BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF045F20

Length=585
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU40714.1|  hypothetical protein MIMGU_mgv1a019320mg                191   1e-54   Erythranthe guttata [common monkey flower]
gb|EYU38885.1|  hypothetical protein MIMGU_mgv1a026932mg                191   1e-54   Erythranthe guttata [common monkey flower]
dbj|BAF01866.1|  chloroplast nucleoid DNA binding protein like          178   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006339720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    188   3e-53   Solanum tuberosum [potatoes]
ref|XP_004229990.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    188   5e-53   Solanum lycopersicum
ref|XP_011093028.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    187   7e-53   Sesamum indicum [beniseed]
ref|XP_009775618.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    187   9e-53   Nicotiana sylvestris
ref|XP_011093892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   1e-52   Sesamum indicum [beniseed]
ref|XP_011023172.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   2e-52   Populus euphratica
ref|XP_004171805.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   2e-52   
ref|XP_002302634.2|  aspartyl protease family protein                   185   4e-52   Populus trichocarpa [western balsam poplar]
ref|XP_002263964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    185   4e-52   Vitis vinifera
ref|XP_010053832.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    185   5e-52   Eucalyptus grandis [rose gum]
ref|XP_002523337.1|  Aspartic proteinase nepenthesin-1 precursor,...    184   5e-52   Ricinus communis
ref|XP_010556596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   6e-52   Tarenaya hassleriana [spider flower]
ref|XP_006444833.1|  hypothetical protein CICLE_v10019938mg             184   6e-52   Citrus clementina [clementine]
ref|XP_006491285.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   6e-52   Citrus sinensis [apfelsine]
ref|XP_008437888.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   7e-52   Cucumis melo [Oriental melon]
ref|XP_011038277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    185   8e-52   Populus euphratica
gb|KDP28482.1|  hypothetical protein JCGZ_14253                         184   9e-52   Jatropha curcas
ref|XP_004133810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   9e-52   Cucumis sativus [cucumbers]
ref|XP_009613969.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   9e-52   Nicotiana tomentosiformis
gb|EYU32252.1|  hypothetical protein MIMGU_mgv1a005685mg                184   1e-51   Erythranthe guttata [common monkey flower]
gb|KGN56421.1|  Aspartic proteinase nepenthesin-1                       184   1e-51   Cucumis sativus [cucumbers]
ref|XP_004306664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    183   1e-51   Fragaria vesca subsp. vesca
emb|CDP08669.1|  unnamed protein product                                183   2e-51   Coffea canephora [robusta coffee]
gb|AGV54495.1|  aspartic proteinase nepenthesin-1-like protein          183   2e-51   Phaseolus vulgaris [French bean]
ref|XP_010095748.1|  Aspartic proteinase nepenthesin-1                  183   3e-51   Morus notabilis
ref|XP_003529886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   3e-51   Glycine max [soybeans]
gb|AGV54447.1|  aspartic proteinase nepenthesin-1 precursor             182   3e-51   Phaseolus vulgaris [French bean]
ref|XP_007135265.1|  hypothetical protein PHAVU_010G114700g             182   3e-51   Phaseolus vulgaris [French bean]
gb|KFK42512.1|  hypothetical protein AALP_AA1G003500                    182   4e-51   Arabis alpina [alpine rockcress]
emb|CDX90023.1|  BnaA10g00590D                                          181   9e-51   
ref|XP_003554768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   1e-50   Glycine max [soybeans]
ref|XP_009119684.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   1e-50   Brassica rapa
ref|XP_006418409.1|  hypothetical protein EUTSA_v10009389mg             181   1e-50   Eutrema salsugineum [saltwater cress]
ref|XP_002320868.1|  aspartyl protease family protein                   181   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_008351846.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    180   2e-50   
ref|XP_008343434.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    180   3e-50   
ref|XP_008376086.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    180   3e-50   Malus domestica [apple tree]
ref|XP_007147317.1|  hypothetical protein PHAVU_006G113700g             180   5e-50   Phaseolus vulgaris [French bean]
ref|XP_007051537.1|  Eukaryotic aspartyl protease family protein ...    179   9e-50   
emb|CDY15187.1|  BnaC05g00660D                                          179   1e-49   Brassica napus [oilseed rape]
ref|XP_004494825.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   1e-49   
ref|XP_003520873.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   1e-49   Glycine max [soybeans]
ref|NP_171637.1|  aspartyl protease family protein                      178   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892074.1|  aspartyl protease family protein                   178   2e-49   
ref|XP_006307379.1|  hypothetical protein CARUB_v10009005mg             178   2e-49   Capsella rubella
ref|XP_010457141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010474721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    177   3e-49   Pyrus x bretschneideri [bai li]
ref|XP_007217966.1|  hypothetical protein PRUPE_ppa005289mg             177   3e-49   
ref|XP_004248083.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    175   1e-48   Solanum lycopersicum
gb|KJB09627.1|  hypothetical protein B456_001G154400                    174   2e-48   Gossypium raimondii
ref|XP_010480432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    175   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_004139658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    174   2e-48   Cucumis sativus [cucumbers]
gb|AAM66061.1|  chloroplast nucleoid DNA binding protein, putative      175   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008461984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    175   3e-48   
gb|EPS66029.1|  hypothetical protein M569_08742                         174   4e-48   Genlisea aurea
gb|KEH24641.1|  eukaryotic aspartyl protease family protein             174   7e-48   Medicago truncatula
gb|KJB09626.1|  hypothetical protein B456_001G154400                    174   9e-48   Gossypium raimondii
ref|XP_006362137.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    173   1e-47   Solanum tuberosum [potatoes]
ref|XP_009600181.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    172   2e-47   
gb|KJB49569.1|  hypothetical protein B456_008G125700                    172   2e-47   Gossypium raimondii
ref|XP_007051536.1|  Eukaryotic aspartyl protease family protein ...    171   1e-46   
ref|XP_010665756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    171   1e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009800816.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    167   3e-45   Nicotiana sylvestris
ref|XP_010544842.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    165   1e-44   Tarenaya hassleriana [spider flower]
gb|ADJ67210.1|  aspartic proteinase nepenthesin-1 precursor             154   2e-44   Jatropha curcas
gb|ADJ67200.1|  aspartic proteinase nepenthesin-1 precursor             152   8e-44   Jatropha curcas
ref|XP_002878415.1|  aspartyl protease family protein                   162   2e-43   
ref|NP_191741.1|  aspartyl protease                                     161   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512555.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010469025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006402438.1|  hypothetical protein EUTSA_v10005923mg             159   2e-42   Eutrema salsugineum [saltwater cress]
gb|KFK35370.1|  hypothetical protein AALP_AA5G276300                    158   4e-42   Arabis alpina [alpine rockcress]
ref|XP_010413342.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    158   5e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009138753.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    157   6e-42   Brassica rapa
emb|CDX89133.1|  BnaA04g00530D                                          157   7e-42   
ref|XP_009104352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    157   1e-41   Brassica rapa
emb|CDX67868.1|  BnaA07g19080D                                          156   2e-41   
emb|CDY25081.1|  BnaC06g18230D                                          156   3e-41   Brassica napus [oilseed rape]
ref|XP_010918360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    156   4e-41   Elaeis guineensis
emb|CDY43952.1|  BnaC04g21580D                                          155   5e-41   Brassica napus [oilseed rape]
ref|XP_009394177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    153   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008795461.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   5e-40   Phoenix dactylifera
ref|XP_010266550.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    152   7e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010924503.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   3e-39   Elaeis guineensis
ref|XP_008799615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    149   1e-38   Phoenix dactylifera
gb|ABK24467.1|  unknown                                                 147   8e-38   Picea sitchensis
ref|XP_006852628.1|  hypothetical protein AMTR_s00021p00234660          145   2e-37   Amborella trichopoda
ref|XP_004969076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    141   5e-36   Setaria italica
ref|XP_003637416.1|  Aspartic proteinase nepenthesin-2                  134   1e-35   
ref|XP_003569303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   1e-35   Brachypodium distachyon [annual false brome]
ref|XP_001757102.1|  predicted protein                                  139   2e-35   
ref|XP_002455897.1|  hypothetical protein SORBIDRAFT_03g026970          139   3e-35   
ref|NP_001043485.1|  Os01g0598600                                       139   4e-35   
gb|EMS49734.1|  Aspartic proteinase nepenthesin-1                       137   5e-35   Triticum urartu
ref|NP_001183392.1|  uncharacterized protein LOC100501808               136   7e-35   
gb|EPS61272.1|  hypothetical protein M569_13524                         138   9e-35   Genlisea aurea
dbj|BAJ86414.1|  predicted protein                                      138   9e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM83204.1|  unnamed protein product                                137   1e-34   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002529147.1|  Aspartic proteinase nepenthesin-1 precursor,...    137   2e-34   
tpg|DAA58835.1|  TPA: hypothetical protein ZEAMMB73_701358              137   2e-34   
ref|XP_008374731.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   3e-34   
gb|KHN27179.1|  Aspartic proteinase nepenthesin-1                       129   4e-34   Glycine soja [wild soybean]
gb|KJB09628.1|  hypothetical protein B456_001G154400                    135   1e-33   Gossypium raimondii
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g             135   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    135   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_007036465.1|  Eukaryotic aspartyl protease family protein        135   1e-33   
gb|KEH44258.1|  aspartic protease in GUARD CELL-like protein            134   2e-33   Medicago truncatula
ref|XP_001759252.1|  predicted protein                                  133   2e-33   
gb|KDP20100.1|  hypothetical protein JCGZ_05869                         134   2e-33   Jatropha curcas
gb|ABK24255.1|  unknown                                                 133   4e-33   Picea sitchensis
emb|CDY24395.1|  BnaCnng04620D                                          133   5e-33   Brassica napus [oilseed rape]
ref|XP_011072934.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   7e-33   Sesamum indicum [beniseed]
ref|XP_009337317.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   8e-33   Pyrus x bretschneideri [bai li]
ref|XP_004497116.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   1e-32   Cicer arietinum [garbanzo]
ref|XP_011077177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   1e-32   Sesamum indicum [beniseed]
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   1e-32   Populus euphratica
ref|XP_006440937.1|  hypothetical protein CICLE_v10019848mg             132   2e-32   Citrus clementina [clementine]
gb|KDO64536.1|  hypothetical protein CISIN_1g011045mg                   132   2e-32   Citrus sinensis [apfelsine]
ref|XP_010551288.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_008351877.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   2e-32   
ref|XP_007153356.1|  hypothetical protein PHAVU_003G028600g             131   2e-32   Phaseolus vulgaris [French bean]
ref|XP_009109887.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   2e-32   Brassica rapa
ref|XP_004299230.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   2e-32   Fragaria vesca subsp. vesca
ref|XP_008367576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   2e-32   
ref|XP_002511962.1|  Aspartic proteinase nepenthesin-1 precursor,...    131   2e-32   Ricinus communis
ref|XP_006485768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   3e-32   Citrus sinensis [apfelsine]
ref|XP_008351878.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   3e-32   
ref|XP_009337150.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   3e-32   Pyrus x bretschneideri [bai li]
gb|EEE64882.1|  hypothetical protein OsJ_19741                          130   3e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056485.1|  Os05g0590000                                       130   4e-32   
gb|EYU40867.1|  hypothetical protein MIMGU_mgv1a023461mg                130   4e-32   Erythranthe guttata [common monkey flower]
ref|XP_003520035.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   4e-32   Glycine max [soybeans]
gb|AAT38006.1|  unknow protein                                          130   4e-32   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99240.1|  hypothetical protein OsI_21202                          130   5e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010265215.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   7e-32   Nelumbo nucifera [Indian lotus]
ref|XP_007152794.1|  hypothetical protein PHAVU_004G160200g             129   9e-32   Phaseolus vulgaris [French bean]
ref|XP_002890686.1|  aspartyl protease family protein                   129   1e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_008244017.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   1e-31   Prunus mume [ume]
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    129   1e-31   
gb|KCW48530.1|  hypothetical protein EUGRSUZ_K02206                     129   1e-31   Eucalyptus grandis [rose gum]
gb|KJB52970.1|  hypothetical protein B456_008G285900                    129   1e-31   Gossypium raimondii
gb|KFK44545.1|  hypothetical protein AALP_AA1G270600                    129   1e-31   Arabis alpina [alpine rockcress]
ref|XP_010527532.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   2e-31   Tarenaya hassleriana [spider flower]
ref|XP_006306517.1|  hypothetical protein CARUB_v10012516mg             129   2e-31   Capsella rubella
gb|EAZ12575.1|  hypothetical protein OsJ_02481                          129   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010092769.1|  Aspartic proteinase nepenthesin-1                  128   2e-31   Morus notabilis
ref|XP_002281973.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   2e-31   Vitis vinifera
ref|XP_003534178.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   2e-31   Glycine max [soybeans]
ref|XP_002971459.1|  hypothetical protein SELMODRAFT_64134              127   3e-31   
emb|CAA09458.1|  hypothetical protein                                   120   3e-31   Cicer arietinum [garbanzo]
ref|XP_002966033.1|  hypothetical protein SELMODRAFT_64135              127   3e-31   
ref|XP_006415880.1|  hypothetical protein EUTSA_v10009899mg             128   4e-31   Eutrema salsugineum [saltwater cress]
ref|XP_004135107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   4e-31   Cucumis sativus [cucumbers]
ref|XP_004172253.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    128   4e-31   
ref|XP_010499100.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   4e-31   Camelina sativa [gold-of-pleasure]
gb|KDO36875.1|  hypothetical protein CISIN_1g037264mg                   124   4e-31   Citrus sinensis [apfelsine]
ref|NP_173922.1|  aspartyl protease family protein                      127   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007209939.1|  hypothetical protein PRUPE_ppa004726mg             127   4e-31   Prunus persica
gb|KDP29378.1|  hypothetical protein JCGZ_18299                         127   5e-31   Jatropha curcas
ref|XP_009103072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   6e-31   Brassica rapa
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   6e-31   Elaeis guineensis
ref|XP_010677970.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   6e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006843768.1|  hypothetical protein AMTR_s00007p00241440          127   7e-31   Amborella trichopoda
emb|CDY51131.1|  BnaA07g37140D                                          127   7e-31   Brassica napus [oilseed rape]
ref|XP_008782298.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   7e-31   Phoenix dactylifera
ref|XP_010487776.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   9e-31   Camelina sativa [gold-of-pleasure]
ref|XP_002315953.1|  aspartyl protease family protein                   126   1e-30   Populus trichocarpa [western balsam poplar]
gb|KFK39179.1|  hypothetical protein AALP_AA3G210500                    126   1e-30   Arabis alpina [alpine rockcress]
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504              126   1e-30   
ref|XP_003517994.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    126   2e-30   Glycine max [soybeans]
emb|CDP20336.1|  unnamed protein product                                126   2e-30   Coffea canephora [robusta coffee]
ref|XP_006298983.1|  hypothetical protein CARUB_v10015108mg             125   2e-30   Capsella rubella
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   2e-30   Phoenix dactylifera
gb|KDO70056.1|  hypothetical protein CISIN_1g0117492mg                  122   2e-30   Citrus sinensis [apfelsine]
ref|XP_008446567.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   3e-30   Cucumis melo [Oriental melon]
ref|XP_009380958.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY03848.1|  BnaC07g10730D                                          125   4e-30   
ref|XP_010465949.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   4e-30   Camelina sativa [gold-of-pleasure]
gb|KEH27070.1|  aspartic protease in GUARD CELL-like protein            124   5e-30   Medicago truncatula
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048              124   5e-30   
gb|EMT00623.1|  Aspartic proteinase nepenthesin-1                       121   5e-30   
ref|XP_009608744.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   6e-30   Nicotiana tomentosiformis
ref|XP_007225636.1|  hypothetical protein PRUPE_ppa003917mg             125   6e-30   
ref|XP_010506935.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   6e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010926497.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    124   7e-30   Elaeis guineensis
ref|XP_008243190.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   7e-30   Prunus mume [ume]
ref|XP_009112699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   9e-30   Brassica rapa
emb|CDY69364.1|  BnaCnng63170D                                          124   1e-29   Brassica napus [oilseed rape]
gb|KJB50738.1|  hypothetical protein B456_008G185200                    124   1e-29   Gossypium raimondii
ref|XP_009800603.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   1e-29   Nicotiana sylvestris
ref|XP_006406598.1|  hypothetical protein EUTSA_v10020568mg             123   2e-29   Eutrema salsugineum [saltwater cress]
ref|XP_009409187.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010695864.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007046283.1|  Eukaryotic aspartyl protease family protein        123   2e-29   
emb|CDY24483.1|  BnaC05g34710D                                          123   2e-29   Brassica napus [oilseed rape]
ref|XP_006437718.1|  hypothetical protein CICLE_v10031364mg             122   2e-29   Citrus clementina [clementine]
ref|XP_006484425.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   3e-29   Citrus sinensis [apfelsine]
ref|XP_009145889.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   3e-29   Brassica rapa
ref|XP_011008360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   3e-29   Populus euphratica
ref|XP_002885261.1|  aspartyl protease family protein                   122   3e-29   Arabidopsis lyrata subsp. lyrata
emb|CDX92240.1|  BnaA05g21670D                                          122   3e-29   
ref|XP_002275164.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   4e-29   Vitis vinifera
ref|XP_010105777.1|  Aspartic proteinase nepenthesin-1                  122   4e-29   Morus notabilis
emb|CDM80984.1|  unnamed protein product                                122   4e-29   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002440367.1|  hypothetical protein SORBIDRAFT_09g030430          122   4e-29   
ref|XP_004512945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   5e-29   Cicer arietinum [garbanzo]
dbj|BAK07248.1|  predicted protein                                      121   8e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010551158.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   8e-29   Tarenaya hassleriana [spider flower]
ref|XP_010533981.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   9e-29   Tarenaya hassleriana [spider flower]
emb|CDX75968.1|  BnaC03g40510D                                          120   1e-28   
ref|XP_006362549.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   1e-28   Solanum tuberosum [potatoes]
gb|ABR16474.1|  unknown                                                 121   1e-28   Picea sitchensis
gb|AAL87345.1|  putative chloroplast nucleoid DNA-binding protein       120   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188478.1|  protein ASPARTIC PROTEASE IN GUARD CELL 1             120   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008389306.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   2e-28   
ref|XP_004238952.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   2e-28   Solanum lycopersicum
ref|XP_004968151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   2e-28   Setaria italica
ref|XP_009762361.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   3e-28   Nicotiana sylvestris
ref|XP_010549135.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   4e-28   Tarenaya hassleriana [spider flower]
ref|XP_008457107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   4e-28   
ref|XP_004137465.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   5e-28   Cucumis sativus [cucumbers]
ref|XP_004157423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   5e-28   
gb|EAY72467.1|  hypothetical protein OsI_00323                          119   5e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_001041979.1|  Os01g0140100                                       119   5e-28   
gb|KHN15927.1|  Aspartic proteinase nepenthesin-1                       110   6e-28   Glycine soja [wild soybean]
ref|XP_009336599.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   6e-28   Pyrus x bretschneideri [bai li]
gb|KJB37242.1|  hypothetical protein B456_006G195400                    119   7e-28   Gossypium raimondii
emb|CDX82342.1|  BnaA03g34790D                                          118   1e-27   
ref|NP_001168599.1|  uncharacterized protein LOC100382383               116   1e-27   
gb|AEW08671.1|  hypothetical protein CL1136Contig1_03                   109   2e-27   Pinus radiata
ref|XP_003565317.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   2e-27   Brachypodium distachyon [annual false brome]
ref|XP_006645485.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   3e-27   
tpg|DAA53545.1|  TPA: hypothetical protein ZEAMMB73_483039              117   3e-27   
ref|XP_004241622.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   4e-27   Solanum lycopersicum
ref|XP_009616228.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   4e-27   Nicotiana tomentosiformis
ref|XP_002965292.1|  hypothetical protein SELMODRAFT_83230              116   5e-27   
ref|XP_002986620.1|  hypothetical protein SELMODRAFT_124369             115   5e-27   
ref|XP_009135580.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   5e-27   Brassica rapa
ref|XP_009356391.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_002457394.1|  hypothetical protein SORBIDRAFT_03g006630          115   1e-26   Sorghum bicolor [broomcorn]
ref|XP_004298296.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   1e-26   Fragaria vesca subsp. vesca
ref|XP_004235788.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   1e-26   
ref|XP_004961034.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   2e-26   Setaria italica
gb|EYU19035.1|  hypothetical protein MIMGU_mgv1a021892mg                114   2e-26   Erythranthe guttata [common monkey flower]
gb|AEW08670.1|  hypothetical protein CL1136Contig1_03                   107   3e-26   Pinus lambertiana
ref|XP_010044282.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    114   3e-26   Eucalyptus grandis [rose gum]
ref|XP_006341626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   3e-26   Solanum tuberosum [potatoes]
ref|XP_008791252.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   5e-26   
emb|CDP20730.1|  unnamed protein product                                113   6e-26   Coffea canephora [robusta coffee]
ref|XP_008802841.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   7e-26   Phoenix dactylifera
gb|AFK45956.1|  unknown                                                 109   1e-25   Medicago truncatula
emb|CAN80962.1|  hypothetical protein VITISV_022007                     107   1e-25   Vitis vinifera
gb|ABR17085.1|  unknown                                                 112   2e-25   Picea sitchensis
ref|XP_006354732.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   2e-25   
gb|EMT24490.1|  Aspartic proteinase nepenthesin-1                       105   2e-25   
ref|XP_006484478.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   3e-25   Citrus sinensis [apfelsine]
ref|XP_010935575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   3e-25   Elaeis guineensis
ref|XP_009798772.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   4e-25   Nicotiana sylvestris
ref|XP_009609715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   4e-25   
ref|XP_007227097.1|  hypothetical protein PRUPE_ppa025647mg             111   6e-25   
emb|CDO98452.1|  unnamed protein product                                110   7e-25   Coffea canephora [robusta coffee]
ref|XP_010487964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   8e-25   Camelina sativa [gold-of-pleasure]
gb|ABR17396.1|  unknown                                                 109   8e-25   Picea sitchensis
gb|KJB79793.1|  hypothetical protein B456_013G067200                    109   1e-24   Gossypium raimondii
gb|KDO69941.1|  hypothetical protein CISIN_1g011042mg                   110   1e-24   Citrus sinensis [apfelsine]
ref|XP_006437655.1|  hypothetical protein CICLE_v10031332mg             109   1e-24   
ref|XP_007043208.1|  Aspartic proteinase nepenthesin-1, putative        109   1e-24   
ref|XP_010279486.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   1e-24   Nelumbo nucifera [Indian lotus]
emb|CAD31717.1|  putative nucleoid DNA-binding protein                  104   2e-24   Cicer arietinum [garbanzo]
gb|KEH44446.1|  aspartic protease in GUARD CELL-like protein            109   2e-24   Medicago truncatula
emb|CDY24567.1|  BnaC05g32510D                                          108   2e-24   Brassica napus [oilseed rape]
gb|ABK24480.1|  unknown                                                 109   2e-24   Picea sitchensis
emb|CDY25371.1|  BnaA05g19130D                                          108   2e-24   Brassica napus [oilseed rape]
gb|KFK39328.1|  hypothetical protein AALP_AA3G230300                    108   3e-24   
ref|XP_006406427.1|  hypothetical protein EUTSA_v10020671mg             108   3e-24   
ref|NP_188636.2|  protein ASPARTIC PROTEASE IN GUARD CELL 2             108   3e-24   
ref|XP_002885351.1|  pepsin A                                           108   3e-24   
ref|XP_009398943.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   3e-24   
ref|XP_006297584.1|  hypothetical protein CARUB_v10013606mg             108   3e-24   
ref|XP_010508355.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   4e-24   
ref|XP_009145693.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   4e-24   
ref|XP_010466176.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   4e-24   
ref|XP_008221090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   4e-24   
ref|XP_001784204.1|  predicted protein                                  107   4e-24   
ref|XP_008359997.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    108   6e-24   
ref|XP_002442590.1|  hypothetical protein SORBIDRAFT_08g022570          107   7e-24   
ref|XP_010542095.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   7e-24   
ref|XP_002513132.1|  Aspartic proteinase nepenthesin-1 precursor,...    107   8e-24   
ref|XP_008453384.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   9e-24   
ref|XP_010248951.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   1e-23   
ref|XP_002267930.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   1e-23   
gb|KJB49971.1|  hypothetical protein B456_008G147500                    107   1e-23   
emb|CBI35367.3|  unnamed protein product                                107   1e-23   
ref|XP_008465249.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   1e-23   
ref|XP_002961719.1|  hypothetical protein SELMODRAFT_64161              105   1e-23   
ref|XP_004138238.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   2e-23   
ref|XP_004150193.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   2e-23   
ref|XP_004170575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   2e-23   
ref|XP_010103590.1|  Aspartic proteinase nepenthesin-2                  106   2e-23   
ref|XP_010908909.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   2e-23   
ref|XP_008340423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   2e-23   
ref|XP_003555824.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   3e-23   
ref|XP_011089579.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    105   4e-23   
ref|XP_008445900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   5e-23   
gb|KDP40474.1|  hypothetical protein JCGZ_24473                         105   5e-23   
ref|XP_009351765.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   6e-23   
ref|XP_004138341.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   7e-23   
ref|XP_003536757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   7e-23   
ref|XP_002468182.1|  hypothetical protein SORBIDRAFT_01g041210          104   1e-22   
gb|AFB33833.1|  hypothetical protein CL1136Contig1_03                 97.4    1e-22   
ref|XP_009385987.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   1e-22   
ref|XP_007153018.1|  hypothetical protein PHAVU_003G000900g             103   1e-22   
gb|KJB77420.1|  hypothetical protein B456_012G135900                    104   1e-22   
ref|XP_009629151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   1e-22   
ref|XP_002964789.1|  hypothetical protein SELMODRAFT_82470              103   1e-22   
ref|XP_009760593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   1e-22   
ref|XP_004497254.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   2e-22   
ref|XP_004147103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   2e-22   
emb|CDP07949.1|  unnamed protein product                                102   2e-22   
ref|XP_002442591.1|  hypothetical protein SORBIDRAFT_08g022580          103   3e-22   
ref|XP_007142740.1|  hypothetical protein PHAVU_007G013000g             103   3e-22   
ref|XP_004253208.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   3e-22   
ref|XP_010031370.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   4e-22   
gb|KGN63808.1|  hypothetical protein Csa_1G021980                       101   4e-22   
gb|EYU40681.1|  hypothetical protein MIMGU_mgv1a005122mg                102   5e-22   
ref|XP_004138237.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   5e-22   
ref|XP_002306246.2|  hypothetical protein POPTR_0005s06390g             102   6e-22   
ref|XP_011007544.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   6e-22   
ref|XP_008791253.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   6e-22   
ref|XP_003589787.1|  Aspartic proteinase nepenthesin-2                  102   6e-22   
ref|XP_011031192.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   7e-22   
ref|XP_011022942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   7e-22   
gb|AES60038.2|  aspartic protease in GUARD CELL-like protein            101   8e-22   
ref|XP_004972145.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   8e-22   
ref|XP_004297710.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   1e-21   
emb|CDP04865.1|  unnamed protein product                                102   1e-21   
ref|XP_002309912.2|  hypothetical protein POPTR_0007s04120g             101   1e-21   
ref|XP_010688619.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   2e-21   
ref|XP_008675097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   2e-21   
ref|XP_004498098.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   2e-21   
ref|XP_002458414.1|  hypothetical protein SORBIDRAFT_03g033075          100   2e-21   
gb|EAZ13356.1|  hypothetical protein OsJ_03278                          100   2e-21   
ref|XP_004498097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   2e-21   
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750          100   3e-21   
gb|KGN63809.1|  hypothetical protein Csa_1G022480                       100   3e-21   
ref|XP_004170576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   3e-21   
gb|KCW64008.1|  hypothetical protein EUGRSUZ_G01690                   99.4    4e-21   
ref|XP_006345303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   4e-21   
gb|EAY75637.1|  hypothetical protein OsI_03542                        99.4    5e-21   
dbj|BAB84414.1|  chloroplast nucleoid DNA-binding protein cnd41-like  99.4    6e-21   
ref|XP_006653026.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.4    7e-21   
ref|XP_006360843.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.0    1e-20   
ref|XP_004236867.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  98.6    1e-20   
gb|EMT00485.1|  Aspartic proteinase nepenthesin-1                     94.0    1e-20   
ref|XP_002448772.1|  hypothetical protein SORBIDRAFT_06g032900        97.8    2e-20   
ref|XP_003580821.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.8    2e-20   
ref|XP_010068575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.4    2e-20   
ref|XP_010068543.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.1    2e-20   
ref|XP_009770623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.4    4e-20   
gb|KCW63938.1|  hypothetical protein EUGRSUZ_G01615                   97.1    4e-20   
gb|KCW63937.1|  hypothetical protein EUGRSUZ_G01615                   97.1    4e-20   
ref|XP_002442593.1|  hypothetical protein SORBIDRAFT_08g022613        96.3    8e-20   
ref|XP_008668690.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.5    1e-19   
ref|XP_003567056.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.1    2e-19   
dbj|BAJ97639.1|  predicted protein                                    95.1    2e-19   
ref|XP_009607692.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.4    4e-19   
ref|XP_002443631.1|  hypothetical protein SORBIDRAFT_08g022620        94.4    5e-19   
ref|XP_008453383.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.4    5e-19   
gb|KJB41527.1|  hypothetical protein B456_007G108800                  90.1    5e-19   
gb|ABR16115.1|  unknown                                               94.0    6e-19   
gb|ABR18297.1|  unknown                                               93.2    8e-19   
gb|KJB23742.1|  hypothetical protein B456_004G112400                  93.2    1e-18   
ref|XP_006646069.1|  PREDICTED: uncharacterized protein LOC102700486  93.2    2e-18   
emb|CDO98457.1|  unnamed protein product                              90.5    3e-18   
gb|ACN40790.1|  unknown                                               91.7    3e-18   
emb|CDM84701.1|  unnamed protein product                              90.9    6e-18   
emb|CAE05761.2|  OSJNBa0064G10.12                                     90.5    9e-18   
gb|KHN45833.1|  Aspartic proteinase nepenthesin-1                     84.3    1e-17   
emb|CAJ86229.1|  H0402C08.5                                           90.1    1e-17   
gb|EAZ32412.1|  hypothetical protein OsJ_16623                        90.1    1e-17   
ref|NP_001054261.2|  Os04g0677100                                     90.1    1e-17   
gb|ABK24493.1|  unknown                                               90.1    1e-17   
gb|ADE76437.1|  unknown                                               88.6    1e-17   
emb|CDO98456.1|  unnamed protein product                              90.1    1e-17   
ref|XP_002979394.1|  hypothetical protein SELMODRAFT_53966            88.2    2e-17   
ref|XP_002990366.1|  hypothetical protein SELMODRAFT_43971            88.2    4e-17   
ref|XP_004960076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    4e-17   
ref|XP_010916755.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    7e-17   
emb|CDP20729.1|  unnamed protein product                              87.0    2e-16   
gb|KCW44808.1|  hypothetical protein EUGRSUZ_L01627                   86.3    2e-16   
ref|XP_010928895.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.3    3e-16   
gb|ACF83919.1|  unknown                                               81.3    3e-16   
ref|XP_008220626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.3    3e-16   
gb|EMT12122.1|  Aspartic proteinase nepenthesin-2                     83.6    4e-16   
gb|ABP93696.1|  unknown protein isoform 1                             84.3    4e-16   
ref|XP_006426445.1|  hypothetical protein CICLE_v10025623mg           85.5    5e-16   
gb|KDO58699.1|  hypothetical protein CISIN_1g013672mg                 85.5    5e-16   
ref|XP_006466172.1|  PREDICTED: aspartic proteinase nepenthesin-1...  85.1    5e-16   
gb|KCW63732.1|  hypothetical protein EUGRSUZ_G01378                   84.3    6e-16   
ref|XP_003530761.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    7e-16   
ref|XP_007223364.1|  hypothetical protein PRUPE_ppa005616mg           84.7    8e-16   
ref|XP_010928894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    1e-15   
gb|AAM74221.1|AF518565_1  putative chloroplast nucleoid DNA-bindi...  80.5    2e-15   
ref|XP_010256103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    2e-15   
ref|XP_009420903.1|  PREDICTED: aspartic proteinase nepenthesin-1...  83.2    2e-15   
gb|EMT16849.1|  Aspartic proteinase nepenthesin-1                     81.3    2e-15   
ref|XP_003573011.1|  PREDICTED: aspartic proteinase nepenthesin-2...  83.6    3e-15   
emb|CDP19504.1|  unnamed protein product                              83.6    3e-15   
ref|XP_007224453.1|  hypothetical protein PRUPE_ppa022256mg           82.8    3e-15   
ref|XP_008670374.1|  PREDICTED: aspartic proteinase nepenthesin-2...  83.2    4e-15   
ref|XP_010266606.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.2    4e-15   
dbj|BAK01404.1|  predicted protein                                    82.8    5e-15   
ref|XP_004291984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.8    5e-15   
ref|XP_010241283.1|  PREDICTED: aspartic proteinase nepenthesin-1...  83.2    5e-15   
ref|XP_010241281.1|  PREDICTED: aspartic proteinase nepenthesin-1...  83.2    5e-15   
ref|XP_002262813.3|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.5    5e-15   
gb|EMS59201.1|  Aspartic proteinase nepenthesin-1                     77.0    6e-15   
ref|XP_006857532.1|  hypothetical protein AMTR_s00061p00034260        77.8    7e-15   
ref|XP_008668689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.0    7e-15   
gb|KJB71343.1|  hypothetical protein B456_011G117400                  82.0    7e-15   
ref|XP_001774247.1|  predicted protein                                81.6    8e-15   
dbj|BAF01928.1|  nucleoid DNA-binding protein cnd41 - like protein    79.0    9e-15   
gb|AFK40811.1|  unknown                                               79.0    9e-15   
ref|XP_002309515.1|  nucleoid DNA-binding family protein              81.6    1e-14   
tpg|DAA35351.1|  TPA: hypothetical protein ZEAMMB73_696016            82.0    1e-14   
gb|KDP41942.1|  hypothetical protein JCGZ_26960                       81.6    1e-14   
emb|CDO98454.1|  unnamed protein product                              79.7    1e-14   
gb|KDP26966.1|  hypothetical protein JCGZ_22200                       81.6    2e-14   
emb|CDO98455.1|  unnamed protein product                              81.3    2e-14   
ref|XP_009411894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.9    2e-14   
emb|CDX97058.1|  BnaC09g45670D                                        81.3    2e-14   
ref|XP_010523813.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  78.6    2e-14   
emb|CDX69804.1|  BnaA10g21530D                                        80.9    2e-14   
ref|XP_010648779.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.0    2e-14   
emb|CBI41087.3|  unnamed protein product                              76.3    2e-14   
ref|XP_011044763.1|  PREDICTED: aspartic proteinase nepenthesin-2...  80.9    2e-14   
ref|XP_009122022.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.9    3e-14   
ref|XP_002307559.2|  hypothetical protein POPTR_0005s22630g           80.9    3e-14   
ref|XP_002460980.1|  hypothetical protein SORBIDRAFT_02g038700        80.9    3e-14   
ref|XP_010099762.1|  Aspartic proteinase nepenthesin-1                80.5    3e-14   
ref|XP_002453187.1|  hypothetical protein SORBIDRAFT_04g001340        80.5    3e-14   
ref|XP_002324352.2|  hypothetical protein POPTR_0018s03010g           80.5    3e-14   
ref|XP_002324351.1|  nucleoid DNA-binding family protein              80.5    3e-14   
gb|KFK25359.1|  hypothetical protein AALP_AA8G103100                  80.5    3e-14   
emb|CDX85746.1|  BnaA02g00670D                                        80.5    3e-14   
ref|XP_009359072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.5    3e-14   
ref|XP_009125277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.5    3e-14   
ref|XP_006847614.1|  hypothetical protein AMTR_s00014p00246430        80.5    3e-14   
ref|XP_010258628.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.5    3e-14   
gb|KDO67374.1|  hypothetical protein CISIN_1g011556mg                 80.5    3e-14   
ref|XP_010422811.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.1    3e-14   
ref|XP_006648575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.1    3e-14   
ref|XP_008442220.1|  PREDICTED: aspartic proteinase nepenthesin-1     80.1    4e-14   
ref|XP_006483510.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.1    4e-14   
emb|CDY40117.1|  BnaC02g00130D                                        80.1    4e-14   
ref|NP_196637.1|  aspartyl protease family protein                    80.1    4e-14   
ref|XP_010252879.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.1    4e-14   
ref|NP_001140482.1|  hypothetical protein precursor                   80.1    4e-14   
emb|CDP11359.1|  unnamed protein product                              80.1    4e-14   
ref|XP_009391129.1|  PREDICTED: aspartic proteinase nepenthesin-2...  80.1    4e-14   
ref|XP_006399574.1|  hypothetical protein EUTSA_v10013429mg           79.7    4e-14   
ref|XP_008380197.1|  PREDICTED: aspartic proteinase nepenthesin-2     80.1    4e-14   
ref|XP_011045692.1|  PREDICTED: aspartic proteinase nepenthesin-1...  79.7    5e-14   
ref|XP_002300215.2|  aspartyl protease family protein                 79.7    5e-14   
ref|XP_010491756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.3    5e-14   
ref|XP_011036735.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.7    5e-14   
gb|AAN60226.1|  unknown                                               79.7    5e-14   
ref|XP_010424699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  77.8    5e-14   
ref|XP_010491757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.7    5e-14   
ref|XP_010491755.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.7    6e-14   
ref|XP_004973134.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.7    6e-14   
ref|XP_002520371.1|  basic 7S globulin 2 precursor small subunit,...  79.7    6e-14   
ref|XP_006370905.1|  aspartyl protease family protein                 79.3    6e-14   
dbj|BAJ04354.1|  pollen allergen CPA63                                79.3    7e-14   
ref|XP_006841210.1|  hypothetical protein AMTR_s00135p00030880        79.0    7e-14   
ref|XP_010916060.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.7    7e-14   
ref|XP_011046330.1|  PREDICTED: aspartic proteinase nepenthesin-1...  79.0    8e-14   
ref|XP_006845396.1|  hypothetical protein AMTR_s00019p00061190        79.3    8e-14   
ref|XP_009391894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.0    9e-14   
ref|XP_008452815.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.0    9e-14   
gb|KDP34587.1|  hypothetical protein JCGZ_12216                       78.6    9e-14   
ref|XP_010272925.1|  PREDICTED: aspartic proteinase nepenthesin-1...  78.6    1e-13   
gb|KJB58890.1|  hypothetical protein B456_009G230400                  78.6    1e-13   
ref|XP_006294147.1|  hypothetical protein CARUB_v10023140mg           79.0    1e-13   
emb|CAB96832.1|  nucleoid DNA-binding protein cnd41-like protein      78.6    1e-13   
gb|KEH35638.1|  aspartic proteinase nepenthesin                       78.6    1e-13   
ref|NP_001046662.1|  Os02g0314600                                     79.0    1e-13   
gb|EAY85563.1|  hypothetical protein OsI_06935                        79.0    1e-13   
ref|XP_010025709.1|  PREDICTED: aspartic proteinase nepenthesin-1     78.6    1e-13   
ref|XP_011085418.1|  PREDICTED: aspartic proteinase nepenthesin-2...  79.0    1e-13   
gb|AFG63982.1|  hypothetical protein CL1136Contig1_02                 72.8    1e-13   
ref|XP_009377195.1|  PREDICTED: aspartic proteinase nepenthesin-2...  79.0    1e-13   
ref|XP_002967518.1|  hypothetical protein SELMODRAFT_87804            78.2    1e-13   
ref|NP_196638.2|  aspartyl protease family protein                    78.6    1e-13   



>gb|EYU40714.1| hypothetical protein MIMGU_mgv1a019320mg [Erythranthe guttata]
Length=469

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS+LK SS+FSLFDTCFDLSGKTEVKVPTVVLHF GADVSLPA+NYLIPVD
Sbjct  364  ALRDAFRIGASNLKRSSDFSLFDTCFDLSGKTEVKVPTVVLHFEGADVSLPASNYLIPVD  423

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            +EGKFCFAFAGT SGLSIIGNIQQQGFRVVFDLAG+R+GFA  GCA
Sbjct  424  SEGKFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGNRVGFAPRGCA  469



>gb|EYU38885.1| hypothetical protein MIMGU_mgv1a026932mg [Erythranthe guttata]
Length=471

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS+LK SSEFSLFDTCFDLSGKTEVKVPTVVLH  GADVSLPA+NYLIPVD
Sbjct  366  ALRDAFRIGASNLKRSSEFSLFDTCFDLSGKTEVKVPTVVLHLEGADVSLPASNYLIPVD  425

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            +EGKFCFAFAGT SGLSIIGNIQQQGFRVVFDLAG+R+GFA  GCA
Sbjct  426  SEGKFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGNRVGFAPRGCA  471



>dbj|BAF01866.1| chloroplast nucleoid DNA binding protein like [Arabidopsis thaliana]
Length=142

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GA  LK + +FSLFDTCFDLS   EVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  37   AMRDAFRVGAKTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVD  96

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  97   TNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLASSRVGFAPGGCA  142



>ref|XP_006339720.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=480

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RD+FR GA DLK + +FSLFDTCFDLSGKTEVKVPTVV+HFRGADVSLPA+NYLIPVD
Sbjct  375  ALRDSFRMGARDLKRAPDFSLFDTCFDLSGKTEVKVPTVVMHFRGADVSLPASNYLIPVD  434

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            ++G FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSRLGFA  GCA
Sbjct  435  SDGTFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRLGFAPRGCA  480



>ref|XP_004229990.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=500

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA DLK + +FSLFDTCFDLSGKTEVKVPTVV+HFRGADVSLPA+NYLIPVD
Sbjct  395  ALRDAFRMGAKDLKRAPDFSLFDTCFDLSGKTEVKVPTVVMHFRGADVSLPASNYLIPVD  454

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            ++G FCFAFAGT SGLSIIGNIQQQGFRVVFDLAG+RLGFA  GCA
Sbjct  455  SDGTFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGNRLGFAPRGCA  500



>ref|XP_011093028.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=476

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS+LK + +FSLFDTCFDLSGKTEVKVPTVVLHF GADVSLPA+NYLIPVD
Sbjct  371  ALRDAFRAGASNLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFGGADVSLPASNYLIPVD  430

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            +EGKFCFAFAGT SGLSIIGNIQQQGFRVVFD+A +R+GFAA GCA
Sbjct  431  SEGKFCFAFAGTMSGLSIIGNIQQQGFRVVFDMASNRVGFAARGCA  476



>ref|XP_009775618.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=491

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA++LK + +FSLFDTCFDLSGKTEVKVPTVVLHF+GADVSLPA+NYLIPVD
Sbjct  386  ALRDAFRIGAANLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFKGADVSLPASNYLIPVD  445

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            ++G FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSRLGFA  GCA
Sbjct  446  SDGTFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRLGFAPRGCA  491



>ref|XP_011093892.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Sesamum 
indicum]
Length=478

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+R+AFR GAS+LKP+ +FSLFDTCFDLSGKTEVKVPTVVLHF GADVSLPA+NYLIPVD
Sbjct  373  ALRNAFRVGASNLKPAPDFSLFDTCFDLSGKTEVKVPTVVLHFAGADVSLPASNYLIPVD  432

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            ++GKFCFAFAGT SGLSIIGNIQQQGFRVVFDLA +R+GFA  GCA
Sbjct  433  SDGKFCFAFAGTMSGLSIIGNIQQQGFRVVFDLASNRVGFAPRGCA  478



>ref|XP_011023172.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=492

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS+LK + EFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA+NYLIPVD
Sbjct  387  ALRDAFRVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPASNYLIPVD  446

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
              G FCFAFAGT SGLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  447  NSGSFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAASRVGFAPRGCA  492



>ref|XP_004171805.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Cucumis sativus]
Length=384

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK + EFSLFDTC+DLSGKT VKVPTVVLHFRGADVSLPA+NYLIPVD
Sbjct  279  ALRDAFRAGASSLKSAPEFSLFDTCYDLSGKTTVKVPTVVLHFRGADVSLPASNYLIPVD  338

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
              G+FCFAFAGTTSGLSIIGNIQQQGFRVV+DLA SR+GF+  GCA
Sbjct  339  GSGRFCFAFAGTTSGLSIIGNIQQQGFRVVYDLASSRVGFSPRGCA  384



>ref|XP_002302634.2| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE81907.2| aspartyl protease family protein [Populus trichocarpa]
Length=490

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS+LK + EFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA+NYLIPVD
Sbjct  385  ALRDAFRVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPASNYLIPVD  444

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
              G FCFAFAGT SGLSI+GNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  445  NSGSFCFAFAGTMSGLSIVGNIQQQGFRVVYDLAASRVGFAPRGCA  490



>ref|XP_002263964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
 emb|CAN64659.1| hypothetical protein VITISV_009613 [Vitis vinifera]
Length=489

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            ++RDAFR GA+DLK + ++SLFDTCFDLSGKTEVKVPTVV+HFRGADVSLPA NYLIPVD
Sbjct  384  SLRDAFRAGAADLKRAPDYSLFDTCFDLSGKTEVKVPTVVMHFRGADVSLPATNYLIPVD  443

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T G FCFAFAGT SGLSIIGNIQQQGFRVVFD+A SR+GFAA GCA
Sbjct  444  TNGVFCFAFAGTMSGLSIIGNIQQQGFRVVFDVAASRIGFAARGCA  489



>ref|XP_010053832.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
 gb|KCW78191.1| hypothetical protein EUGRSUZ_D02381 [Eucalyptus grandis]
Length=485

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK + +FSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA+NYLIPVD
Sbjct  380  ALRDAFRAGASGLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPASNYLIPVD  439

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            ++G FCFAFA T SGLSIIGNIQQQGFRVVFDLAGSR+GF+  GCA
Sbjct  440  SQGTFCFAFAATMSGLSIIGNIQQQGFRVVFDLAGSRVGFSPRGCA  485



>ref|XP_002523337.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF39053.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=469

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A RDAFR GAS+LK + +FSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA+NYLIPVD
Sbjct  364  AFRDAFRAGASNLKRAPQFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPASNYLIPVD  423

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T G FC AFAGT  GLSIIGNIQQQGFRVV+DLAGSR+GFA  GCA
Sbjct  424  TSGNFCLAFAGTMGGLSIIGNIQQQGFRVVYDLAGSRVGFAPHGCA  469



>ref|XP_010556596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=467

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GA +LK ++ FSLFDTCFDLSG TEVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  362  AMRDAFRVGAKNLKRATSFSLFDTCFDLSGLTEVKVPTVVLHFRGADVSLPATNYLIPVD  421

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T GKFCFAFAGT SGLSIIGNIQQQGFRVV+DL GSR+GFA  GC
Sbjct  422  TNGKFCFAFAGTASGLSIIGNIQQQGFRVVYDLVGSRVGFAPRGC  466



>ref|XP_006444833.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
 gb|ESR58073.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
Length=480

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK + +FSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  375  ALRDAFRAGASSLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPATNYLIPVD  434

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + G FCFAFAGT SGLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  435  SSGTFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAASRIGFAPRGCA  480



>ref|XP_006491285.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO86492.1| hypothetical protein CISIN_1g040810mg [Citrus sinensis]
Length=480

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK + +FSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  375  ALRDAFRAGASSLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPATNYLIPVD  434

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + G FCFAFAGT SGLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  435  SSGTFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAASRIGFAPRGCA  480



>ref|XP_008437888.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=474

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK + EFSLFDTC+DLSGKT VKVPTVVLHFRGADVSLPA+NYLIPVD
Sbjct  369  ALRDAFRAGASSLKSAPEFSLFDTCYDLSGKTTVKVPTVVLHFRGADVSLPASNYLIPVD  428

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
              G+FCFAFAGTTSGLSIIGNIQQQGFRVV+DLA SR+GF+  GCA
Sbjct  429  GSGRFCFAFAGTTSGLSIIGNIQQQGFRVVYDLASSRVGFSPRGCA  474



>ref|XP_011038277.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Populus 
euphratica]
Length=505

 Score =   185 bits (469),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS+LK + EFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA+NYLIPVD
Sbjct  400  ALRDAFRVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPASNYLIPVD  459

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
              G FCFAFAGT SGLSIIGNIQQQGFRVV+D+A SR+GFA  GCA
Sbjct  460  NSGSFCFAFAGTASGLSIIGNIQQQGFRVVYDVATSRVGFAPRGCA  505



>gb|KDP28482.1| hypothetical protein JCGZ_14253 [Jatropha curcas]
Length=478

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+R+AFR GAS+LK + EFSLFDTCFDLSGKTEVKVPTV LHFRGADVSLPA+NYLIPVD
Sbjct  373  ALRNAFRVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTVALHFRGADVSLPASNYLIPVD  432

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            ++G FCFAFAGT SGLSIIGNIQQQGFRVV+DLAGSR+GFA  GC
Sbjct  433  SDGSFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAGSRVGFAPRGC  477



>ref|XP_004133810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=471

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK + EFSLFDTC+DLSGKT VKVPTVVLHFRGADVSLPA+NYLIPVD
Sbjct  366  ALRDAFRAGASSLKSAPEFSLFDTCYDLSGKTTVKVPTVVLHFRGADVSLPASNYLIPVD  425

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
              G+FCFAFAGTTSGLSIIGNIQQQGFRVV+DLA SR+GF+  GCA
Sbjct  426  GSGRFCFAFAGTTSGLSIIGNIQQQGFRVVYDLASSRVGFSPRGCA  471



>ref|XP_009613969.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=510

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RD+FR GA++LK + +FSLFDTCFDLSGKTEVKVPTVVLHF+GA+VSLPA+NYLIPVD
Sbjct  405  ALRDSFRMGAANLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFKGAEVSLPASNYLIPVD  464

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            ++G FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSRLGFA  GCA
Sbjct  465  SDGTFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRLGFAPRGCA  510



>gb|EYU32252.1| hypothetical protein MIMGU_mgv1a005685mg [Erythranthe guttata]
Length=474

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS+LK   +FSLFDTCFDLSGKTEVKVPTVV+HF GADVSLPA+NYLIPVD
Sbjct  369  ALRDAFRAGASNLKRGPDFSLFDTCFDLSGKTEVKVPTVVMHFTGADVSLPASNYLIPVD  428

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + GKFCFAFAGT SGLSIIGNIQQQGFRVVFDLA +R+GF A+GCA
Sbjct  429  SNGKFCFAFAGTMSGLSIIGNIQQQGFRVVFDLASNRVGFTANGCA  474



>gb|KGN56421.1| Aspartic proteinase nepenthesin-1 [Cucumis sativus]
Length=512

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK + EFSLFDTC+DLSGKT VKVPTVVLHFRGADVSLPA+NYLIPVD
Sbjct  407  ALRDAFRAGASSLKSAPEFSLFDTCYDLSGKTTVKVPTVVLHFRGADVSLPASNYLIPVD  466

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
              G+FCFAFAGTTSGLSIIGNIQQQGFRVV+DLA SR+GF+  GCA
Sbjct  467  GSGRFCFAFAGTTSGLSIIGNIQQQGFRVVYDLASSRVGFSPRGCA  512



>ref|XP_004306664.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=467

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            ++RDAFR GA  LK + EFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  362  SLRDAFRAGARSLKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPATNYLIPVD  421

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + G FCFAFAGTT GLSIIGNIQQQGFRVV+DLAG R+GFA  GCA
Sbjct  422  SSGTFCFAFAGTTGGLSIIGNIQQQGFRVVYDLAGKRVGFAPRGCA  467



>emb|CDP08669.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GAS+L+ + +FSLFDTCFDLSGKTEVKVPTVVLHF GADVSLPA+NYLIPVD
Sbjct  382  AMRDAFRAGASNLRRAPDFSLFDTCFDLSGKTEVKVPTVVLHFNGADVSLPASNYLIPVD  441

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
              G+FCFAFAGT SGLSIIGNIQQQGFRV FDLAGSR+GFA  GCA
Sbjct  442  GNGRFCFAFAGTISGLSIIGNIQQQGFRVSFDLAGSRVGFAPRGCA  487



>gb|AGV54495.1| aspartic proteinase nepenthesin-1-like protein [Phaseolus vulgaris]
Length=476

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK + EFSLFDTC+DLSG +EVKVPTVV+HFRGADVS PAANYLIPVD
Sbjct  371  ALRDAFRVGASHLKRAPEFSLFDTCYDLSGISEVKVPTVVMHFRGADVSFPAANYLIPVD  430

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
              G+FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSR+GFA  GCA
Sbjct  431  NSGRFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRVGFAPRGCA  476



>ref|XP_010095748.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB62168.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=491

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR G+ +LK + EFSLFDTC+DLSGKTEVKVPTVVLHFRGADVS PA NYLIPVD
Sbjct  386  ALRDAFRAGSVNLKRAPEFSLFDTCYDLSGKTEVKVPTVVLHFRGADVSFPATNYLIPVD  445

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + G FCFAFAGT SGLSIIGNIQQQGFRVV+DLAGSR+GFA  GCA
Sbjct  446  SSGTFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAGSRVGFAPRGCA  491



>ref|XP_003529886.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            ++RDAFR GAS LK + EFSLFDTC+DLSG +EVKVPTVVLHFRGADVSLPAANYL+PVD
Sbjct  368  SLRDAFRVGASHLKRAPEFSLFDTCYDLSGLSEVKVPTVVLHFRGADVSLPAANYLVPVD  427

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
              G FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSR+GFA  GCA
Sbjct  428  NSGSFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRVGFAPRGCA  473



>gb|AGV54447.1| aspartic proteinase nepenthesin-1 precursor [Phaseolus vulgaris]
Length=477

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK + EFSLFDTC+DLSG +EVKVPTVV+HFRGADVS PAANYLIPVD
Sbjct  372  ALRDAFRVGASHLKRAPEFSLFDTCYDLSGISEVKVPTVVMHFRGADVSFPAANYLIPVD  431

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
              G+FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSR+GFA  GCA
Sbjct  432  NSGRFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRVGFAPRGCA  477



>ref|XP_007135265.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
 gb|ESW07259.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
Length=477

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK + EFSLFDTC+DLSG +EVKVPTVV+HFRGADVS PAANYLIPVD
Sbjct  372  ALRDAFRVGASHLKRAPEFSLFDTCYDLSGISEVKVPTVVMHFRGADVSFPAANYLIPVD  431

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
              G+FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSR+GFA  GCA
Sbjct  432  NSGRFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRVGFAPRGCA  477



>gb|KFK42512.1| hypothetical protein AALP_AA1G003500 [Arabis alpina]
Length=477

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR G+  LK +++FSLFDTCFDLS + EVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  372  AMRDAFRVGSRTLKRATDFSLFDTCFDLSNQNEVKVPTVVLHFRGADVSLPATNYLIPVD  431

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T GKFCFAFAGT SGLSIIGNIQQQGFRVV+DLAGSR+GFA  GC
Sbjct  432  TNGKFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAGSRVGFAPRGC  476



>emb|CDX90023.1| BnaA10g00590D [Brassica napus]
Length=481

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GA  LK + ++SLFDTCFDLS + EVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  376  AMRDAFRVGAKSLKRAPDYSLFDTCFDLSHQNEVKVPTVVLHFRGADVSLPATNYLIPVD  435

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T GKFCFAFAGT SGLSIIGNIQQQGFRVV+DL GSR+GFA  GCA
Sbjct  436  TNGKFCFAFAGTMSGLSIIGNIQQQGFRVVYDLMGSRVGFAPRGCA  481



>ref|XP_003554768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=472

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK ++EFSLFDTCFDLSG TEVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  367  ALRDAFRVGASHLKRAAEFSLFDTCFDLSGLTEVKVPTVVLHFRGADVSLPATNYLIPVD  426

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
              G FCFAFAGT SGLSIIGNIQQQGFRV FDLAGSR+GFA  GC
Sbjct  427  NSGSFCFAFAGTMSGLSIIGNIQQQGFRVSFDLAGSRVGFAPRGC  471



>ref|XP_009119684.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=481

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GA  LK + ++SLFDTCFDLS + EVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  376  AMRDAFRVGAKSLKRAPDYSLFDTCFDLSHQNEVKVPTVVLHFRGADVSLPATNYLIPVD  435

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T GKFCFAFAGT SGLSIIGNIQQQGFRVV+DL GSR+GFA  GCA
Sbjct  436  TNGKFCFAFAGTMSGLSIIGNIQQQGFRVVYDLMGSRVGFAPRGCA  481



>ref|XP_006418409.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
 gb|ESQ36762.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
Length=486

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GA  LK + +FSLFDTCFDLS + EVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  381  AMRDAFRVGAKTLKRAPDFSLFDTCFDLSNQNEVKVPTVVLHFRGADVSLPATNYLIPVD  440

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + GKFCFAFAGT SGLSIIGNIQQQGFRVV+DL GSR+GFA  GCA
Sbjct  441  SNGKFCFAFAGTMSGLSIIGNIQQQGFRVVYDLTGSRVGFAPRGCA  486



>ref|XP_002320868.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE99183.1| aspartyl protease family protein [Populus trichocarpa]
Length=488

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAF  GAS+LK + EFSLFDTCFDLSGKTEVKVPTVVLHFRGADV LPA+NYLIPVD
Sbjct  383  ALRDAFLVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVPLPASNYLIPVD  442

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
              G FCFAFAGT SGLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  443  NSGSFCFAFAGTASGLSIIGNIQQQGFRVVYDLATSRVGFAPRGCA  488



>ref|XP_008351846.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR G S LK   +FSLFDTCFDLSGKTEVKVPTVVLHFR ADVSLPAANYLIPVD
Sbjct  381  ALRDAFRAGTSGLKRGPQFSLFDTCFDLSGKTEVKVPTVVLHFRNADVSLPAANYLIPVD  440

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + G FCFAFAGT  GLSIIGNIQQQGFRVV+DLAGSR+GF+  GCA
Sbjct  441  SSGSFCFAFAGTMGGLSIIGNIQQQGFRVVYDLAGSRVGFSPRGCA  486



>ref|XP_008343434.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR G S LK   +FSLFDTCFDLSGKTEVKVPTVVLHFR ADVSLPAANYLIPVD
Sbjct  381  ALRDAFRAGTSGLKRGPQFSLFDTCFDLSGKTEVKVPTVVLHFRNADVSLPAANYLIPVD  440

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + G FCFAFAGT  GLSIIGNIQQQGFRVV+DLAGSR+GF+  GCA
Sbjct  441  SSGSFCFAFAGTMGGLSIIGNIQQQGFRVVYDLAGSRVGFSPRGCA  486



>ref|XP_008376086.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=487

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR G S LK   EFSLFDTCFDLSGKTEVKVPTVVLHFR ADVSLPA NYLIPVD
Sbjct  382  ALRDAFRAGTSGLKRGPEFSLFDTCFDLSGKTEVKVPTVVLHFRNADVSLPATNYLIPVD  441

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + G FCFAFAGT  GLSIIGNIQQQGFRVV+DLAGSR+GF+  GCA
Sbjct  442  SSGSFCFAFAGTMGGLSIIGNIQQQGFRVVYDLAGSRVGFSPRGCA  487



>ref|XP_007147317.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
 gb|ESW19311.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
Length=534

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK +SEFSLFDTCFDLSG TEVKVPTVVLHFRGADVSLPA+NYLIPVD
Sbjct  429  ALRDAFRVGASRLKRASEFSLFDTCFDLSGLTEVKVPTVVLHFRGADVSLPASNYLIPVD  488

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
              G FCFAFAGT SGLSIIGNIQQQGFRV +DL GSR+GFA  GC
Sbjct  489  NSGSFCFAFAGTMSGLSIIGNIQQQGFRVSYDLGGSRVGFAPRGC  533



>ref|XP_007051537.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOX95694.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=488

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GAS+LK + +FSLFDTCFDLSGKT VKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  383  AMRDAFRIGASNLKGAPDFSLFDTCFDLSGKTSVKVPTVVLHFRGADVSLPATNYLIPVD  442

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
              G FCFAFAGT SGLSIIGNIQQQGFRV +DLAGSR+GF   GC
Sbjct  443  GSGTFCFAFAGTMSGLSIIGNIQQQGFRVSYDLAGSRIGFTPRGC  487



>emb|CDY15187.1| BnaC05g00660D [Brassica napus]
Length=481

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR  A  LK + ++SLFDTCFDLS + EVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  376  AMRDAFRVRARSLKRAPDYSLFDTCFDLSHQNEVKVPTVVLHFRGADVSLPATNYLIPVD  435

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T GKFCFAFAGT SGLSIIGNIQQQGFRVV+DL GSR+GFA  GCA
Sbjct  436  TNGKFCFAFAGTMSGLSIIGNIQQQGFRVVYDLMGSRVGFAPRGCA  481



>ref|XP_004494825.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=473

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK + EFSLFDTCFDLSG TEVKVPTVVLHFR +DVSLPA NYLIPVD
Sbjct  368  ALRDAFRVGASHLKRAPEFSLFDTCFDLSGLTEVKVPTVVLHFRDSDVSLPATNYLIPVD  427

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
              G FCFAFAGT SGLSIIGNIQQQGFRVV+DLAGSR+GFA  GC
Sbjct  428  NSGSFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAGSRVGFAPRGC  472



>ref|XP_003520873.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=461

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK + EFSLFDTCFDLSG TEVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  356  ALRDAFRIGASHLKRAPEFSLFDTCFDLSGLTEVKVPTVVLHFRGADVSLPATNYLIPVD  415

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
              G FCFAFAGT SGLSIIGNIQQQGFR+ +DL GSR+GFA  GC
Sbjct  416  NSGSFCFAFAGTMSGLSIIGNIQQQGFRISYDLTGSRVGFAPRGC  460



>ref|NP_171637.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAF97328.1|AC023628_9 Unknown protein [Arabidopsis thaliana]
 gb|AAM91547.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
 gb|AAP31963.1| At1g01300 [Arabidopsis thaliana]
 gb|AEE27268.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=485

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GA  LK + +FSLFDTCFDLS   EVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  380  AMRDAFRVGAKTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVD  439

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  440  TNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLASSRVGFAPGGCA  485



>ref|XP_002892074.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68333.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=485

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GA  LK + +FSLFDTCFDLS   EVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  380  AMRDAFRVGAKALKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVD  439

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  440  TNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLASSRVGFAPGGCA  485



>ref|XP_006307379.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
 gb|EOA40277.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
Length=481

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GA  LK + +FSLFDTCFDLS   EVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  376  AMRDAFRVGARTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVD  435

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  436  TNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLATSRVGFAPRGCA  481



>ref|XP_010457141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=485

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GA  LK + +FSLFDTCFDLS   EVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  380  AMRDAFRVGARTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVD  439

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  440  TNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLATSRVGFAPRGCA  485



>ref|XP_010474721.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=484

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GA  LK + +FSLFDTCFDLS   EVKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  379  AMRDAFRVGARTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVD  438

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  439  TNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLATSRVGFAPRGCA  484



>ref|XP_009336767.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=485

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR G S LK   +FSLFDTCFDLSG+TEVKVPTVVLHFR ADVSLPA NYLIPVD
Sbjct  380  ALRDAFRAGTSGLKRGPQFSLFDTCFDLSGRTEVKVPTVVLHFRNADVSLPATNYLIPVD  439

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + G FCFAFAGT  GLSIIGNIQQQGFRVV+DLAGSR+GF+  GCA
Sbjct  440  SSGSFCFAFAGTMGGLSIIGNIQQQGFRVVYDLAGSRVGFSPRGCA  485



>ref|XP_007217966.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
 gb|EMJ19165.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
Length=468

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            ++RDAFR G S LK + EFSLFDTCFDLSGK+EVKVPTVVLHFR ADVSLPA NYLIPVD
Sbjct  363  SLRDAFRAGTSGLKRAPEFSLFDTCFDLSGKSEVKVPTVVLHFRNADVSLPATNYLIPVD  422

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + G FCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  423  SSGSFCFAFAGTMGGLSIIGNIQQQGFRVVYDLASSRVGFAPRGCA  468



>ref|XP_004248083.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=458

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA DLK +  FSLFDTC+DLSGK + KVPT+VLHF GADV+LPAANY+IPV+
Sbjct  352  AVRDAFRLGAKDLKRAPNFSLFDTCYDLSGKKQAKVPTMVLHFAGADVALPAANYMIPVN  411

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            TEG++CF FAGT  GLSIIGNIQQQGFRVVFDLAGSRLGFA  GC+
Sbjct  412  TEGRYCFGFAGTNGGLSIIGNIQQQGFRVVFDLAGSRLGFAPRGCS  457



>gb|KJB09627.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=416

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A RDAFR GA+ LK + +FSLFDTCFDLSG+T VKVPT+VLHFRGAD+SLPA NYLIPVD
Sbjct  311  ATRDAFRLGATHLKRAPDFSLFDTCFDLSGQTSVKVPTLVLHFRGADLSLPATNYLIPVD  370

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + G FCFAFAGT +GLSIIGNIQQQGFRV +DLAGSR+GF+  GCA
Sbjct  371  SSGTFCFAFAGTMNGLSIIGNIQQQGFRVAYDLAGSRVGFSPRGCA  416



>ref|XP_010480432.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=488

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GA  LK + +FSLFDTCFDLS   EVKVPTVVLHFR ADVSLPA NYLIPVD
Sbjct  383  AMRDAFRVGARTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLHFREADVSLPATNYLIPVD  442

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  443  TNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLATSRVGFAPRGCA  488



>ref|XP_004139658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004154449.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN44550.1| hypothetical protein Csa_7G329350 [Cucumis sativus]
Length=453

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA  LK   EFSLFDTC+DLSG++ VKVPTVVLHFRGAD++LPA NYLIPVD
Sbjct  348  ALRDAFRVGARHLKRGPEFSLFDTCYDLSGQSSVKVPTVVLHFRGADMALPATNYLIPVD  407

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
              G FCFAFAGT SGLSIIGNIQQQGFRVV+DLAGSR+GFA  GC
Sbjct  408  ENGSFCFAFAGTISGLSIIGNIQQQGFRVVYDLAGSRIGFAPRGC  452



>gb|AAM66061.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
Length=485

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GA  LK +  FSLFDTCFDLS   EVKVPTVVLHFR ADVSLPA NYLIPVD
Sbjct  380  AMRDAFRVGAKTLKRAPNFSLFDTCFDLSNMNEVKVPTVVLHFRRADVSLPATNYLIPVD  439

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA  GCA
Sbjct  440  TNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLASSRVGFAPGGCA  485



>ref|XP_008461984.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=517

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA  LK   EFSLFDTC+DLSG++ VKVPTVVLHFRGAD+ LPA NYLIPVD
Sbjct  412  ALRDAFRAGARHLKRGPEFSLFDTCYDLSGQSSVKVPTVVLHFRGADMPLPATNYLIPVD  471

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
              G FCFAFAGT SGLSIIGNIQQQGFRVV+DLAGSR+GFA  GC
Sbjct  472  ENGSFCFAFAGTISGLSIIGNIQQQGFRVVYDLAGSRIGFAPRGC  516



>gb|EPS66029.1| hypothetical protein M569_08742 [Genlisea aurea]
Length=464

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA  L  + +FSLFDTC+DLSGKTEVKVPTVVLHF GADVSLPA+NYLIPVD
Sbjct  357  ALRDAFRIGAYHLNRAPDFSLFDTCYDLSGKTEVKVPTVVLHFEGADVSLPASNYLIPVD  416

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T G+FCFAFAGT SGLSIIGNIQQQGFRV FDLA +R+GFA  GC
Sbjct  417  TSGRFCFAFAGTMSGLSIIGNIQQQGFRVSFDLASNRVGFAPRGC  461



>gb|KEH24641.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=485

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA+ LK + EFSLFDTCFDLSG TEVKVPT+VLHF+GADVSLPA NYLIPVD
Sbjct  380  ALRDAFRLGATHLKKAPEFSLFDTCFDLSGLTEVKVPTLVLHFQGADVSLPAQNYLIPVD  439

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
              G FCFAFAGT SGLSIIGNIQQQGFRV +DLA SR+GFA  GC
Sbjct  440  NSGSFCFAFAGTMSGLSIIGNIQQQGFRVSYDLATSRVGFAPKGC  484



>gb|KJB09626.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=488

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A RDAFR GA+ LK + +FSLFDTCFDLSG+T VKVPT+VLHFRGAD+SLPA NYLIPVD
Sbjct  383  ATRDAFRLGATHLKRAPDFSLFDTCFDLSGQTSVKVPTLVLHFRGADLSLPATNYLIPVD  442

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + G FCFAFAGT +GLSIIGNIQQQGFRV +DLAGSR+GF+  GCA
Sbjct  443  SSGTFCFAFAGTMNGLSIIGNIQQQGFRVAYDLAGSRVGFSPRGCA  488



>ref|XP_006362137.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=461

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA DLK +  FSLFDTC+DLSGKT+ KVPT+VLHF GADV+LPAANY+IPV+
Sbjct  355  AVRDAFRLGAKDLKRAPNFSLFDTCYDLSGKTQAKVPTLVLHFAGADVALPAANYMIPVN  414

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
             EG++C  FAGT  GLSIIGNIQQQGFRVVFDLAGSRLGFA  GC+
Sbjct  415  GEGRYCLGFAGTNGGLSIIGNIQQQGFRVVFDLAGSRLGFAPRGCS  460



>ref|XP_009600181.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAF  G  +LK +  +SLFDTC+DLSGKTEVKVPT+VLHF+ ADV+LPA+NYLIPV 
Sbjct  369  ALRDAFSLGTKNLKRAPNYSLFDTCYDLSGKTEVKVPTLVLHFKDADVALPASNYLIPVS  428

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +EG+FCF FAGT SGLSIIGNIQQQGFRVVFDLAGSRLGFA  GC
Sbjct  429  SEGRFCFGFAGTASGLSIIGNIQQQGFRVVFDLAGSRLGFAPRGC  473



>gb|KJB49569.1| hypothetical protein B456_008G125700 [Gossypium raimondii]
Length=488

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+R+AFR G+S+LK +  FSLFDTC+D SGKT VKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  383  ALRNAFRLGSSNLKRAPAFSLFDTCYDFSGKTSVKVPTVVLHFRGADVSLPATNYLIPVD  442

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            + G FCFAFAGT SGLSIIGNIQQQGF V +DLAGSR+GF  +GCA
Sbjct  443  SSGTFCFAFAGTMSGLSIIGNIQQQGFLVAYDLAGSRIGFKPNGCA  488



>ref|XP_007051536.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX95693.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=557

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            AMRDAFR GAS+LK + +FSLFDTCFDLSGKT VKVPTVVLHFRGADVSLPA NYLIPVD
Sbjct  383  AMRDAFRIGASNLKGAPDFSLFDTCFDLSGKTSVKVPTVVLHFRGADVSLPATNYLIPVD  442

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  289
              G FCFAFAGT SGLSIIGNIQQQGFRV +DLAGSR+G
Sbjct  443  GSGTFCFAFAGTMSGLSIIGNIQQQGFRVSYDLAGSRIG  481



>ref|XP_010665756.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Beta 
vulgaris subsp. vulgaris]
Length=484

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA+ LK +  FSLFDTC+DLSGKTEV+VPTVV+H+ GADV+LPA NYLIPVD
Sbjct  379  ALRDAFRAGATSLKSAPGFSLFDTCYDLSGKTEVRVPTVVMHYNGADVALPANNYLIPVD  438

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            T G+FCFAFAGT SGLSIIGNIQQQGFRV+FD+A +R+GF+ + C 
Sbjct  439  TSGRFCFAFAGTMSGLSIIGNIQQQGFRVLFDVASNRVGFSPNACT  484



>ref|XP_009800816.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=474

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR G  +LK +  +SLFDTC+DLSGKTEVKVPT+VLHF+ AD++LPA+NYLIPV 
Sbjct  369  ALRDAFRLGTKNLKRAPNYSLFDTCYDLSGKTEVKVPTLVLHFKDADLALPASNYLIPVS  428

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +  +FCF FAGT SGLSIIGNIQQQGFRVVFD+AGSRLGFA  GC
Sbjct  429  SGRRFCFGFAGTASGLSIIGNIQQQGFRVVFDVAGSRLGFAPRGC  473



>ref|XP_010544842.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Tarenaya 
hassleriana]
Length=510

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK +  +SLFDTCFDLSG T VKVPTVV HF G DVSLPA NYLIPVD
Sbjct  406  ALRDAFRAGASRLKRAPAYSLFDTCFDLSGMTTVKVPTVVFHFSGGDVSLPATNYLIPVD  465

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            ++G+FCFAFAGT  GLSI GNIQQQ FRVV+DL GSR+GFA  GC
Sbjct  466  SKGRFCFAFAGTMGGLSIFGNIQQQSFRVVYDLIGSRVGFAPRGC  510



>gb|ADJ67210.1| aspartic proteinase nepenthesin-1 precursor [Jatropha curcas]
Length=84

 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  519  DTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNI  340
            DTCFDLSGKTEVKVPTV LHFRGADVSLPA+NYLIPVD++G FCFAFAGT SGLSIIGNI
Sbjct  1    DTCFDLSGKTEVKVPTVALHFRGADVSLPASNYLIPVDSDGSFCFAFAGTMSGLSIIGNI  60

Query  339  QQQGFRVVFDLAGSRLGFAASGC  271
            QQQGFRVV+DLAGSR+GFA  GC
Sbjct  61   QQQGFRVVYDLAGSRVGFAPRGC  83



>gb|ADJ67200.1| aspartic proteinase nepenthesin-1 precursor [Jatropha curcas]
Length=84

 Score =   152 bits (384),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  519  DTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNI  340
            DTCFDLSGKTEVKVPTV LHFRG DVSLPA+NYLIPVD++G FCFAFAGT SGLSIIGNI
Sbjct  1    DTCFDLSGKTEVKVPTVALHFRGVDVSLPASNYLIPVDSDGSFCFAFAGTMSGLSIIGNI  60

Query  339  QQQGFRVVFDLAGSRLGFAASGC  271
            QQQGFRVV+DLAGSR+GFA  GC
Sbjct  61   QQQGFRVVYDLAGSRVGFAPRGC  83



>ref|XP_002878415.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54674.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA+ LK +  +SLFDTCFDLSG T VKVPTVV HF G +VSLPA+NYLIPV+
Sbjct  382  ALRDAFRLGATKLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFGGGEVSLPASNYLIPVN  441

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            TEG+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  442  TEGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRVGFLSRAC  486



>ref|NP_191741.1| aspartyl protease [Arabidopsis thaliana]
 emb|CAB71112.1| putative protein [Arabidopsis thaliana]
 gb|AEE80260.1| aspartyl protease [Arabidopsis thaliana]
Length=483

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA+ LK +  +SLFDTCFDLSG T VKVPTVV HF G +VSLPA+NYLIPV+
Sbjct  379  ALRDAFRLGATKLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFGGGEVSLPASNYLIPVN  438

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            TEG+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  439  TEGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRVGFLSRAC  483



>ref|XP_010512555.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA  LK +  +SLFDTCFDLSG T VKVPTVV HF G +VSLPA+NYLIPV+
Sbjct  379  ALRDAFRLGARSLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFGGGEVSLPASNYLIPVN  438

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  439  TQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRIGFLSRAC  483



>ref|XP_010469025.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=486

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA  LK +  +SLFDTCFDLSG T VKVPTVV HF G +VSLPA+NYLIPV+
Sbjct  382  ALRDAFRLGARSLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFGGGEVSLPASNYLIPVN  441

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  442  TQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRIGFLSRAC  486



>ref|XP_006402438.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
 dbj|BAJ34045.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43891.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
Length=484

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA+ LK +  +SLFDTCFDLSG T VKVPTVV HF G +VSLPA+NYLIPV+
Sbjct  380  ALRDAFRLGATRLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFTGGEVSLPASNYLIPVN  439

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
             +G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  440  NQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRVGFLSRAC  484



>gb|KFK35370.1| hypothetical protein AALP_AA5G276300 [Arabis alpina]
Length=485

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GAS LK +  +SLFDTC+DL G T VKVPTVV HF G +VSLPA+NYLIPV+
Sbjct  381  ALRDAFRLGASKLKRAPSYSLFDTCYDLIGMTTVKVPTVVFHFGGGEVSLPASNYLIPVN  440

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  441  TQGRFCFAFAGTIGSLSIIGNIQQQGFRVAYDLVGSRVGFLSRAC  485



>ref|XP_010413342.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=488

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA+ LK +  +SLFDTCFDLSG   VKVPTVV HF G +VSLPA+NYLIPV+
Sbjct  384  ALRDAFRLGATSLKRAPPYSLFDTCFDLSGMKTVKVPTVVFHFGGGEVSLPASNYLIPVN  443

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  444  TQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRIGFLSRAC  488



>ref|XP_009138753.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=483

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA  LK +  +SLFDTCFDLSG + VKVPTVV HF G +VSLPA+NYLIPV+
Sbjct  379  ALRDAFRLGAKRLKRAPSYSLFDTCFDLSGMSTVKVPTVVFHFGGGEVSLPASNYLIPVN  438

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF    C
Sbjct  439  TQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLTGSRVGFLPRAC  483



>emb|CDX89133.1| BnaA04g00530D [Brassica napus]
Length=483

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR GA  LK +  +SLFDTCFDLSG + VKVPTVV HF G +VSLPA+NYLIPV+
Sbjct  379  ALRDAFRLGAKRLKRAPSYSLFDTCFDLSGMSTVKVPTVVFHFGGGEVSLPASNYLIPVN  438

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF    C
Sbjct  439  TQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLTGSRVGFLPRAC  483



>ref|XP_009104352.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=485

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A RDAF  GA+ LK +  +SLFDTCFDLSG T VKVPTVV HF G DVSLPA+NYLIPV+
Sbjct  381  AFRDAFLLGATRLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFSGGDVSLPASNYLIPVN  440

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            ++G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  441  SQGRFCFAFAGTMGNLSIIGNIQQQGFRVAYDLVGSRVGFMSGAC  485



>emb|CDX67868.1| BnaA07g19080D [Brassica napus]
Length=485

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A RDAF  GA+ LK +  +SLFDTCFDLSG T VKVPTVV HF G DVSLPA+NYLIPV+
Sbjct  381  AFRDAFLLGATRLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFSGGDVSLPASNYLIPVN  440

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            ++G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  441  SQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRVGFMSGAC  485



>emb|CDY25081.1| BnaC06g18230D [Brassica napus]
Length=485

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A RDAF  GA+ LK +  +SLFDTCFDLSG T VKVPTVV HF G DVSLPA+NYLIPV+
Sbjct  381  AFRDAFLLGATRLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHFSGGDVSLPASNYLIPVN  440

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T+G+FCFAFA T   LSIIGNIQQQGFRV +DL GSR+GF +  C
Sbjct  441  TQGRFCFAFASTMGSLSIIGNIQQQGFRVAYDLVGSRVGFMSGAC  485



>ref|XP_010918360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=507

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 90/107 (84%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            AMRDAF+ GA+DL+ +   FSLFDTC++L+GKTEVKVPTVV+H  G A VSLPA NYLIP
Sbjct  401  AMRDAFKAGAADLREAPGGFSLFDTCYNLAGKTEVKVPTVVMHLGGGASVSLPAENYLIP  460

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VDT+G FCFAFAGT SG+SIIGNIQQQGFRVVFD A SR+GF   GC
Sbjct  461  VDTKGTFCFAFAGTDSGVSIIGNIQQQGFRVVFDGARSRVGFMPRGC  507



>emb|CDY43952.1| BnaC04g21580D [Brassica napus]
Length=483

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAFR  A  LK +  +SLFDTCFDLSG + VKVPTVV HF G +VSLPA+NYLIPV+
Sbjct  379  ALRDAFRLAAKRLKRAPSYSLFDTCFDLSGMSTVKVPTVVFHFGGGEVSLPASNYLIPVN  438

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF    C
Sbjct  439  TQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLTGSRVGFLPRAC  483



>ref|XP_009394177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=499

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLK-PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAF+ G S LK     FSLFDTC+DLSG+TEVKVPTVVLH  G A VSLPA NYLIP
Sbjct  393  ALRDAFKAGVSGLKLAPGGFSLFDTCYDLSGRTEVKVPTVVLHLAGGAAVSLPAENYLIP  452

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VDT+G FCFAFAGT SG+SIIGNIQQQGFRVVFD   SR+GF   GC
Sbjct  453  VDTKGTFCFAFAGTDSGVSIIGNIQQQGFRVVFDAEKSRVGFMPRGC  499



>ref|XP_008795461.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=343

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAF+ GA++L+ +   FSLFDTC+DL+GKTEVKVPTVV+H  G A V+LPA NYLIP
Sbjct  237  ALRDAFKAGAAELREAPGGFSLFDTCYDLAGKTEVKVPTVVMHLGGGASVALPAENYLIP  296

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VDT+G FCFAFA T +G+SIIGNIQQQGFRVVFD+A SR+GF   GC
Sbjct  297  VDTKGTFCFAFAETDNGVSIIGNIQQQGFRVVFDVARSRVGFLPRGC  343



>ref|XP_010266550.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=484

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 94/107 (88%), Gaps = 1/107 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPV  409
            A+RDAFR GA  LK +  FSLFDTC+DLSGKT VKVPTVV+HFRG AD+SLPAANYLIPV
Sbjct  378  ALRDAFRAGAIQLKRAEGFSLFDTCYDLSGKTVVKVPTVVMHFRGGADLSLPAANYLIPV  437

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
            D+ G FCFAFAGTTSGLSI+GNIQQQGFRVVFD A SR+GFAA GCA
Sbjct  438  DSNGIFCFAFAGTTSGLSIVGNIQQQGFRVVFDGASSRIGFAAHGCA  484



>ref|XP_010924503.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=508

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAF+ GA++L+ +   FSLFDTC++L+GKTEVKVPTVV+H  G A V LPA NYLIP
Sbjct  402  ALRDAFKAGAAELREAPGGFSLFDTCYNLAGKTEVKVPTVVMHLGGGASVPLPAENYLIP  461

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VDT+G FCFAFAGT SG+SIIGNIQQQGFRVVFD A SR+GF   GC
Sbjct  462  VDTKGTFCFAFAGTESGVSIIGNIQQQGFRVVFDGARSRVGFLPRGC  508



>ref|XP_008799615.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=504

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            AMRDAF+  A++L+ +   FSLFDTC++L+G+T+VKVPTVV+H  G A VSLPA NYLIP
Sbjct  398  AMRDAFKAAAAELREAPGGFSLFDTCYNLAGRTQVKVPTVVMHLGGGAAVSLPAENYLIP  457

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VDT+G FCFAFAGT SG+SIIGNIQQQGFRVVFD A SR+GF   GC
Sbjct  458  VDTKGTFCFAFAGTDSGVSIIGNIQQQGFRVVFDGAQSRVGFMPLGC  504



>gb|ABK24467.1| unknown [Picea sitchensis]
Length=497

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVD  406
            MRDAFR G  +LK +  FSLFDTC+DLSG   VKVPT+V HF+G A +SLPA NYLIPVD
Sbjct  391  MRDAFRVGTGNLKSAGGFSLFDTCYDLSGLKTVKVPTLVFHFQGGAHISLPATNYLIPVD  450

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +   FCFAFAG T GLSIIGNIQQQG+RVVFD   +R+GF A  C
Sbjct  451  SSATFCFAFAGNTGGLSIIGNIQQQGYRVVFDSLANRVGFKAGSC  495



>ref|XP_006852628.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
 gb|ERN14095.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
Length=489

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVD  406
            +RDAFR GA+ L  +  FSLFDTC++L G+  VKVPT+V HF G AD+SLPA+NYLIPV+
Sbjct  384  VRDAFRAGATGLPLADSFSLFDTCYNLGGRDVVKVPTMVFHFDGGADLSLPASNYLIPVN  443

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGCA  268
             +G FCFAFAGT SGLSIIGNIQQQGF VVFD   SR+GF   GCA
Sbjct  444  NQGVFCFAFAGTRSGLSIIGNIQQQGFSVVFDGKNSRIGFVPKGCA  489



>ref|XP_004969076.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=493

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 84/107 (79%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAFR  A+ L+ S S FSLFDTC+DL G+  VKVPTV +HF G A+ +LP  NYLIP
Sbjct  387  ALRDAFRGAAAGLRLSPSGFSLFDTCYDLGGRKVVKVPTVSMHFAGGAEAALPPENYLIP  446

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD++G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G R+GFA  GC
Sbjct  447  VDSKGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQRVGFAPKGC  493



>ref|XP_003637416.1| Aspartic proteinase nepenthesin-2, partial [Medicago truncatula]
Length=165

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
             +RDAF KG  DL  ++E SLFDTC+DLS KT V+VPTV  HF  G  + LPA NYL+PV
Sbjct  60   VVRDAFVKGTKDLLATNEVSLFDTCYDLSSKTSVEVPTVAFHFGEGKVLVLPAKNYLVPV  119

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T S LSIIGNIQQQG RV FDLA S +GF+ + C
Sbjct  120  DSVGTFCFAFAPTMSSLSIIGNIQQQGTRVSFDLANSLVGFSPNRC  165



>ref|XP_003569303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brachypodium 
distachyon]
Length=494

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 83/107 (78%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAFR  A+ L+ S   FSLFDTC+DLSG+  VKVPTV +HF G A+ +LP  NYLIP
Sbjct  388  ALRDAFRAAAAGLRLSPGGFSLFDTCYDLSGRKVVKVPTVSMHFAGGAEAALPPENYLIP  447

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD++G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G R+GF   GC
Sbjct  448  VDSKGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQRVGFVPKGC  494



>ref|XP_001757102.1| predicted protein [Physcomitrella patens]
 gb|EDQ77961.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 81/106 (76%), Gaps = 2/106 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPV  409
            ++RDAFR G SDL P++ FSLFDTC+DLSG   V VPTV LHF+ G D+ LPA+NYLIPV
Sbjct  301  SLRDAFRAGTSDLAPTAGFSLFDTCYDLSGLASVDVPTVTLHFQGGTDLKLPASNYLIPV  360

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D    FC AFAGTT G SIIGNIQQQGFRV++D   +++GF  S C
Sbjct  361  DNSNTFCLAFAGTT-GPSIIGNIQQQGFRVIYDNLHNQVGFVPSQC  405



>ref|XP_002455897.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
 gb|EES01017.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
Length=493

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAFR  A+ L+ S   FSLFDTC+DL G+  VKVPTV +HF G A+ +LP  NYLIP
Sbjct  387  ALRDAFRAAAAGLRLSPGGFSLFDTCYDLGGRKVVKVPTVSMHFAGGAEAALPPENYLIP  446

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD+ G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G R+GFA  GC
Sbjct  447  VDSRGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQRVGFAPKGC  493



>ref|NP_001043485.1| Os01g0598600 [Oryza sativa Japonica Group]
 dbj|BAB63755.1| nucleoid DNA-binding protein cnd41-like [Oryza sativa Japonica 
Group]
 dbj|BAF05399.1| Os01g0598600 [Oryza sativa Japonica Group]
 gb|EAY74816.1| hypothetical protein OsI_02707 [Oryza sativa Indica Group]
Length=500

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAFR  A+ L+ S   FSLFDTC+DLSG   VKVPTV +HF G A+ +LP  NYLIP
Sbjct  394  ALRDAFRAAAAGLRLSPGGFSLFDTCYDLSGLKVVKVPTVSMHFAGGAEAALPPENYLIP  453

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD+ G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G RLGF   GC
Sbjct  454  VDSRGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQRLGFVPKGC  500



>gb|EMS49734.1| Aspartic proteinase nepenthesin-1 [Triticum urartu]
Length=352

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAFR  A+ L+ S   FSLFDTC+DLSG+  VKVPTV +HF G A+ +LP  NYLIP
Sbjct  246  ALRDAFRGAAAGLRLSPGGFSLFDTCYDLSGRKVVKVPTVSMHFAGGAEAALPPENYLIP  305

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD++G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G R+ F   GC
Sbjct  306  VDSKGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQRVAFVPKGC  352



>ref|NP_001183392.1| uncharacterized protein LOC100501808 [Zea mays]
 gb|ACR36629.1| unknown [Zea mays]
Length=342

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = -1

Query  585  AMRDAFRKGASD---LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYL  418
            A+RDAFR  A+    L P   FSLFDTC+DL G+  VKVPTV +HF G A+ +LP  NYL
Sbjct  235  ALRDAFRAAAAGGLRLSPGG-FSLFDTCYDLGGRRVVKVPTVSMHFAGGAEAALPPENYL  293

Query  417  IPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            IPVD+ G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G R+GFA  GC
Sbjct  294  IPVDSRGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQRVGFAPKGC  342



>gb|EPS61272.1| hypothetical protein M569_13524, partial [Genlisea aurea]
Length=489

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            +MRDAF+KG +DL P++  SLFDTC+DLS +  V+VPTV  HF  G +V LPA NY+IPV
Sbjct  384  SMRDAFKKGTADLPPANAVSLFDTCYDLSSRKSVEVPTVSFHFSNGKEVKLPAKNYMIPV  443

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S L IIGN+QQQG RV +DLA S +GF+ + C
Sbjct  444  DSSGTFCFAFAPTSSSLGIIGNVQQQGTRVSYDLANSLVGFSPNKC  489



>dbj|BAJ86414.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92334.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAFR  A+ L+ S   FSLFDTC+DLSG+  VKVPTV +HF G A+ +LP  NYLIP
Sbjct  386  ALRDAFRGAAAGLRLSPGGFSLFDTCYDLSGRKVVKVPTVSMHFAGGAEAALPPENYLIP  445

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD++G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G R+ F   GC
Sbjct  446  VDSKGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQRVAFTPKGC  492



>emb|CDM83204.1| unnamed protein product [Triticum aestivum]
Length=492

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAFR  A+ L+ S   FSLFDTC+DLSG+  VKVPTV +HF G A+ +LP  NYLIP
Sbjct  386  ALRDAFRGAAAGLRLSPGGFSLFDTCYDLSGRKVVKVPTVSMHFAGGAEAALPPENYLIP  445

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD++G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G R+ F   GC
Sbjct  446  VDSKGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQRVAFVPKGC  492



>ref|XP_002529147.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF33260.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=479

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            A+RDAF KG  DL  +SE +LFDTC+DLS KT V+VPTV  H  G  V  LPA NYLIPV
Sbjct  374  ALRDAFVKGTKDLPVTSEVALFDTCYDLSRKTSVEVPTVTFHLAGGKVLPLPATNYLIPV  433

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D++G FCFAFA T+S LSIIGN+QQQG RV FDLA S +GF    C
Sbjct  434  DSDGTFCFAFAPTSSALSIIGNVQQQGTRVGFDLANSLVGFEPRQC  479



>tpg|DAA58835.1| TPA: hypothetical protein ZEAMMB73_701358 [Zea mays]
Length=485

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = -1

Query  585  AMRDAFRKGASD---LKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYL  418
            A+RDAFR  A+    L P   FSLFDTC+DL G+  VKVPTV +HF G A+ +LP  NYL
Sbjct  378  ALRDAFRAAAAGGLRLSPGG-FSLFDTCYDLGGRRVVKVPTVSMHFAGGAEAALPPENYL  436

Query  417  IPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            IPVD+ G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G R+GFA  GC
Sbjct  437  IPVDSRGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQRVGFAPKGC  485



>ref|XP_008374731.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
Length=487

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            ++RDAF++  SDL  +S F+LFDTC+DLS +T V+VPTV   F G   +SLPA NYLIPV
Sbjct  382  SLRDAFKRFTSDLPTASSFALFDTCYDLSSRTRVQVPTVAFQFSGGKSLSLPAKNYLIPV  441

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV +DLA  R+GF+ + C
Sbjct  442  DSAGTFCFAFAPTSSSLSIIGNVQQQGIRVSYDLANKRVGFSPNKC  487



>gb|KHN27179.1| Aspartic proteinase nepenthesin-1, partial [Glycine soja]
Length=131

 Score =   129 bits (324),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAF KGA  +  ++  SLFDTC+DLS +  V+VPTV  HF  G ++ LPA NYLIPV
Sbjct  26   ALRDAFVKGAKGIPKANGVSLFDTCYDLSSRESVQVPTVSFHFPEGRELPLPARNYLIPV  85

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA TTS LSI+GN+QQQG RV FD+A S +GF+A  C
Sbjct  86   DSVGTFCFAFAPTTSSLSIMGNVQQQGTRVGFDIANSLVGFSADSC  131



>gb|KJB09628.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=446

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -1

Query  501  SGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFR  322
            SG+T VKVPT+VLHFRGAD+SLPA NYLIPVD+ G FCFAFAGT +GLSIIGNIQQQGFR
Sbjct  369  SGQTSVKVPTLVLHFRGADLSLPATNYLIPVDSSGTFCFAFAGTMNGLSIIGNIQQQGFR  428

Query  321  VVFDLAGSRLGFAASGCA  268
            V +DLAGSR+GF+  GCA
Sbjct  429  VAYDLAGSRVGFSPRGCA  446



>ref|XP_006374138.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
 gb|ABK94105.1| unknown [Populus trichocarpa]
 gb|ERP51935.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
Length=499

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 80/105 (76%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVD  406
            +RDAF +   +LK +S  +LFDTC+DLSG+  V+VPTV  HF  G   +LPAANYLIPVD
Sbjct  394  LRDAFVRMTQNLKLTSAVALFDTCYDLSGQASVRVPTVSFHFADGKSWNLPAANYLIPVD  453

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            + G +CFAFA TTS LSIIGN+QQQG RV FDLA +R+GF+ + C
Sbjct  454  SAGTYCFAFAPTTSSLSIIGNVQQQGTRVTFDLANNRMGFSPNKC  498



>ref|XP_009346910.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            ++RDAF++   DL  +S F+LFDTC+DLS +T V+VPTV   F G   +SLPA NYLIPV
Sbjct  382  SLRDAFKRYTRDLPTASSFALFDTCYDLSSRTRVQVPTVAFQFSGGKSLSLPAKNYLIPV  441

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV +DLA  R+GF+ + C
Sbjct  442  DSAGTFCFAFAPTSSSLSIIGNVQQQGTRVSYDLANKRVGFSPNKC  487



>ref|XP_007036465.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY20966.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=491

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVD  406
            A+RDAF K   DL  +S  +LFDTC+DLS +T V+VPTV  HF G  + LPA NYLIPVD
Sbjct  387  ALRDAFVKLTHDLPTASGVALFDTCYDLSSRTSVRVPTVAFHFGGQSLDLPAKNYLIPVD  446

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            + G FCFAFA T+S LSIIGN+QQQG RV FDLA +++GF+   C
Sbjct  447  SSGVFCFAFAPTSSSLSIIGNVQQQGTRVSFDLANNKVGFSPRKC  491



>gb|KEH44258.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=467

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 78/105 (74%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVD  406
            +RDAF KG  DL  ++E SLFDTC+DLS KT V+VPTV  HF  G  + LPA NYL+PVD
Sbjct  363  VRDAFVKGTKDLLATNEVSLFDTCYDLSSKTSVEVPTVAFHFGEGKVLVLPAKNYLVPVD  422

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            + G FCFAFA T S LSIIGNIQQQG RV FDLA S +GF+ + C
Sbjct  423  SVGTFCFAFAPTMSSLSIIGNIQQQGTRVSFDLANSLVGFSPNRC  467



>ref|XP_001759252.1| predicted protein [Physcomitrella patens]
 gb|EDQ75936.1| predicted protein [Physcomitrella patens]
Length=385

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 2/106 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPV  409
            ++R+AFR G SDL  ++EFSLFDTC++LS  + V VPTV LHF+ GAD+ LPA+NYL+PV
Sbjct  280  SLREAFRAGTSDLVLTTEFSLFDTCYNLSDLSSVDVPTVTLHFQGGADLKLPASNYLVPV  339

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D    FC AFAGTT G SIIGNIQQQGFRV++D   +++GF  S C
Sbjct  340  DNSSTFCLAFAGTT-GPSIIGNIQQQGFRVIYDNLHNQVGFVPSQC  384



>gb|KDP20100.1| hypothetical protein JCGZ_05869 [Jatropha curcas]
Length=493

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            ++RDAF      LK +S  +LFDTC+DLSG+  VKVPTV  HF +G   +LPA NYLIPV
Sbjct  388  SLRDAFVSMTQHLKSTSGVALFDTCYDLSGQNSVKVPTVSFHFSQGQSWNLPAMNYLIPV  447

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D++G +CFAFA TTS LSIIGN+QQQG RV FDLA +R+GF+   C
Sbjct  448  DSDGTYCFAFAPTTSSLSIIGNVQQQGTRVSFDLANNRVGFSTDKC  493



>gb|ABK24255.1| unknown [Picea sitchensis]
 gb|ABR16185.1| unknown [Picea sitchensis]
Length=485

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            ++RDAFR G  +L  +   SLFDTC+DLS K  V VPTVV HF G   +SLPA NYL+PV
Sbjct  380  SLRDAFRAGTKNLPSTDGVSLFDTCYDLSSKESVDVPTVVFHFSGGGSMSLPAKNYLVPV  439

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSI+GNIQQQG RV FD A +++GFA + C
Sbjct  440  DSMGTFCFAFAPTSSSLSIVGNIQQQGIRVSFDRANNQVGFAVNKC  485



>emb|CDY24395.1| BnaCnng04620D [Brassica napus]
Length=482

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RDAF KG +DL+ ++  ++FDTC+DLSGKT ++VP+V  HF G ++ +LPA NY+IPV
Sbjct  377  SLRDAFVKGTTDLERAAGVAMFDTCYDLSGKTTIEVPSVAFHFPGGNMLALPAKNYMIPV  436

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            DT G FC AFA T S L+IIGN+QQQG RV FDLA S +GF+A+ C
Sbjct  437  DTVGTFCLAFAPTASSLAIIGNVQQQGTRVGFDLANSLIGFSANKC  482



>ref|XP_011072934.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Sesamum 
indicum]
Length=510

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPVD  406
            +RDAF+    +L P+S  SLFDTC++LSG++ V+VPTV   F G   +SLP  NYLIPVD
Sbjct  406  VRDAFKNMTQNLPPASRLSLFDTCYNLSGRSRVQVPTVSFQFSGGRTLSLPPTNYLIPVD  465

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
             EGKFCFAFAGT+  +SI+GN+QQQG RV FDLA + +GF+ + C
Sbjct  466  DEGKFCFAFAGTSGPMSIMGNVQQQGTRVSFDLANNYIGFSPNKC  510



>ref|XP_009337317.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RDAF++   DL  +S FSLFDTC++LS +T+V+VPTV   F G   +SLPA NYLIPV
Sbjct  382  ALRDAFKRLTRDLPTASSFSLFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYLIPV  441

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV +D A  R+GF+ + C
Sbjct  442  DSAGAFCFAFAPTSSQLSIIGNVQQQGTRVSYDFANKRVGFSPNKC  487



>ref|XP_004497116.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=469

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 78/105 (74%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVD  406
            +RDAF++G  DL  +++ SLFDTC+DLS KT V+VPTV  HF  G  + LPA NYL+PVD
Sbjct  365  VRDAFKRGTKDLPATNDVSLFDTCYDLSSKTSVEVPTVAFHFGEGKGLVLPAKNYLVPVD  424

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            + G FCFAFA T S LSIIGNIQQQG RV FDL  S +GF+ + C
Sbjct  425  SVGTFCFAFAPTMSSLSIIGNIQQQGTRVSFDLGRSIVGFSPNSC  469



>ref|XP_011077177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Sesamum 
indicum]
Length=492

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            +MRDAF+KG  DL  +   +LFDTC+DLS +  V+VPTV  HF  G ++SLPA NY+IPV
Sbjct  387  SMRDAFKKGTKDLASTEGVALFDTCYDLSSRKSVEVPTVAFHFGNGKELSLPAKNYMIPV  446

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S L IIGN+QQQG RV +DL  S +GF+ + C
Sbjct  447  DSSGTFCFAFAPTSSSLGIIGNVQQQGTRVSYDLTNSLIGFSPNKC  492



>ref|XP_011004863.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=501

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVD  406
            +RDAF +   +LK +   +LFDTC+DLSG+  V+VPTV  HF  G   +LPAANY+IPVD
Sbjct  396  LRDAFVRMTQNLKVAGAVALFDTCYDLSGQASVRVPTVSFHFADGKSWNLPAANYMIPVD  455

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            + G +CFAFA TTS LSIIGN+QQQG RV FDLA +R+GF+ + C
Sbjct  456  SAGTYCFAFAPTTSSLSIIGNVQQQGTRVTFDLANNRMGFSPNKC  500



>ref|XP_006440937.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
 gb|ESR54177.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
Length=495

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            ++RD+F + A +LKP+S  +LFDTC+D SG   V+VPTV LHF  G  + LPA NYLIPV
Sbjct  390  SLRDSFVRLAGNLKPTSGVALFDTCYDFSGLRSVRVPTVSLHFGAGKALDLPAKNYLIPV  449

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV FDLA +R+GF  + C
Sbjct  450  DSAGTFCFAFAPTSSALSIIGNVQQQGTRVSFDLANNRVGFTPNKC  495



>gb|KDO64536.1| hypothetical protein CISIN_1g011045mg [Citrus sinensis]
Length=495

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            ++RD+F + A +LKP+S  +LFDTC+D SG   V+VPTV LHF  G  + LPA NYLIPV
Sbjct  390  SLRDSFVRLAGNLKPTSGVALFDTCYDFSGLRSVRVPTVSLHFGAGKALDLPAKNYLIPV  449

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV FDLA +R+GF  + C
Sbjct  450  DSAGTFCFAFAPTSSALSIIGNVQQQGTRVSFDLANNRVGFTPNKC  495



>ref|XP_010551288.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Tarenaya 
hassleriana]
Length=511

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RD+F KG +DL  +S  +LFDTC+DLSG T V+VPTV LHF G  + +LPA NYLIPV
Sbjct  406  SLRDSFVKGTADLPTASGVALFDTCYDLSGNTTVEVPTVALHFTGGRMLALPAKNYLIPV  465

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FC AFA TTS + IIGN+QQQG RV  DLA S +GF+++ C
Sbjct  466  DSAGTFCLAFAPTTSPMGIIGNVQQQGTRVTLDLANSAIGFSSNQC  511



>ref|XP_008351877.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RDAF++   DL  +S F+LFDTC++LS +T+V+VPTV   F G   +SLPA NYLIPV
Sbjct  382  ALRDAFKRLTRDLPTASSFALFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYLIPV  441

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV +D A  R+GF+ + C
Sbjct  442  DSAGTFCFAFAPTSSPLSIIGNVQQQGTRVSYDFANKRVGFSPNKC  487



>ref|XP_007153356.1| hypothetical protein PHAVU_003G028600g [Phaseolus vulgaris]
 gb|ESW25350.1| hypothetical protein PHAVU_003G028600g [Phaseolus vulgaris]
Length=483

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAF +G   L  ++  SLFDTC+DLS +  V VPTV LHF  G ++ LPA NYLIPV
Sbjct  378  ALRDAFVRGTKGLPKTNGVSLFDTCYDLSSRNSVDVPTVSLHFPEGRELPLPAKNYLIPV  437

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA TTS LSIIGN+QQQG RV FD+  S +GF+A+ C
Sbjct  438  DSVGTFCFAFAPTTSSLSIIGNVQQQGTRVSFDIGNSLVGFSANSC  483



>ref|XP_009109887.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=482

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RDAF KG +DL+ + E ++FDTC+DLSGKT ++VP+V  HF G ++ +LPA NY+IPV
Sbjct  377  SLRDAFVKGTTDLERAGEVAMFDTCYDLSGKTTIEVPSVAFHFPGGNMLALPAKNYMIPV  436

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FC AFA T S L+IIGN+QQQG RV FDLA S + F+A+ C
Sbjct  437  DSVGTFCLAFAPTASSLAIIGNVQQQGTRVGFDLANSLIRFSANKC  482



>ref|XP_004299230.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RD F++   DL  +  F+LFDTC+DLSG+T V+VPTV   F G   ++LPA NYLIPV
Sbjct  387  ALRDQFKRLTPDLPAAGNFALFDTCYDLSGRTSVRVPTVSFLFAGGKSLALPAKNYLIPV  446

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G FCFAFA T+S LSIIGN+QQQG RV +DLA +R+GF+ + C
Sbjct  447  DNSGTFCFAFAPTSSSLSIIGNVQQQGTRVSYDLANNRVGFSPNKC  492



>ref|XP_008367576.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RDAF++   DL  +S F+LFDTC++LS +T+V+VPTV   F G   +SLPA NYLIPV
Sbjct  382  ALRDAFKRLTRDLPTASSFALFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYLIPV  441

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV +D A  R+GF+ + C
Sbjct  442  DSAGTFCFAFAPTSSPLSIIGNVQQQGTRVSYDFANKRVGFSPNKC  487



>ref|XP_002511962.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF50631.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=495

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            ++RD+F   +  L+ +S  +LFDTC+DLSG++ VKVPTV  HF G     LPAANYLIPV
Sbjct  390  SLRDSFVSMSRHLRSTSGVALFDTCYDLSGQSSVKVPTVSFHFDGGKSWDLPAANYLIPV  449

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G +CFAFA TTS LSIIGN+QQQG RV FDLA +R+GF+ + C
Sbjct  450  DSAGTYCFAFAPTTSSLSIIGNVQQQGTRVSFDLANNRVGFSTNKC  495



>ref|XP_006485768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=495

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            ++RD+F + A +LKP+S  +LFDTC+D SG   V+VPTV LHF  G  + LPA NYLIPV
Sbjct  390  SLRDSFVRLAGNLKPTSGVALFDTCYDFSGLRSVRVPTVSLHFGAGKALDLPAKNYLIPV  449

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S +SIIGN+QQQG RV FDLA +R+GF  + C
Sbjct  450  DSAGTFCFAFAPTSSAMSIIGNVQQQGTRVSFDLANNRVGFTPNKC  495



>ref|XP_008351878.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RDAF++   DL  +S F+LFDTC++LS +T+V+VPTV   F G   +SLPA NYLIPV
Sbjct  382  ALRDAFKRLTRDLPTASSFALFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYLIPV  441

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV +D A  R+GF+ + C
Sbjct  442  DSAGTFCFAFAPTSSPLSIIGNVQQQGTRVSYDFANKRVGFSPNKC  487



>ref|XP_009337150.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RDAF++   DL  +S FSLFDTC++LS +T+V+VPTV   F G   +SLPA NYLIPV
Sbjct  382  ALRDAFKRLTRDLPTASSFSLFDTCYNLSSRTKVQVPTVSFQFSGGKSLSLPAKNYLIPV  441

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV +D    R+GF+ + C
Sbjct  442  DSAGTFCFAFAPTSSQLSIIGNVQQQGTRVSYDFENKRVGFSPNKC  487



>gb|EEE64882.1| hypothetical protein OsJ_19741 [Oryza sativa Japonica Group]
Length=456

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAFR  A  L+ S   FSLFDTC++LSG+  VKVPTV +H  G A V+LP  NYLIP
Sbjct  350  AVRDAFRAAAVGLRVSPGGFSLFDTCYNLSGRRVVKVPTVSMHLAGGASVALPPENYLIP  409

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VDT G FCFA AGT  G+SIIGNIQQQGFRVVFD    R+GF    C
Sbjct  410  VDTSGTFCFAMAGTDGGVSIIGNIQQQGFRVVFDGDAQRVGFVPKSC  456



>ref|NP_001056485.1| Os05g0590000 [Oryza sativa Japonica Group]
 gb|AAT58814.1| putative nucleoid DNA-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF18399.1| Os05g0590000 [Oryza sativa Japonica Group]
Length=481

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAFR  A  L+ S   FSLFDTC++LSG+  VKVPTV +H  G A V+LP  NYLIP
Sbjct  375  AVRDAFRAAAVGLRVSPGGFSLFDTCYNLSGRRVVKVPTVSMHLAGGASVALPPENYLIP  434

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VDT G FCFA AGT  G+SIIGNIQQQGFRVVFD    R+GF    C
Sbjct  435  VDTSGTFCFAMAGTDGGVSIIGNIQQQGFRVVFDGDAQRVGFVPKSC  481



>gb|EYU40867.1| hypothetical protein MIMGU_mgv1a023461mg [Erythranthe guttata]
Length=479

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            +MRDAFRKG  +L  ++  +LFDTC+DLS +  V+VPTV  HF  G  +SLPA NY+IPV
Sbjct  374  SMRDAFRKGTKELPTAAGVALFDTCYDLSSRKSVEVPTVSFHFSNGKSLSLPAKNYIIPV  433

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T S L IIGN+QQQG RV +DLA S +GF+ + C
Sbjct  434  DSSGTFCFAFAPTASELGIIGNVQQQGTRVSYDLANSLIGFSPNKC  479



>ref|XP_003520035.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=484

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAF KGA  +  ++  SLFDTC+DLS +  V+VPTV  HF  G ++ LPA NYLIPV
Sbjct  379  ALRDAFVKGAKGIPKANGVSLFDTCYDLSSRESVQVPTVSFHFPEGRELPLPARNYLIPV  438

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA TTS LSI+GN+QQQG RV FD+A S +GF+A  C
Sbjct  439  DSVGTFCFAFAPTTSSLSIMGNVQQQGTRVGFDIANSLVGFSADSC  484



>gb|AAT38006.1| unknow protein [Oryza sativa Japonica Group]
Length=475

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAFR  A  L+ S   FSLFDTC++LSG+  VKVPTV +H  G A V+LP  NYLIP
Sbjct  369  AVRDAFRAAAVGLRVSPGGFSLFDTCYNLSGRRVVKVPTVSMHLAGGASVALPPENYLIP  428

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VDT G FCFA AGT  G+SIIGNIQQQGFRVVFD    R+GF    C
Sbjct  429  VDTSGTFCFAMAGTDGGVSIIGNIQQQGFRVVFDGDAQRVGFVPKSC  475



>gb|EAY99240.1| hypothetical protein OsI_21202 [Oryza sativa Indica Group]
Length=475

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+RDAFR  A  L+ S   FSLFDTC++LSG+  VKVPTV +H  G A V+LP  NYLIP
Sbjct  369  AVRDAFRAAAVGLRVSPGGFSLFDTCYNLSGRRVVKVPTVSMHLAGGASVALPPENYLIP  428

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VDT G FCFA AGT  G+SIIGNIQQQGFRVVFD    R+GF    C
Sbjct  429  VDTSGTFCFAMAGTDGGVSIIGNIQQQGFRVVFDGDAQRVGFVPKSC  475



>ref|XP_010477900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RD+F KG SDL+ ++  ++FDTC++LS KT ++VPTV  HF G  + +LPA NY+IPV
Sbjct  378  SLRDSFLKGTSDLEKANGVAMFDTCYNLSSKTTIEVPTVAFHFPGGKMLALPAKNYMIPV  437

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF+++ C
Sbjct  438  DSMGTFCLAFAPTASSLAIIGNVQQQGTRVTFDLANSLIGFSSNKC  483



>ref|XP_010265215.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nelumbo 
nucifera]
Length=494

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            ++RDAF KG  DL  +S  +LFDTC+DLS KT V+VPTV  HF G   + LPA NYL+PV
Sbjct  389  SLRDAFVKGTGDLPSTSGVALFDTCYDLSSKTSVEVPTVTFHFPGGKSLPLPAKNYLVPV  448

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D++G FCFAFA T+S LSIIGNIQQQG RV  D   S +GF+ S C
Sbjct  449  DSQGTFCFAFAPTSSALSIIGNIQQQGTRVSVDFQKSVVGFSPSKC  494



>ref|XP_007152794.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
 gb|ESW24788.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
Length=486

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            A+RDAF++   +L+P+   +LFDTC+DLS    V+VPTV  HF G    +LPA NYLIPV
Sbjct  381  AVRDAFKRMTQNLRPADGVALFDTCYDLSSLQSVRVPTVSFHFAGDKTWALPAKNYLIPV  440

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G +CFAFA TTS LSIIGN+QQQG RV FDLA S +GF+ + C
Sbjct  441  DSAGTYCFAFAPTTSSLSIIGNVQQQGTRVSFDLANSVVGFSPNKC  486



>ref|XP_002890686.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66945.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RD+F KG SDL+ ++  ++FDTC++LS KT ++VPTV  HF G  + +LPA NY+IPV
Sbjct  381  SLRDSFLKGTSDLEKAAGVAMFDTCYNLSAKTTIEVPTVAFHFPGGKMLALPAKNYMIPV  440

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF+++ C
Sbjct  441  DSVGTFCLAFAPTASSLAIIGNVQQQGTRVTFDLANSLIGFSSNKC  486



>ref|XP_010460347.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RD+F KG SDL+ ++  ++FDTC++LS KT ++VPTV  HF G  + +LPA NY+IPV
Sbjct  377  SLRDSFLKGTSDLEKANGVAMFDTCYNLSTKTTIEVPTVAFHFPGGKMLALPAKNYMIPV  436

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF+++ C
Sbjct  437  DSVGTFCLAFAPTASSLAIIGNVQQQGTRVTFDLANSLIGFSSNKC  482



>ref|XP_008244017.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=494

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            ++RDAF++   DL  +S F+LFDTC+DLS ++ V+VPTV   F G   +SLPA NYLIPV
Sbjct  389  SLRDAFKRLTRDLPSASGFALFDTCYDLSSRSRVQVPTVSFLFAGGKSLSLPAKNYLIPV  448

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S  SIIGN+QQQG RV +DLA +R+GF+A+ C
Sbjct  449  DSAGTFCFAFAPTSSSPSIIGNVQQQGTRVSYDLANNRVGFSANKC  494



>ref|XP_010036867.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Eucalyptus grandis]
Length=496

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            ++RDAF K   DLK +S  +LFDTC+D S  + V+VPTV   F G   ++LPA NYLIPV
Sbjct  391  SLRDAFVKLTPDLKSTSGVALFDTCYDFSSLSSVQVPTVSFQFTGGRSLALPAKNYLIPV  450

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA TTS LSIIGN+QQQG RV FDLA SR+GF  + C
Sbjct  451  DSAGTFCFAFAPTTSSLSIIGNVQQQGTRVTFDLANSRVGFTPNKC  496



>gb|KCW48530.1| hypothetical protein EUGRSUZ_K02206 [Eucalyptus grandis]
Length=497

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            ++RDAF K   DLK +S  +LFDTC+D S  + V+VPTV   F G   ++LPA NYLIPV
Sbjct  392  SLRDAFVKLTPDLKSTSGVALFDTCYDFSSLSSVQVPTVSFQFTGGRSLALPAKNYLIPV  451

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA TTS LSIIGN+QQQG RV FDLA SR+GF  + C
Sbjct  452  DSAGTFCFAFAPTTSSLSIIGNVQQQGTRVTFDLANSRVGFTPNKC  497



>gb|KJB52970.1| hypothetical protein B456_008G285900 [Gossypium raimondii]
Length=492

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RDAF K + DL  +   +LFDTC+DLS +T V+VPTV  HF G   + LPA NYLIPV
Sbjct  387  ALRDAFVKLSPDLPTTGGVALFDTCYDLSSRTSVRVPTVAFHFSGGMSLDLPAKNYLIPV  446

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G +C AFA TTS LSIIGN+QQQG RV FDLA +++GF+   C
Sbjct  447  DSSGTYCLAFAPTTSSLSIIGNVQQQGTRVSFDLANNKVGFSPHKC  492



>gb|KFK44545.1| hypothetical protein AALP_AA1G270600 [Arabis alpina]
Length=485

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 3/107 (3%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD---VSLPAANYLIP  412
            +RDAF KG  DL+  +  ++FDTC+DLS KT ++VPTV LHF G     ++LPA NY+IP
Sbjct  379  LRDAFVKGTMDLERVNGVAMFDTCYDLSTKTTIEVPTVALHFSGGGGGMLALPAKNYMIP  438

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD+ G FCFAFA T S L+IIGN+QQQG RV FDLA S +GF+++ C
Sbjct  439  VDSVGTFCFAFAPTASSLAIIGNVQQQGTRVGFDLANSLIGFSSNKC  485



>ref|XP_010527532.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=484

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RD+F KG  DL   S  +LFDTC+DLSGKT+V+VPTV LHF G  +  LPA N LIPV
Sbjct  379  SLRDSFVKGTPDLPTVSGVALFDTCYDLSGKTKVEVPTVALHFPGGRMLPLPAKNCLIPV  438

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D++G FC AFA T S L+IIGN+QQQG RV FDLA S + F+++ C
Sbjct  439  DSKGTFCLAFAPTASSLAIIGNVQQQGTRVTFDLANSVIAFSSNKC  484



>ref|XP_006306517.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
 gb|EOA39415.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
Length=482

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RD+F KG SDL+ ++  ++FDTC++LS KT ++VPTV  HF G  + +LPA NY+IPV
Sbjct  377  SLRDSFLKGTSDLEKTTGVAMFDTCYNLSTKTTIEVPTVAFHFPGGKMLALPAKNYMIPV  436

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FC AFA T S L+I+GN+QQQG RV FDLA S +GF+++ C
Sbjct  437  DSVGTFCLAFAPTASSLAIVGNVQQQGTRVTFDLANSLIGFSSNKC  482



>gb|EAZ12575.1| hypothetical protein OsJ_02481 [Oryza sativa Japonica Group]
Length=501

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = -1

Query  531  FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLS  355
            FSLFDTC+DLSG   VKVPTV +HF G A+ +LP  NYLIPVD+ G FCFAFAGT  G+S
Sbjct  414  FSLFDTCYDLSGLKVVKVPTVSMHFAGGAEAALPPENYLIPVDSRGTFCFAFAGTDGGVS  473

Query  354  IIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            IIGNIQQQGFRVVFD  G RLGF   GC
Sbjct  474  IIGNIQQQGFRVVFDGDGQRLGFVPKGC  501



>ref|XP_010092769.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB52179.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=494

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPVD  406
            +RD F++G  DL  ++  +LFDTC+DLS +T V+VPTV   F G     LPA NYLIPVD
Sbjct  390  LRDEFKRGTQDLPAANGVALFDTCYDLSSRTSVRVPTVSFLFAGGKAWHLPAKNYLIPVD  449

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
              G FCFAFA TTS LSI+GN+QQQG RV +DLA SR+GF+ + C
Sbjct  450  NSGTFCFAFAPTTSSLSIVGNVQQQGTRVSYDLANSRVGFSPNKC  494



>ref|XP_002281973.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vitis vinifera]
Length=491

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            ++RD+F +G   L  +S  +LFDTC+DLS ++ V+VPTV  HF  G  ++LPA NYLIPV
Sbjct  386  SLRDSFVRGTQHLPSTSGVALFDTCYDLSSRSSVEVPTVSFHFPDGKYLALPAKNYLIPV  445

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA TTS LSIIGN+QQQG RV +DL+ S +GF+ +GC
Sbjct  446  DSAGTFCFAFAPTTSALSIIGNVQQQGTRVSYDLSNSLVGFSPNGC  491



>ref|XP_003534178.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Glycine 
max]
Length=492

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RDAF++  S+L+P+   +LFDTC+DLS    V+VPTV  HF G    +LPA NYLIPV
Sbjct  387  SVRDAFKRKTSNLRPAEGVALFDTCYDLSSLQSVRVPTVSFHFSGDRAWALPAKNYLIPV  446

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +CFAFA TTS +SIIGN+QQQG RV FDLA S +GF+ + C
Sbjct  447  DGAGTYCFAFAPTTSSMSIIGNVQQQGTRVSFDLANSLVGFSPNKC  492



>ref|XP_002971459.1| hypothetical protein SELMODRAFT_64134, partial [Selaginella moellendorffii]
 gb|EFJ27208.1| hypothetical protein SELMODRAFT_64134, partial [Selaginella moellendorffii]
Length=357

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVD  406
            MRDAFR     L  +++FSLFDTC+D S  T V +PTV  HF G A V LP +NYL+PVD
Sbjct  253  MRDAFRSATQKLPRAADFSLFDTCYDFSALTSVTIPTVSFHFEGGASVQLPPSNYLVPVD  312

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T G FCFAF+ T+  LSIIGNIQQQ  RV  DL  SR+GFA   C
Sbjct  313  TSGTFCFAFSKTSLDLSIIGNIQQQTMRVAIDLDSSRVGFAPRQC  357



>emb|CAA09458.1| hypothetical protein [Cicer arietinum]
Length=110

 Score =   120 bits (302),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RDAF++   +L+ +   ++FDTC+DLS    V+VPTV  HF    V  LPA NYLIPV
Sbjct  5    SVRDAFKRLTQNLRSAEGVAIFDTCYDLSSLRSVRVPTVSFHFGNDRVWDLPAKNYLIPV  64

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D++G FCFAFA T+S LSIIGN+QQQG RV FD+A S +GF+ + C
Sbjct  65   DSDGTFCFAFAPTSSSLSIIGNVQQQGTRVSFDIANSLVGFSPNKC  110



>ref|XP_002966033.1| hypothetical protein SELMODRAFT_64135, partial [Selaginella moellendorffii]
 gb|EFJ33453.1| hypothetical protein SELMODRAFT_64135, partial [Selaginella moellendorffii]
Length=357

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVD  406
            MRDAFR     L  +++FSLFDTC+D S  T V +PTV  HF G A V LP +NYL+PVD
Sbjct  253  MRDAFRSATQKLPRAADFSLFDTCYDFSALTSVTIPTVSFHFEGGASVQLPPSNYLVPVD  312

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T G FCFAF+ T+  LSIIGNIQQQ  RV  DL  SR+GFA   C
Sbjct  313  TSGTFCFAFSKTSLDLSIIGNIQQQTMRVAIDLDSSRVGFAPRQC  357



>ref|XP_006415880.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
 gb|ESQ34233.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
Length=487

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RDAF KG +DL+ ++  ++FDTC++LS KT ++VPTV  HF G  + +LPA NY+IPV
Sbjct  382  SLRDAFVKGTTDLERAAGVAMFDTCYNLSAKTTIEVPTVAFHFPGGKMMALPAKNYMIPV  441

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF+++ C
Sbjct  442  DSVGTFCLAFAPTGSSLAIIGNVQQQGTRVAFDLANSLIGFSSNKC  487



>ref|XP_004135107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN52057.1| hypothetical protein Csa_5G608450 [Cucumis sativus]
Length=486

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVD  406
            +RDAF K   DL+ +   +LFDTC+DLS K+ V+VPTV  HF  G ++ LPA NYLIPVD
Sbjct  382  LRDAFVKSTHDLQTARGVALFDTCYDLSSKSRVEVPTVSFHFANGNELPLPAKNYLIPVD  441

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +EG FCFAFA T S LSI+GN QQQG RV FDLA S +GF+ + C
Sbjct  442  SEGTFCFAFAPTDSTLSILGNAQQQGTRVGFDLANSLVGFSPNKC  486



>ref|XP_004172253.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=486

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVD  406
            +RDAF K   DL+ +   +LFDTC+DLS K+ V+VPTV  HF  G ++ LPA NYLIPVD
Sbjct  382  LRDAFVKSTHDLQTARGVALFDTCYDLSSKSRVEVPTVSFHFANGNELPLPAKNYLIPVD  441

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +EG FCFAFA T S LSI+GN QQQG RV FDLA S +GF+ + C
Sbjct  442  SEGTFCFAFAPTDSTLSILGNAQQQGTRVGFDLANSLVGFSPNKC  486



>ref|XP_010499100.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RD+F KG SDL+ ++  ++FDTC++LS KT ++VPTV  HF G  + +LPA NY+IPV
Sbjct  377  SLRDSFLKGTSDLEKANGVAMFDTCYNLSTKTTIEVPTVAFHFPGGKMLALPAKNYMIPV  436

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FC AFA TTS L+IIGN+QQQG RV F LA S +GF+++ C
Sbjct  437  DSVGTFCLAFAPTTSSLAIIGNVQQQGTRVTFYLANSLIGFSSNKC  482



>gb|KDO36875.1| hypothetical protein CISIN_1g037264mg, partial [Citrus sinensis]
Length=249

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAF +G   L P+   +LFDTC+D S ++ V+VPTV  HF  G  + LPA NYLIPV
Sbjct  144  ALRDAFVRGTRALSPTDGVALFDTCYDFSSRSSVEVPTVSFHFPEGKVLPLPAKNYLIPV  203

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV F+L  S +GF  + C
Sbjct  204  DSNGTFCFAFAPTSSSLSIIGNVQQQGTRVSFNLRNSLIGFTPNKC  249



>ref|NP_173922.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAG50814.1|AC079281_16 hypothetical protein [Arabidopsis thaliana]
 gb|AAM20575.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15613.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00436.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30636.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=483

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RD+F KG  DL+ ++  ++FDTC++LS KT V+VPTV  HF G  + +LPA NY+IPV
Sbjct  378  SLRDSFVKGTLDLEKAAGVAMFDTCYNLSAKTTVEVPTVAFHFPGGKMLALPAKNYMIPV  437

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF+++ C
Sbjct  438  DSVGTFCLAFAPTASSLAIIGNVQQQGTRVTFDLANSLIGFSSNKC  483



>ref|XP_007209939.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
 gb|EMJ11138.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
Length=494

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            ++RDAF++   DL  +S F+LFDTC+DLS ++ V+VPTV   F  G  +SLPA NYLIPV
Sbjct  389  SLRDAFKRLTRDLPSASGFALFDTCYDLSSRSRVQVPTVSFLFADGKSLSLPAKNYLIPV  448

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S  SIIGN+QQQG RV +DLA +R+GF+ + C
Sbjct  449  DSAGTFCFAFAPTSSSPSIIGNVQQQGTRVSYDLANNRVGFSPNKC  494



>gb|KDP29378.1| hypothetical protein JCGZ_18299 [Jatropha curcas]
Length=484

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            ++RDAF KG   L  ++  +LFDTC+DLS K  V+VP +  HF  G  + LPA NYLIPV
Sbjct  379  SLRDAFVKGTEGLPSTNSVALFDTCYDLSSKYSVEVPALSFHFPDGKVLPLPAKNYLIPV  438

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D++G FCFAFA T S LSIIGN+QQQG RV FDLA SR+GF  + C
Sbjct  439  DSDGTFCFAFAPTASALSIIGNVQQQGTRVSFDLANSRIGFEPNKC  484



>ref|XP_009103072.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=487

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RDAF KG +DL+ ++  ++FDTC++L+ KT ++VPTV  HF G ++ +LPA NY+IPV
Sbjct  382  SLRDAFVKGTTDLEKAAGVAMFDTCYNLAAKTTIEVPTVAFHFPGGNMLALPAKNYMIPV  441

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF+ + C
Sbjct  442  DSVGTFCLAFAPTASSLAIIGNVQQQGTRVGFDLANSLIGFSTNKC  487



>ref|XP_010916474.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=512

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAFR+G + L  +   SLFDTC+DLS +T V+VPTV  HF +G ++ LPA NYLIPV
Sbjct  407  ALRDAFRRGTAGLPAAEGVSLFDTCYDLSSRTSVEVPTVGFHFPQGRELRLPAKNYLIPV  466

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA TT+ LSIIGN+QQQG RV FDL  S +GF  + C
Sbjct  467  DGVGTYCLAFAPTTAPLSIIGNVQQQGIRVSFDLDNSVVGFTPNNC  512



>ref|XP_010677970.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Beta vulgaris 
subsp. vulgaris]
Length=507

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPV  409
            ++R+AF +    L  +S  +LFDTC+D S  + VKVPTV LHF G   + LPA NYLIPV
Sbjct  402  SLRNAFTRLTQHLTSASAVALFDTCYDFSSMSSVKVPTVALHFSGGQTLDLPAKNYLIPV  461

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G +CFAFA TTS +SIIGN+QQQG RV +DLA S++ F+A+ C
Sbjct  462  DSSGTYCFAFAETTSSMSIIGNVQQQGIRVHYDLARSQVAFSANNC  507



>ref|XP_006843768.1| hypothetical protein AMTR_s00007p00241440 [Amborella trichopoda]
 gb|ERN05443.1| hypothetical protein AMTR_s00007p00241440 [Amborella trichopoda]
Length=496

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVD  406
            +RDAF KGA  L  +S  SLFDTC+DLSG+  V VPTV LHF  G  + LPA NYL+PVD
Sbjct  392  LRDAFVKGAQALPRTSGVSLFDTCYDLSGRASVDVPTVSLHFPEGQALVLPAKNYLVPVD  451

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            + G FCFAFA T S LSIIGN+QQQG RV FD A S + F  + C
Sbjct  452  STGTFCFAFAPTNSQLSIIGNVQQQGTRVAFDTANSVVSFTPNKC  496



>emb|CDY51131.1| BnaA07g37140D [Brassica napus]
Length=436

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RDAF KG +DL+ ++  ++FDTC++L+ KT ++VPTV  HF G ++ +LPA NY+IPV
Sbjct  331  SLRDAFVKGTTDLEKAAGVAMFDTCYNLAAKTTIEVPTVAFHFPGGNMLALPAKNYMIPV  390

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF+ + C
Sbjct  391  DSVGTFCLAFAPTASSLAIIGNVQQQGTRVGFDLANSLIGFSTNKC  436



>ref|XP_008782298.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=513

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAFR+G S L  ++  SLFD+C+DLS +T V+VPTV  HF  G D+ LPA NYLIPV
Sbjct  408  ALRDAFRRGTSGLPAAAGVSLFDSCYDLSSRTSVEVPTVAFHFPEGRDLRLPAKNYLIPV  467

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA T + LSIIGN+QQQG RV FDL  S +GF    C
Sbjct  468  DGTGTYCLAFAPTKAPLSIIGNVQQQGTRVSFDLDNSVVGFTPKNC  513



>ref|XP_010487776.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=501

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RDAF +  ++LK  +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIP
Sbjct  395  SLRDAFLRLTTNLKKGTSSISLFDTCYDFSSLSTVKVPTVTFHFTGGKSLDLPAKNYLIP  454

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD  G FCFAFA T+S LSIIGN+QQQG R+ +DLA +R+G +A+ C
Sbjct  455  VDDSGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNRIGLSANKC  501



>ref|XP_002315953.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEF02124.1| aspartyl protease family protein [Populus trichocarpa]
Length=484

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            ++RDAF K   DL  ++  +LFDTC+DLS K  V+VPTV  HF  G ++ LPA NYL+P+
Sbjct  379  SLRDAFVKRTRDLPSTNGIALFDTCYDLSSKGNVEVPTVSFHFPDGKELPLPAKNYLVPL  438

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+EG FCFAFA T S LSIIGN+QQQG RVV+DL    +GF  + C
Sbjct  439  DSEGTFCFAFAPTASSLSIIGNVQQQGTRVVYDLVNHLVGFVPNKC  484



>gb|KFK39179.1| hypothetical protein AALP_AA3G210500 [Arabis alpina]
Length=499

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RD+F K  S+LK  +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIP
Sbjct  393  SLRDSFVKLTSNLKKGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSLDLPAKNYLIP  452

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +D  G FCFAFA T+S LSIIGN+QQQG R+ +DLA +R+G +A+ C
Sbjct  453  IDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNRIGLSANKC  499



>ref|XP_002970504.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
 gb|EFJ28634.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
Length=483

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVD  406
            +RDAFR   ++L  +  +SLFDTC++ SGK  V VP +VLHF  GAD+ LP  NYLIP++
Sbjct  378  IRDAFRNATTNLPSAPRYSLFDTCYNFSGKASVDVPALVLHFENGADLQLPPTNYLIPIN  437

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T G FC AFA T+  L IIGNIQQQ FR+ FDL  S L FA   C
Sbjct  438  TAGSFCLAFAPTSMELGIIGNIQQQSFRIGFDLQKSHLAFAPQQC  482



>ref|XP_003517994.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=484

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAF KGA  +  ++  SLFDTC+DLS +  V++PTV   F  G ++ LPA NYLIPV
Sbjct  379  ALRDAFVKGAKGIPKANGVSLFDTCYDLSSRESVEIPTVSFRFPEGRELPLPARNYLIPV  438

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA TTS LSIIGN+QQQG RV FD+A S +GF+   C
Sbjct  439  DSVGTFCFAFAPTTSSLSIIGNVQQQGTRVGFDIANSLVGFSVDSC  484



>emb|CDP20336.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAF KG  +L  ++  +LFDTCF L  +  V+VPTV  HF  G D+SLPA NYLIPV
Sbjct  379  ALRDAFVKGTKNLPSANGVALFDTCFALGSRKSVEVPTVSFHFSNGKDLSLPAKNYLIPV  438

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV +D+A S + F+++ C
Sbjct  439  DSTGTFCFAFAPTSSTLSIIGNVQQQGTRVSYDIAHSLIAFSSNKC  484



>ref|XP_006298983.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
 gb|EOA31881.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
Length=501

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RDAF +  ++LK  +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIP
Sbjct  395  SLRDAFIRLTANLKKGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSLDLPAKNYLIP  454

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD  G FCFAFA T+S LSIIGN+QQQG R+ +DLA +R+G +A+ C
Sbjct  455  VDDSGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNRIGLSANKC  501



>ref|XP_008799310.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=507

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAFR+  S L  +   SLFDTC+DLS ++ V+VPTV  HF  G ++ LPA NYLIPV
Sbjct  402  ALRDAFRRETSGLPSAEGMSLFDTCYDLSSRSSVEVPTVAFHFPEGRELRLPAKNYLIPV  461

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA TT+ LSIIGN+QQQG RV FDL  S LGF  + C
Sbjct  462  DGGGTYCLAFAPTTAPLSIIGNVQQQGTRVSFDLDKSVLGFTPNNC  507



>gb|KDO70056.1| hypothetical protein CISIN_1g0117492mg, partial [Citrus sinensis]
Length=243

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAF +G   L P+   +LFDTC+D S ++ V+VPTV  HF  G  + LPA N+LIPV
Sbjct  138  ALRDAFVRGTRALSPTDGVALFDTCYDFSSRSSVEVPTVSFHFPEGKVLPLPAKNFLIPV  197

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV F+L  S +GF  + C
Sbjct  198  DSNGTFCFAFAPTSSSLSIIGNVQQQGTRVSFNLRNSLVGFTPNKC  243



>ref|XP_008446567.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Cucumis 
melo]
Length=486

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVD  406
            +RD+F K   DL+ +   +LFDTC+DLS K+ V+VPTV  HF  G ++ LPA NYLIPVD
Sbjct  382  LRDSFVKSTHDLQSARGVALFDTCYDLSSKSSVEVPTVSFHFANGNELPLPAKNYLIPVD  441

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +EG FCFAFA T S LSI+GN QQQG RV FDL+ S +GF+ + C
Sbjct  442  SEGTFCFAFAPTDSTLSILGNAQQQGTRVGFDLSNSLVGFSPNKC  486



>ref|XP_009380958.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=523

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RDAFR G + L  +S  SLFDTC+DLS +T V+VPTV  HF G  ++ LPA NYLIPV
Sbjct  418  ALRDAFRAGTASLPSASGVSLFDTCYDLSSRTSVEVPTVGFHFPGGRELRLPAKNYLIPV  477

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA T++ LSIIGN+QQQG RV FDL  + +GF  + C
Sbjct  478  DGAGTYCLAFAPTSAPLSIIGNVQQQGTRVSFDLENASVGFTPNKC  523



>emb|CDY03848.1| BnaC07g10730D [Brassica napus]
Length=485

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RD+F KG +DL+ ++  ++FDTC++L+ KT ++VPTV  HF G ++ +LPA NY+IPV
Sbjct  380  SLRDSFVKGTTDLEKAAGVAMFDTCYNLAAKTTIEVPTVAFHFPGGNMLALPAKNYMIPV  439

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF  + C
Sbjct  440  DSVGTFCLAFAPTASSLAIIGNVQQQGTRVGFDLANSLIGFLTNKC  485



>ref|XP_010465949.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=502

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RDAF +  ++LK  +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIP
Sbjct  396  SLRDAFLRLTTNLKKGTSSISLFDTCYDFSSLSTVKVPTVTFHFTGGKSLDLPAKNYLIP  455

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD  G FCFAFA T+S LSIIGN+QQQG R+ +DLA +R+G + + C
Sbjct  456  VDDSGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNRIGLSPNKC  502



>gb|KEH27070.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=491

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RD F++   +L+ +  F+LFDTC+DLS    V+VPTV  HF    V SLPA NYLI V
Sbjct  386  SVRDEFKRMTQNLRSADNFALFDTCYDLSNLQSVRVPTVAFHFGENKVWSLPAKNYLIAV  445

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ GKFCFAFA T+S LSIIGN+QQQG RV F+LA + +GF+   C
Sbjct  446  DSAGKFCFAFAPTSSSLSIIGNVQQQGTRVTFNLANNLVGFSNDKC  491



>ref|XP_002978584.1| hypothetical protein SELMODRAFT_54048, partial [Selaginella moellendorffii]
 gb|EFJ20570.1| hypothetical protein SELMODRAFT_54048, partial [Selaginella moellendorffii]
Length=407

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPVD  406
            +RDAFR    +L  +  +SLFDTC++ SGK  V VP +VLHF  GAD+ LP  NYLIP++
Sbjct  303  IRDAFRNATINLPSAPRYSLFDTCYNFSGKASVDVPALVLHFENGADLQLPPTNYLIPIN  362

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            T G FC AFA T+  L IIGNIQQQ FR+ FDL  S L FA   C
Sbjct  363  TAGSFCLAFAPTSMELGIIGNIQQQSFRIGFDLQKSHLAFAPQQC  407



>gb|EMT00623.1| Aspartic proteinase nepenthesin-1 [Aegilops tauschii]
Length=246

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+R+AF +G   L  +S  SLFDTC+DL+G+  V+VP V L F G  ++ LPA NYLIPV
Sbjct  141  ALREAFVQGTQSLPRASGISLFDTCYDLAGRQSVQVPAVALRFEGGGELKLPAKNYLIPV  200

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFAGT+  +SIIGN+QQQG RV FD A + +GF A  C
Sbjct  201  DGAGTYCLAFAGTSGAVSIIGNVQQQGVRVSFDTAKNTVGFTADKC  246



>ref|XP_009608744.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nicotiana 
tomentosiformis]
Length=488

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
             +RD F KG   L  ++  +LFDTC+DL     V+VPTV  HF  G ++ LPA NYLIPV
Sbjct  383  TLRDEFVKGTRHLPSTNSVALFDTCYDLKSMKSVEVPTVSFHFSNGKELPLPAKNYLIPV  442

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV FDL  S +GF+++ C
Sbjct  443  DSSGTFCFAFAPTSSSLSIIGNVQQQGTRVSFDLKNSLIGFSSNKC  488



>ref|XP_007225636.1| hypothetical protein PRUPE_ppa003917mg [Prunus persica]
 gb|EMJ26835.1| hypothetical protein PRUPE_ppa003917mg [Prunus persica]
Length=540

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAF KG  DL  +   +LFD C+DLS K  V+VPTV  HF  G  + LPA NYLIP+
Sbjct  435  ALRDAFVKGTKDLTSTQGAALFDVCYDLSSKKSVEVPTVSFHFADGKVLPLPAKNYLIPI  494

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+EG FCFAFA T S +SIIGN+QQQG RV FD+A S +GF  + C
Sbjct  495  DSEGTFCFAFAPTPSSMSIIGNVQQQGTRVGFDIANSVVGFFPNQC  540



>ref|XP_010506935.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Camelina 
sativa]
Length=501

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RDAF +  + LK  +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIP
Sbjct  395  SLRDAFLRLTTKLKKGTSSISLFDTCYDFSSLSTVKVPTVTFHFTGGKSLDLPAKNYLIP  454

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD  G FCFAFA T+S LSIIGN+QQQG R+ +DL  +R+G +A+ C
Sbjct  455  VDDSGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLTNNRIGLSANKC  501



>ref|XP_010926497.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1 [Elaeis guineensis]
Length=508

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAFR+G + L  ++  SLFDTC+DLS +T V VPTV  HF  G ++ LPA NYLIPV
Sbjct  403  ALRDAFRRGTAGLPAAAGVSLFDTCYDLSSRTSVDVPTVAFHFPEGRELRLPAKNYLIPV  462

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA T + LSIIGN+QQQG RV FDL  S +GF  + C
Sbjct  463  DGVGTYCLAFAPTKAPLSIIGNVQQQGTRVSFDLDKSVVGFTPNNC  508



>ref|XP_008243190.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=556

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAF KG  DL  +   +LFD C+DLS K  V+VPTV  HF  G  + LPA NYLIP+
Sbjct  451  ALRDAFVKGTKDLTSTQGAALFDVCYDLSAKKSVEVPTVSFHFADGKVLPLPAKNYLIPI  510

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+EG FCFAFA T S LSIIGN+QQQG RV FD+A S +GF    C
Sbjct  511  DSEGTFCFAFAPTPSSLSIIGNVQQQGTRVGFDIANSVVGFFPDQC  556



>ref|XP_009112699.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
 emb|CDY18523.1| BnaA01g26720D [Brassica napus]
Length=499

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RDAF K  ++LK  +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIP
Sbjct  393  SLRDAFVKLTANLKKGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSIDLPAKNYLIP  452

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD  G FCFAFA T+S LSIIGN+QQQG R+ +DLA + +G +A+ C
Sbjct  453  VDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNLIGLSANQC  499



>emb|CDY69364.1| BnaCnng63170D [Brassica napus]
Length=501

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RDAF K  ++LK  +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIP
Sbjct  395  SLRDAFVKLTANLKKGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSIDLPAKNYLIP  454

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD  G FCFAFA T+S LSIIGN+QQQG R+ +DLA + +G +A+ C
Sbjct  455  VDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNLIGLSANQC  501



>gb|KJB50738.1| hypothetical protein B456_008G185200 [Gossypium raimondii]
Length=495

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVD  406
            +RDAF KG  +L  +   +LFDTC++LS K+ V VPT+  HF  G  + LPA NY+IPVD
Sbjct  391  LRDAFAKGTKNLPSADSVALFDTCYNLSTKSSVDVPTLSFHFPEGKVLPLPAKNYMIPVD  450

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            + G FCFAFA T+S LSIIGN+QQQG RV FDL  SR+GF  + C
Sbjct  451  SVGTFCFAFAPTSSSLSIIGNVQQQGTRVGFDLGNSRVGFVPNKC  495



>ref|XP_009800603.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nicotiana 
sylvestris]
Length=488

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
             +RD F KG   L  ++  +LFDTC+DL     V+VPTV  HF  G ++ LPA NYLIPV
Sbjct  383  TLRDEFVKGTRHLPSTNGVALFDTCYDLKSMKSVEVPTVSFHFSNGKELPLPAKNYLIPV  442

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV FDL  S +GF+++ C
Sbjct  443  DSSGTFCFAFAPTSSSLSIIGNVQQQGTRVSFDLKNSLIGFSSNKC  488



>ref|XP_006406598.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
 dbj|BAJ33681.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48051.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
Length=502

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RDAF K  +D K  +S  SLFDTC+D S  + VKVPTV  HF G   ++LPA NYLIP
Sbjct  396  SLRDAFVKLTTDFKKGTSPISLFDTCYDFSSLSTVKVPTVTFHFTGGKSLNLPAKNYLIP  455

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +D  G FCFAFA T+S LSIIGN+QQQG R+ +DLA + +G +A+ C
Sbjct  456  IDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNLIGLSANKC  502



>ref|XP_009409187.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RDAFR G + L  +S +SLFDTC+DLS +T V+VPTV  HF  + ++ LPA NYL+PV
Sbjct  417  ALRDAFRAGTASLPSASAWSLFDTCYDLSSRTSVEVPTVGFHFPSSKELRLPAKNYLVPV  476

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA T++ LSIIGN+QQQ  RV FDL  + +GF+ + C
Sbjct  477  DDAGTYCLAFAPTSASLSIIGNVQQQEIRVSFDLDNAVVGFSPNKC  522



>ref|XP_010695864.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPVD  406
            +RD FRKG + L  + E ++FDTC+DL GK  V+VPT+  HF G   ++LPA NY+IPVD
Sbjct  380  LRDEFRKGTTHLPTTDEVAIFDTCYDLRGKESVEVPTLEFHFAGGKTLALPAKNYVIPVD  439

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            TEG FC AFA TT+ +SIIGN+QQ+G RV F+L  S + F  + C
Sbjct  440  TEGTFCLAFAPTTASMSIIGNVQQEGIRVGFNLVYSLVTFEPNQC  484



>ref|XP_007046283.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY02115.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=489

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVD  406
            +RDAF KG  +L  +   +LFDTC+DLS ++ V VPTV  HF  G  + LPA NYLIPVD
Sbjct  385  LRDAFVKGTKNLPSTDSVALFDTCYDLSKRSSVDVPTVSFHFPEGQVLPLPAKNYLIPVD  444

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +EG FCFAFA T+S LSIIGN+QQQG RV FDL  S + F    C
Sbjct  445  SEGTFCFAFAPTSSSLSIIGNVQQQGTRVGFDLGNSLVEFVPDKC  489



>emb|CDY24483.1| BnaC05g34710D [Brassica napus]
Length=491

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIP  412
            ++RDAF K  ++LK  +S  SLFDTC+D S  + VKVPTV  HF G   ++LPA NYLIP
Sbjct  385  SLRDAFVKLTANLKRGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKTLNLPAKNYLIP  444

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +D  G FCFAFA T+S LSIIGN+QQQG R+ +DLA   +G +A+ C
Sbjct  445  IDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANHLIGLSANKC  491



>ref|XP_006437718.1| hypothetical protein CICLE_v10031364mg [Citrus clementina]
 gb|ESR50958.1| hypothetical protein CICLE_v10031364mg [Citrus clementina]
Length=485

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAF +G   L P+   +LFDTC+D S ++ V+VPTV  HF  G  + LPA N+LIPV
Sbjct  380  ALRDAFVRGTRALSPTDGVALFDTCYDFSSRSSVEVPTVSFHFPEGKVLPLPAKNFLIPV  439

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV F+L  S +GF  + C
Sbjct  440  DSNGTFCFAFAPTSSSLSIIGNVQQQGTRVSFNLRNSLVGFTPNKC  485



>ref|XP_006484425.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=485

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAF +G   L P+   +LFDTC+D S ++ V+VPTV  HF  G  + LPA N+LIPV
Sbjct  380  ALRDAFVRGTRALSPTDGVALFDTCYDFSSRSSVEVPTVSFHFPEGKVLPLPAKNFLIPV  439

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA T+S LSIIGN+QQQG RV F+L  S +GF  + C
Sbjct  440  DSNGTFCFAFAPTSSSLSIIGNVQQQGTRVSFNLRNSLVGFTPNKC  485



>ref|XP_009145889.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=492

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIP  412
            ++RDAF K  ++LK  +S  SLFDTC+D S  + VKVPTV  HF G   ++LPA NYLIP
Sbjct  386  SLRDAFVKLTANLKRGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKTLNLPAKNYLIP  445

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +D  G FCFAFA T+S LSIIGN+QQQG R+ +DLA   +G +A+ C
Sbjct  446  IDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANHLIGLSANKC  492



>ref|XP_011008360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=484

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            ++RDAF K   DL  ++  +LFDTC++LS K  V+VPTV  HF  G ++ LPA NYL+P+
Sbjct  379  SLRDAFVKRTRDLPSTNGIALFDTCYNLSSKGNVEVPTVSFHFPDGKELPLPAKNYLVPL  438

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+EG FCFAFA T S LSIIGN+QQQG RV +DL    +GF  + C
Sbjct  439  DSEGTFCFAFAPTASSLSIIGNVQQQGTRVSYDLVNHLVGFVPNRC  484



>ref|XP_002885261.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61520.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RDAF K  ++LK  +S  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIP
Sbjct  394  SLRDAFLKLTTNLKKGTSSISLFDTCYDFSSLSSVKVPTVAFHFTGGKSLDLPAKNYLIP  453

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD  G FCFAFA T+S LSIIGN+QQQG R+ +DLA   +G + + C
Sbjct  454  VDDNGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANKIIGLSGNKC  500



>emb|CDX92240.1| BnaA05g21670D [Brassica napus]
Length=491

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIP  412
            ++RDAF K  ++LK  +S  SLFDTC+D S  + VKVPTV  HF G   ++LPA NYLIP
Sbjct  385  SLRDAFVKLTANLKRGTSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKTLNLPAKNYLIP  444

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +D  G FCFAFA T+S LSIIGN+QQQG R+ +DLA   +G +A+ C
Sbjct  445  IDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANHLIGLSANKC  491



>ref|XP_002275164.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vitis vinifera]
Length=496

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RD F K   DL  +S F+LFDTC++LS +T V+VPTV   F G   + LP +NYLIPV
Sbjct  391  ALRDTFVKLTKDLPSTSGFALFDTCYNLSSRTSVRVPTVAFLFDGGKSLPLPPSNYLIPV  450

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FC AFA TT+ LSIIGN+QQQG RV +DLA S++ F++  C
Sbjct  451  DSAGTFCLAFAPTTASLSIIGNVQQQGTRVTYDLANSQVSFSSRKC  496



>ref|XP_010105777.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXC06062.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=494

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIP  412
            A+RDAF KG   L+ +    +LFDTC+DLS +T V+VPTV  HF G   +SLPA N+LIP
Sbjct  388  ALRDAFVKGTRHLQSTDGGVALFDTCYDLSSQTRVEVPTVSFHFAGGKFLSLPAENFLIP  447

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +D+ G FCFAFA T+S LSIIGN+QQQG RV FDL  S +GF  + C
Sbjct  448  IDSNGTFCFAFAPTSSPLSIIGNVQQQGTRVGFDLVNSLIGFTPNDC  494



>emb|CDM80984.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+R+AF +G   L  +S  SLFDTC+DL+G++ V+VP V L F G  ++ LPA NYLIPV
Sbjct  398  ALREAFVQGTQSLPRASGISLFDTCYDLAGRSSVQVPAVALRFEGGGELKLPAKNYLIPV  457

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFAGT+  +SIIGN+QQQG RV FD A + +GF A  C
Sbjct  458  DGAGTYCLAFAGTSGAVSIIGNVQQQGVRVSFDTAKNTVGFTADKC  503



>ref|XP_002440367.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
 gb|EES18797.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
Length=462

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLK-PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIP  412
            A+R+AFR  A  L+     FSLFDTC+DL G+  VKVPTV +H  G A+V+LP  NYLIP
Sbjct  356  AVREAFRAAAGGLRLAPGGFSLFDTCYDLRGRRVVKVPTVSVHLAGGAEVALPPENYLIP  415

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VDT G FC A AGT  G+SI+GNIQQQGFRVVFD    R+      C
Sbjct  416  VDTRGTFCLALAGTDGGVSIVGNIQQQGFRVVFDGDRQRVALVPKSC  462



>ref|XP_004512945.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=502

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAANYLIPV  409
            ++RDAF++   +L+ +   ++FDTC+DLS    V+VPTV  HF    V  LPA NYLIPV
Sbjct  397  SVRDAFKRLTQNLRSAEGVAIFDTCYDLSSLRSVRVPTVSFHFGNDRVWDLPAKNYLIPV  456

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D++G FCFAFA T+S LSIIGN+QQQG RV FD+A S +GF+ + C
Sbjct  457  DSDGTFCFAFAPTSSSLSIIGNVQQQGTRVSFDIANSLVGFSPNKC  502



>dbj|BAK07248.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+R+AF +G   L  +S  SLFDTC+DL+G++ V+VP V L F G  ++ LPA NYLIPV
Sbjct  395  ALREAFVQGTQSLPRASGVSLFDTCYDLAGRSSVQVPAVALWFEGGGELKLPAKNYLIPV  454

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFAGT+  +SIIGN+QQQG RV FD A + +GF A  C
Sbjct  455  DAAGTYCLAFAGTSGPVSIIGNVQQQGVRVSFDTAKNTVGFTADKC  500



>ref|XP_010551158.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=495

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIP  412
            ++RDAF +  + LK  ++  SLFDTC+D S  + VKVPTV LHF  G  + LPA NYLIP
Sbjct  389  SLRDAFARLTTHLKSATTSISLFDTCYDFSSLSTVKVPTVALHFGDGKYLDLPAKNYLIP  448

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD+ G FCFAFA T++ LSI+GN+QQQG RV FDLA + +GFA + C
Sbjct  449  VDSAGTFCFAFAPTSTPLSIVGNVQQQGTRVSFDLANNLVGFATNKC  495



>ref|XP_010533981.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=502

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RDAF +  ++LK  SS  SLFDTC+D S  + V+VPTV LHF G   + LPA NYLIP
Sbjct  396  SLRDAFARLTANLKSASSSISLFDTCYDFSSLSTVRVPTVALHFAGGKSLELPAKNYLIP  455

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD+ G FCFAFA T++ LSIIGN+QQQG R+ FDLA + +GF  + C
Sbjct  456  VDSAGIFCFAFAPTSTPLSIIGNVQQQGTRIRFDLANNLVGFLPNKC  502



>emb|CDX75968.1| BnaC03g40510D [Brassica napus]
Length=503

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLK-PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            A+RDAF K A D K  +S  SLFDTC+D S  + V VPTV  HF G   + LPA NYLIP
Sbjct  397  ALRDAFVKLAKDFKNATSSISLFDTCYDFSSMSSVNVPTVAFHFTGGKSIDLPAKNYLIP  456

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +D  G FCFAFA T+S LSIIGN+QQQG R+ ++L  + +G +A+ C
Sbjct  457  IDDAGTFCFAFAPTSSELSIIGNVQQQGTRITYNLENNLIGLSANKC  503



>ref|XP_006362549.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=482

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
             +RD F KG   L  ++  +LFDTC+DL     V+VPTV  HF  G +++LPA NYLIPV
Sbjct  377  TLRDEFVKGTRHLPSTNGVALFDTCYDLKSMKSVEVPTVSFHFSNGNELALPAKNYLIPV  436

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+   FCFAFA ++S LSIIGN+QQQG RV FDL  S +GF+++ C
Sbjct  437  DSSSTFCFAFAPSSSSLSIIGNVQQQGTRVSFDLVNSLIGFSSNQC  482



>gb|ABR16474.1| unknown [Picea sitchensis]
Length=538

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
            A+RDAF  G   L  +   S+FDTC+DLSG   V VPTVV HF  GA + LPA NY+IP+
Sbjct  433  AVRDAFVAGTRQLPKAEGVSIFDTCYDLSGLPLVNVPTVVFHFSNGASLILPAKNYMIPM  492

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G FCFAFA  TS LSI+GNIQQQG RV FD A S +GFA   C
Sbjct  493  DFMGTFCFAFAPATSDLSIMGNIQQQGIRVSFDTANSLVGFALRQC  538



>gb|AAL87345.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
Length=500

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RDAF K   +LK  SS  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIP
Sbjct  394  SLRDAFLKLTVNLKKGSSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSLDLPAKNYLIP  453

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD  G FCFAFA T+S LSIIGN+QQQG R+ +DL+ + +G + + C
Sbjct  454  VDDSGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLSKNVIGLSGNKC  500



>ref|NP_188478.1| protein ASPARTIC PROTEASE IN GUARD CELL 1 [Arabidopsis thaliana]
 sp|Q9LS40.1|ASPG1_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 1; Short=AtASPG1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01116.1| CND41, chloroplast nucleoid DNA binding protein-like [Arabidopsis 
thaliana]
 gb|AAN13013.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
 gb|AEE76104.1| protein aspartic protease in guard cell 1 [Arabidopsis thaliana]
Length=500

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RDAF K   +LK  SS  SLFDTC+D S  + VKVPTV  HF G   + LPA NYLIP
Sbjct  394  SLRDAFLKLTVNLKKGSSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKSLDLPAKNYLIP  453

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD  G FCFAFA T+S LSIIGN+QQQG R+ +DL+ + +G + + C
Sbjct  454  VDDSGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLSKNVIGLSGNKC  500



>ref|XP_008389306.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
 ref|XP_008367019.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=488

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVD  406
            +RDAF KG  DL  +   +LFD C+DLS +  V+VPTV  HF  G  + LPA N+LIPVD
Sbjct  384  LRDAFMKGTKDLPVTKGAALFDACYDLSSRKSVEVPTVSFHFADGKVLPLPAKNFLIPVD  443

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            ++G FCFAFA T S LSIIGN+QQQG RV FDL  S +GF+ + C
Sbjct  444  SDGTFCFAFAPTPSSLSIIGNVQQQGTRVGFDLVNSVVGFSPNQC  488



>ref|XP_004238952.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=482

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  409
             +RD F KG   L  ++  +LFDTC+DL     V+VPTV  HF  G +++LPA NYLIPV
Sbjct  377  TLRDEFVKGTRHLPSTNAVALFDTCYDLKSMKSVEVPTVSFHFSNGNELALPAKNYLIPV  436

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+   FCFAFA ++S LSIIGN+QQ+G RV FDL  S +GF+++ C
Sbjct  437  DSSSTFCFAFAPSSSSLSIIGNVQQEGTRVSFDLVNSLIGFSSNQC  482



>ref|XP_004968151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RDAF +G   L  SS  SLFDTC+DLSG+T V+VP V L F G   + LPA NYLIPV
Sbjct  412  ALRDAFVRGTPSLPRSSGVSLFDTCYDLSGRTSVEVPAVSLRFEGGGSLRLPAKNYLIPV  471

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA T + +SIIGN+QQQG RV FD A   +GF  + C
Sbjct  472  DGAGTYCLAFAPTNAAVSIIGNVQQQGTRVSFDTAKGAVGFTPNKC  517



>ref|XP_009762361.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Nicotiana 
sylvestris]
Length=483

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPV  409
            A+RD+F K   +L  + +F+LFDTC+DLS  T+V VPTV LHF G   +SL   NYLI V
Sbjct  378  ALRDSFVKFTQNLPSAGQFALFDTCYDLSSMTKVSVPTVALHFTGDKTLSLHPKNYLIAV  437

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ GKFC AFA T   LSIIGNIQQQG RV +DLA + +GF+   C
Sbjct  438  DSSGKFCLAFAPTEGSLSIIGNIQQQGTRVSYDLASNLVGFSPDKC  483



>ref|XP_010549135.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=496

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RD+F +  + L+  +S  SLFDTC+D S  + V+VPTV LHF G   + LPA NYLIP
Sbjct  390  SLRDSFARLTTHLRSATSTISLFDTCYDFSSLSTVRVPTVALHFAGGKSLDLPAKNYLIP  449

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            VD+ G FCFAFA T++ LSIIGN+QQQG RV FDLA + +GF+ + C
Sbjct  450  VDSAGTFCFAFAPTSTSLSIIGNVQQQGTRVSFDLANNLVGFSPNKC  496



>ref|XP_008457107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=489

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 73/106 (69%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
             +RDAF      LK ++ F+LFDTC+DLS ++ V +PTV   F G   + LP  NYLIPV
Sbjct  384  TLRDAFVSRTPYLKKTNGFALFDTCYDLSSQSRVTIPTVSFEFAGGKSLQLPPKNYLIPV  443

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ G FCFAFA TTS LSIIGN+QQQG RV +DLA S +GF+   C
Sbjct  444  DSVGTFCFAFAPTTSSLSIIGNVQQQGTRVHYDLANSVVGFSPHKC  489



>ref|XP_004137465.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN64110.1| hypothetical protein Csa_1G042220 [Cucumis sativus]
Length=491

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPVD  406
            +RDAF      LK ++ F+LFDTC+DLS ++ V +PTV   F G   + LP  NYLIPVD
Sbjct  387  LRDAFVSRTPYLKKTNGFALFDTCYDLSSQSRVTIPTVSFEFAGGKSLQLPPKNYLIPVD  446

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            + G FCFAFA TTS LSIIGN+QQQG RV +DLA S +GF+   C
Sbjct  447  SVGTFCFAFAPTTSSLSIIGNVQQQGTRVHYDLANSVVGFSPHKC  491



>ref|XP_004157423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=491

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPVD  406
            +RDAF      LK ++ F+LFDTC+DLS ++ V +PTV   F G   + LP  NYLIPVD
Sbjct  387  LRDAFVSRTPYLKKTNGFALFDTCYDLSSQSRVTIPTVSFEFAGGKSLQLPPKNYLIPVD  446

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            + G FCFAFA TTS LSIIGN+QQQG RV +DLA S +GF+   C
Sbjct  447  SVGTFCFAFAPTTSSLSIIGNVQQQGTRVHYDLANSVVGFSPHKC  491



>gb|EAY72467.1| hypothetical protein OsI_00323 [Oryza sativa Indica Group]
Length=500

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RDAF +G   L  +S  SLFDTC+DLS +T V+VP V L F G  ++ LPA NYLIPV
Sbjct  395  ALRDAFVRGTQSLPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFAGGGELRLPAKNYLIPV  454

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA T + +SIIGN+QQQG RV FD A S +GF ++ C
Sbjct  455  DGAGTYCLAFAPTNAAVSIIGNVQQQGTRVSFDTAKSTVGFTSNKC  500



>ref|NP_001041979.1| Os01g0140100 [Oryza sativa Japonica Group]
 dbj|BAB21205.1| putative aspartic proteinase nepenthesin I [Oryza sativa Japonica 
Group]
 dbj|BAF03893.1| Os01g0140100 [Oryza sativa Japonica Group]
 gb|EAZ10476.1| hypothetical protein OsJ_00309 [Oryza sativa Japonica Group]
 dbj|BAG91200.1| unnamed protein product [Oryza sativa Japonica Group]
Length=504

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 73/106 (69%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RDAF +G   L  +S  SLFDTC+DLS +T V+VP V L F G  ++ LPA NYLIPV
Sbjct  399  ALRDAFVRGTQSLPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFAGGGELRLPAKNYLIPV  458

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA T + +SIIGN+QQQG RV FD A S +GF  + C
Sbjct  459  DGAGTYCLAFAPTNAAVSIIGNVQQQGTRVSFDTAKSTVGFTTNKC  504



>gb|KHN15927.1| Aspartic proteinase nepenthesin-1, partial [Glycine soja]
Length=62

 Score =   110 bits (276),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASG  274
            GADVSLPA+NYLIPVD +G FCFAFAGT SGLSI+GNIQQQGFRVVFDLAGSR+GFA  G
Sbjct  1    GADVSLPASNYLIPVDNDGTFCFAFAGTMSGLSIVGNIQQQGFRVVFDLAGSRVGFAPRG  60

Query  273  CA  268
            CA
Sbjct  61   CA  62



>ref|XP_009336599.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=488

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVD  406
            +RDAF KG  DL  +   +LFD C+DLS +  V+VPTV  HF  G  + LPA N+LIPVD
Sbjct  384  LRDAFMKGTKDLPFTKGPALFDACYDLSSRKRVEVPTVSFHFADGKVLPLPAKNFLIPVD  443

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            ++G FCFAFA T S LSIIGN+QQQG RV FDL  S +GF+ + C
Sbjct  444  SDGTFCFAFAPTPSSLSIIGNVQQQGTRVGFDLVNSVVGFSLNQC  488



>gb|KJB37242.1| hypothetical protein B456_006G195400 [Gossypium raimondii]
Length=482

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -1

Query  528  SLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSI  352
            +LFDTC+DLS K+ VKVPTV  HF  G  + LPA NYLIPVD+ G FCFAFA T+S +SI
Sbjct  396  ALFDTCYDLSSKSSVKVPTVSFHFGEGKSLDLPAKNYLIPVDSSGTFCFAFAPTSSSMSI  455

Query  351  IGNIQQQGFRVVFDLAGSRLGFAASGC  271
            IGN+QQQG RV FDLA +R+G ++  C
Sbjct  456  IGNVQQQGTRVSFDLANNRVGLSSHKC  482



>emb|CDX82342.1| BnaA03g34790D [Brassica napus]
Length=499

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLK-PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RDAF K A D K  +S  SLFDTC+D S  + V VP V   F G   + LPA NYLIP
Sbjct  393  SLRDAFVKLAKDFKNATSSISLFDTCYDFSSMSSVNVPAVAFQFTGGKSIDLPAKNYLIP  452

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +D  G FCFAFA T+S LSIIGN+QQQG R+ +DLA + +G +A+ C
Sbjct  453  IDDAGTFCFAFAPTSSELSIIGNVQQQGTRITYDLANNLIGLSANQC  499



>ref|NP_001168599.1| uncharacterized protein LOC100382383 [Zea mays]
 gb|ACN28804.1| unknown [Zea mays]
Length=326

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPV  409
            A+RDAF +GA  L  +S  SLFDTC+DLS +T V+VP V L F G   + LPA NYLIPV
Sbjct  221  ALRDAFVQGAPSLPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFEGGGALRLPAKNYLIPV  280

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA T + +SIIGN+QQQG RV FD A   +GF  + C
Sbjct  281  DGAGTYCLAFAPTNAAVSIIGNVQQQGTRVSFDTARGAVGFTPNKC  326



>gb|AEW08671.1| hypothetical protein CL1136Contig1_03, partial [Pinus radiata]
 gb|AFB33836.1| hypothetical protein CL1136Contig1_03, partial [Pinus mugo]
 gb|AFB33837.1| hypothetical protein CL1136Contig1_03, partial [Pinus mugo]
 gb|AFB33838.1| hypothetical protein CL1136Contig1_03, partial [Pinus mugo]
 gb|AFG48834.1| hypothetical protein CL1136Contig1_03, partial [Pinus taeda]
Length=70

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = -1

Query  531  FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLS  355
            FSLFDTC+DLSG   VKVPTVV HF+G ADVSLPA NYLIPVD+   FCFAFAG T GLS
Sbjct  3    FSLFDTCYDLSGLKTVKVPTVVFHFQGRADVSLPATNYLIPVDSSATFCFAFAGNTGGLS  62

Query  354  IIGNIQQQ  331
            IIGNIQQQ
Sbjct  63   IIGNIQQQ  70



>ref|XP_003565317.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brachypodium 
distachyon]
Length=529

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RDAF +G   L  +S  SLFDTC+DL+G++ V+VP V L F G  ++ LPA NYLIPV
Sbjct  424  ALRDAFVRGTQALPRASGVSLFDTCYDLAGRSSVQVPAVSLRFEGGGELKLPAKNYLIPV  483

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA T   +SI+GN+QQQG RV FD A + +GF+ + C
Sbjct  484  DGAGTYCLAFAATGGAVSIVGNVQQQGIRVSFDTAKNTVGFSPNKC  529



>ref|XP_006645485.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Oryza 
brachyantha]
Length=306

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIPV  409
            A+RDAF +G   L  +S  SLFDTC+DLS +T V+VP     F G  ++ LPA NYLIPV
Sbjct  201  ALRDAFARGTQSLARTSGVSLFDTCYDLSDRTSVEVPAGARRFEGGGELRLPAKNYLIPV  260

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA T + +SIIGN+QQQG RV FD A + +GF ++ C
Sbjct  261  DGAGTYCLAFAATNAAVSIIGNVQQQGTRVSFDTAKATVGFTSNKC  306



>tpg|DAA53545.1| TPA: hypothetical protein ZEAMMB73_483039 [Zea mays]
Length=506

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPV  409
            A+RDAF +GA  L  +S  SLFDTC+DLS +T V+VP V L F G   + LPA NYLIPV
Sbjct  401  ALRDAFVQGAPSLPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFEGGGALRLPAKNYLIPV  460

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA T + +SIIGN+QQQG RV FD A   +GF  + C
Sbjct  461  DGAGTYCLAFAPTNAAVSIIGNVQQQGTRVSFDTARGAVGFTPNKC  506



>ref|XP_004241622.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
lycopersicum]
Length=495

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPV  409
            A+RD F K A +L  + EF LFDTCFDLS  + V VPT+ LHF G   + L A N ++PV
Sbjct  390  ALRDTFVKYAQNLPSAGEFELFDTCFDLSSMSTVNVPTMALHFSGGQTLPLQAQNTVVPV  449

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ GK+C AFA T   +SIIGN+QQQG RV +DL+ + +GF+   C
Sbjct  450  DSSGKYCLAFAPTDESMSIIGNVQQQGIRVSYDLSNNLVGFSLDKC  495



>ref|XP_009616228.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPV  409
            A+RD+F K   +L  +  FSLFDTC+DLS    V VPTV  HF     +SL   NYLIPV
Sbjct  380  ALRDSFVKLTQNLPTAGRFSLFDTCYDLSSMKRVSVPTVAFHFSDDKTLSLHPKNYLIPV  439

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D+ GKFC AFA T   LSIIGNIQQQG RV +DLA + +GF+   C
Sbjct  440  DSSGKFCLAFAPTEGSLSIIGNIQQQGTRVSYDLANNLVGFSPDKC  485



>ref|XP_002965292.1| hypothetical protein SELMODRAFT_83230 [Selaginella moellendorffii]
 gb|EFJ34130.1| hypothetical protein SELMODRAFT_83230 [Selaginella moellendorffii]
Length=423

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 73/106 (69%), Gaps = 2/106 (2%)
 Frame = -1

Query  582  MRDAFRKG-ASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPV  409
            MRDAFR G  SD K +S FSLFDTC+DLSG++ + +P V   F G A ++LPA N ++PV
Sbjct  317  MRDAFRAGMPSDAKMTSGFSLFDTCYDLSGRSSIMLPAVSFVFNGGATMALPAQNIMVPV  376

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA  +   SIIGNIQQQ FR+ FD  G+R+G  A+ C
Sbjct  377  DNSGTYCLAFAPNSENFSIIGNIQQQSFRMSFDSTGNRVGIGANQC  422



>ref|XP_002986620.1| hypothetical protein SELMODRAFT_124369 [Selaginella moellendorffii]
 gb|EFJ12477.1| hypothetical protein SELMODRAFT_124369 [Selaginella moellendorffii]
Length=423

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 73/106 (69%), Gaps = 2/106 (2%)
 Frame = -1

Query  582  MRDAFRKG-ASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPV  409
            MRDAFR G  SD K +S FSLFDTC+DLSG++ + +P V   F G A ++LPA N ++PV
Sbjct  317  MRDAFRAGMPSDAKMTSGFSLFDTCYDLSGRSSIMLPAVSFVFNGGATMALPAQNIMVPV  376

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA  +   SIIGNIQQQ FR+ FD  G+R+G  A+ C
Sbjct  377  DNSGTYCLAFAPNSENFSIIGNIQQQSFRMSFDSTGNRVGIGANQC  422



>ref|XP_009135580.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=499

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = -1

Query  585  AMRDAFRKGASDLK-PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANYLIP  412
            ++RDAF K A D K  +S  SLFDTC+D S  + V VP V   F G   + LPA NYLIP
Sbjct  393  SLRDAFVKLAKDFKNATSSISLFDTCYDFSSMSSVNVPAVAFQFTGGKSIDLPAKNYLIP  452

Query  411  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            +D  G FCFAFA T+S LSIIGN+QQQG R+ +DL  + +G +A+ C
Sbjct  453  IDDAGTFCFAFAPTSSELSIIGNVQQQGTRITYDLENNLIGLSANQC  499



>ref|XP_009356391.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=491

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPVD  406
            +RDAF KG  DL  +   +L D C+DLS K  V+VPT+  HF  G  + LPA N+LIPVD
Sbjct  387  LRDAFMKGTKDLPFTKGAALCDACYDLSSKRSVEVPTLSFHFADGKVLPLPAKNFLIPVD  446

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            ++G FCFAFA T S LSIIGN+QQQG RV FDL  S +GF+ + C
Sbjct  447  SDGTFCFAFAPTPSALSIIGNVQQQGARVGFDLVNSVVGFSRNQC  491



>ref|XP_002457394.1| hypothetical protein SORBIDRAFT_03g006630 [Sorghum bicolor]
 gb|EES02514.1| hypothetical protein SORBIDRAFT_03g006630 [Sorghum bicolor]
Length=509

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPV  409
            A+RDAF +G   L  +S  SLFDTC+DLS +T V+VP V L F G   + LPA NYLIPV
Sbjct  404  ALRDAFVRGTPSLPRTSGVSLFDTCYDLSDRTSVEVPAVSLRFEGGGALRLPAKNYLIPV  463

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D  G +C AFA T + +SIIGN+QQQG RV FD A   +GF  + C
Sbjct  464  DGAGTYCLAFAPTNAAVSIIGNVQQQGTRVSFDTAKGVVGFTPNKC  509



>ref|XP_004298296.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = -1

Query  585  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR-GADVSLPAANYLIPV  409
            A+R AF      L+ +S  +LFD C+DLS    V VP +  HF  G ++ LPA NYLIPV
Sbjct  376  ALRSAFVNMTKGLESTSGVALFDACYDLSKIESVDVPALSFHFEDGKELPLPAKNYLIPV  435

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D++G FCFAFA T+  LSIIGN+QQQG RV FD+A S +GF+A  C
Sbjct  436  DSQGTFCFAFAPTSGALSIIGNVQQQGTRVSFDIANSVVGFSADQC  481



>ref|XP_004235788.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=486

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIPVD  406
            +RD+FRK    L  + +F+LFDTC+DLS      VPT+  HF G   + L   NYLIPVD
Sbjct  382  LRDSFRKYTQHLPSAGQFALFDTCYDLSSMKRASVPTLSFHFSGGKALPLHPKNYLIPVD  441

Query  405  TEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            + GKFC AFA T   LSIIGNIQQQG RV +DLA + +GF+   C
Sbjct  442  SSGKFCLAFAPTDGSLSIIGNIQQQGTRVSYDLANNLVGFSPDKC  486



>ref|XP_004961034.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = -1

Query  549  LKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFA  376
            L+PS   FSLFDTC+DL  +  VKVPT+ +H  G A V+LP  NYLIPVDT G FCFA A
Sbjct  423  LRPSPGGFSLFDTCYDLGRRRVVKVPTLSVHLAGGAAVALPPENYLIPVDTRGTFCFALA  482

Query  375  GTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            GT  G+SI+GNIQQQGFRVVFD    R+G     C
Sbjct  483  GTDGGVSILGNIQQQGFRVVFDGDAQRVGLVPKSC  517



>gb|EYU19035.1| hypothetical protein MIMGU_mgv1a021892mg [Erythranthe guttata]
Length=465

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = -1

Query  582  MRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPA--ANYLIPV  409
            +RD F+  +  L+ +  FSLFDTC+D S +T VKVP +   F G   +LP   +N+LIPV
Sbjct  361  VRDTFKSMSPYLRSAGRFSLFDTCYDFSSETTVKVPMISFQFAGGK-TLPVRPSNFLIPV  419

Query  408  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  271
            D +GKFCFAFAGT+  L+IIGN+QQQG RV +DLA   +GF+ + C
Sbjct  420  DEKGKFCFAFAGTSGPLNIIGNLQQQGTRVTYDLANRNIGFSPNKC  465



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690