L  
Sbjct  300  QRRLAEEVTLMVHSREALDTAIEASNILF-GKATKESLLRLDEQTLLDVFEGVPHFTLAK  358

Query  388  FDQvlsisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLL  209
             D  L    L       +  SK   R+M++ GG+ LN  R++S  + I  DD++DGK LL
Sbjct  359  TDLGLPAVELLTRDDVKVFSSKGEMRKMVQGGGVSLNKERLESFDRLITSDDLIDGKYLL  418

Query  208  LSAGKKN  188
            +  GKKN
Sbjct  419  VQRGKKN  425



>ref|WP_004806341.1| tyrosyl-tRNA synthetase [Actinomyces neuii]
 gb|EJZ87547.1| tyrosine-tRNA ligase [Actinomyces neuii BVS029A5]
Length=420

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 71/125 (57%), Gaps = 3/125 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q+ LAE VTR VHG E  D+ L ATEAL        +D  T+      +P+  L   +V 
Sbjct  295  QKELAESVTRLVHGDEVTDQVLAATEALWGKGDLASIDASTLASATESLPATEL---EVG  351

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + +++DL V +GL + K AARR +K GG YLNN +V+     I E D++ G  +L+  GK
Sbjct  352  TSTIVDLLVGTGLEKGKGAARRTIKSGGAYLNNQKVEDVDYVIAETDLLSGGKVLVRKGK  411

Query  193  KNKMV  179
            +N  V
Sbjct  412  RNLAV  416



>ref|WP_018921741.1| tyrosyl-tRNA synthetase [Salsuginibacillus kocurii]
Length=425

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 73/126 (58%), Gaps = 3/126 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            QRRLAEEVT+FVHG   L++A   ++AL  G A TKL  + IE    DVP+     D   
Sbjct  299  QRRLAEEVTKFVHGITALEQAQNISQALFGGGALTKLSAEEIEQGFKDVPTYKAEED---  355

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            +I +++L + + ++ SK  AR  ++ G +Y+N  R    AK+I  +D +D +  +L  GK
Sbjct  356  TIPLVELLIHAEIVSSKRQAREDIQNGAVYINGERCQDLAKEIGSEDQIDERFTILRRGK  415

Query  193  KNKMVV  176
            K   +V
Sbjct  416  KKYFLV  421



>ref|WP_004896025.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii]
 gb|EEJ60647.1| tyrosine--tRNA ligase [Lactobacillus johnsonii ATCC 33200]
Length=420

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 72/128 (56%), Gaps = 4/128 (3%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q++LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS  +  +   
Sbjct  296  QKKLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEVTHE---  351

Query  373  sisvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAGK  194
            + ++++  V + +  SK  AR  +K G +Y+N  R +     IE D   DGK +++  GK
Sbjct  352  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDSDFDGKYVIIRKGK  411

Query  193  KNKMVVRI  170
            +   +V+I
Sbjct  412  RKYTLVKI  419



>ref|WP_012825381.1| tyrosyl-tRNA synthetase [Haliangium ochraceum]
 ref|YP_003264647.1| tyrosyl-tRNA synthetase [Haliangium ochraceum DSM 14365]
 gb|ACY12754.1| tyrosyl-tRNA synthetase [Haliangium ochraceum DSM 14365]
Length=432

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 80/129 (62%), Gaps = 2/129 (2%)
 Frame = -1

Query  553  QRRLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDWKTIEGIASDVPSCSLPFDQvl  374
            Q  LAE++T +VHG+E    AL A++ +  G+ +  L+   ++ + +D+P+ SLP  Q+ 
Sbjct  302  QSALAEDLTDWVHGEEAKRNALAASQVMFGGSLE-NLNDAALQPLTADLPTTSLPRQQLE  360

Query  373  s-isvldlsvssglleSKFAARRMLKQGGLYLNNARVDSEAKKIEEDDIVDGKVLLLSAG  197
            S I +L+L   + L  SK AARR+++ GG+Y+NN RV    K +  +D+    +++L AG
Sbjct  361  SGIPLLELLAQTKLAASKGAARRLVQGGGVYVNNIRVADVNKTLLPEDLGTETIMILRAG  420

Query  196  KKNKMVVRI  170
            KKN  +V+ 
Sbjct  421  KKNYHLVQF  429



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760