BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF045F06

Length=596
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP18515.1|  unnamed protein product                              70.1    1e-10   Coffea canephora [robusta coffee]
ref|XP_002525667.1|  conserved hypothetical protein                   70.1    1e-10   Ricinus communis
gb|KDP46473.1|  hypothetical protein JCGZ_08445                       70.1    1e-10   Jatropha curcas
ref|XP_010248365.1|  PREDICTED: uncharacterized protein LOC104591254  69.7    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_011046106.1|  PREDICTED: uncharacterized protein LOC105140810  68.2    6e-10   Populus euphratica
ref|XP_011017543.1|  PREDICTED: uncharacterized protein LOC105120863  67.0    1e-09   Populus euphratica
ref|XP_006372281.1|  hypothetical protein POPTR_0018s14940g           67.0    1e-09   
ref|XP_009789864.1|  PREDICTED: testis-expressed sequence 2 prote...  66.6    2e-09   Nicotiana sylvestris
gb|KJB56356.1|  hypothetical protein B456_009G116400                  66.2    2e-09   Gossypium raimondii
ref|XP_007022967.1|  Integral membrane protein conserved region (...  66.6    2e-09   
gb|KHG07655.1|  Testis-expressed sequence 2                           66.6    2e-09   Gossypium arboreum [tree cotton]
gb|KJB56353.1|  hypothetical protein B456_009G116400                  66.2    2e-09   Gossypium raimondii
ref|XP_009789863.1|  PREDICTED: uncharacterized protein LOC104237...  66.2    2e-09   Nicotiana sylvestris
ref|XP_009789860.1|  PREDICTED: uncharacterized protein LOC104237...  66.2    2e-09   Nicotiana sylvestris
ref|XP_010537536.1|  PREDICTED: testis-expressed sequence 2 protein   65.9    3e-09   Tarenaya hassleriana [spider flower]
ref|XP_006347390.1|  PREDICTED: uncharacterized protein LOC102602040  65.5    4e-09   Solanum tuberosum [potatoes]
ref|XP_004241487.1|  PREDICTED: uncharacterized protein LOC101251098  65.5    4e-09   Solanum lycopersicum
ref|XP_009761972.1|  PREDICTED: uncharacterized protein LOC104214...  65.5    5e-09   Nicotiana sylvestris
ref|XP_009761973.1|  PREDICTED: uncharacterized protein LOC104214...  65.5    5e-09   Nicotiana sylvestris
ref|XP_009594853.1|  PREDICTED: testis-expressed sequence 2 prote...  65.5    5e-09   Nicotiana tomentosiformis
ref|XP_009594854.1|  PREDICTED: testis-expressed sequence 2 prote...  65.1    5e-09   Nicotiana tomentosiformis
ref|XP_006372649.1|  hypothetical protein POPTR_0017s03560g           64.7    8e-09   
ref|XP_010104942.1|  hypothetical protein L484_004290                 64.7    8e-09   Morus notabilis
ref|XP_004234314.1|  PREDICTED: testis-expressed sequence 2 prote...  64.7    8e-09   Solanum lycopersicum
ref|XP_010317541.1|  PREDICTED: testis-expressed sequence 2 prote...  64.7    8e-09   Solanum lycopersicum
ref|XP_010317540.1|  PREDICTED: uncharacterized protein LOC101250...  64.3    1e-08   Solanum lycopersicum
emb|CBI26392.3|  unnamed protein product                              64.3    1e-08   Vitis vinifera
ref|XP_010662020.1|  PREDICTED: testis-expressed sequence 2 prote...  63.9    1e-08   Vitis vinifera
ref|XP_010662022.1|  PREDICTED: uncharacterized protein LOC100244...  63.9    1e-08   
ref|XP_006589245.1|  PREDICTED: uncharacterized protein LOC100816...  63.9    1e-08   Glycine max [soybeans]
ref|XP_009631470.1|  PREDICTED: testis-expressed sequence 2 prote...  63.9    1e-08   Nicotiana tomentosiformis
ref|XP_009631469.1|  PREDICTED: testis-expressed sequence 2 prote...  63.9    1e-08   Nicotiana tomentosiformis
ref|XP_003535400.1|  PREDICTED: uncharacterized protein LOC100816...  63.5    2e-08   Glycine max [soybeans]
ref|XP_006351568.1|  PREDICTED: uncharacterized protein LOC102588484  63.5    2e-08   
ref|XP_006649193.1|  PREDICTED: testis-expressed sequence 2 prote...  63.2    2e-08   Oryza brachyantha
emb|CDY21730.1|  BnaA09g44810D                                        63.2    2e-08   Brassica napus [oilseed rape]
emb|CDX81851.1|  BnaC08g37500D                                        63.2    2e-08   
ref|XP_009117641.1|  PREDICTED: uncharacterized protein LOC103842732  63.2    3e-08   Brassica rapa
gb|KDO56008.1|  hypothetical protein CISIN_1g003631mg                 62.8    3e-08   Citrus sinensis [apfelsine]
ref|XP_006441502.1|  hypothetical protein CICLE_v100194782mg          62.8    3e-08   Citrus clementina [clementine]
ref|XP_004495486.1|  PREDICTED: testis-expressed sequence 2 prote...  62.8    3e-08   Cicer arietinum [garbanzo]
ref|XP_007210364.1|  hypothetical protein PRUPE_ppa001510mg           62.8    4e-08   Prunus persica
gb|KDO56007.1|  hypothetical protein CISIN_1g003631mg                 62.8    4e-08   Citrus sinensis [apfelsine]
ref|XP_008240431.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  62.4    4e-08   Prunus mume [ume]
ref|XP_006478163.1|  PREDICTED: testis-expressed sequence 2 prote...  62.4    4e-08   Citrus sinensis [apfelsine]
gb|KEH42874.1|  integral membrane protein, putative                   62.4    4e-08   Medicago truncatula
ref|XP_008437259.1|  PREDICTED: uncharacterized protein LOC103482740  61.6    7e-08   Cucumis melo [Oriental melon]
ref|XP_004164497.1|  PREDICTED: uncharacterized LOC101209104          61.6    7e-08   
ref|XP_004137541.1|  PREDICTED: uncharacterized protein LOC101209104  61.6    7e-08   Cucumis sativus [cucumbers]
ref|XP_009408155.1|  PREDICTED: testis-expressed sequence 2 prote...  61.2    9e-08   
dbj|BAD94762.1|  hypothetical protein                                 60.8    9e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408154.1|  PREDICTED: uncharacterized protein LOC103990...  61.2    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007161563.1|  hypothetical protein PHAVU_001G080200g           61.2    1e-07   Phaseolus vulgaris [French bean]
gb|EEC74285.1|  hypothetical protein OsI_09535                        61.2    1e-07   Oryza sativa Indica Group [Indian rice]
dbj|BAD23057.1|  unknown protein                                      60.8    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006306770.1|  hypothetical protein CARUB_v10008308mg           60.5    2e-07   Capsella rubella
ref|XP_010476945.1|  PREDICTED: uncharacterized protein LOC104756113  60.5    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010498158.1|  PREDICTED: uncharacterized protein LOC104775894  60.5    2e-07   Camelina sativa [gold-of-pleasure]
gb|AAF97262.1|AC034106_5  Strong similarity to a hypothetical pro...  60.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892968.1|  hypothetical protein ARALYDRAFT_889192           60.5    2e-07   Arabidopsis lyrata subsp. lyrata
ref|NP_173224.2|  putative integral membrane protein conserved re...  60.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459394.1|  PREDICTED: testis-expressed sequence 2 prote...  60.5    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010687269.1|  PREDICTED: testis-expressed sequence 2 prote...  59.7    3e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687270.1|  PREDICTED: testis-expressed sequence 2 prote...  59.7    3e-07   
ref|XP_006416664.1|  hypothetical protein EUTSA_v10006829mg           59.7    4e-07   Eutrema salsugineum [saltwater cress]
gb|EPS70705.1|  hypothetical protein M569_04055                       58.9    4e-07   Genlisea aurea
ref|XP_006848627.1|  hypothetical protein AMTR_s00171p00040960        59.3    4e-07   
ref|XP_004301206.1|  PREDICTED: uncharacterized protein LOC101303523  59.3    4e-07   Fragaria vesca subsp. vesca
emb|CDY26213.1|  BnaA06g12040D                                        58.9    5e-07   Brassica napus [oilseed rape]
ref|XP_009149234.1|  PREDICTED: uncharacterized protein LOC103872560  58.9    6e-07   Brassica rapa
emb|CDY19177.1|  BnaC05g13780D                                        58.5    6e-07   Brassica napus [oilseed rape]
ref|XP_002453085.1|  hypothetical protein SORBIDRAFT_04g038050        58.5    8e-07   
ref|XP_008802615.1|  PREDICTED: uncharacterized protein LOC103716408  58.2    1e-06   Phoenix dactylifera
ref|XP_010497157.1|  PREDICTED: uncharacterized protein C23G7.06c...  56.6    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010935611.1|  PREDICTED: testis-expressed sequence 2 prote...  57.8    1e-06   Elaeis guineensis
ref|XP_004954472.1|  PREDICTED: uncharacterized protein LOC101777078  57.4    2e-06   
ref|XP_002888912.1|  hypothetical protein ARALYDRAFT_895179           57.4    2e-06   Arabidopsis lyrata subsp. lyrata
gb|AFW63912.1|  hypothetical protein ZEAMMB73_732140                  57.4    2e-06   
gb|KFK41758.1|  hypothetical protein AALP_AA2G168400                  57.4    2e-06   Arabis alpina [alpine rockcress]
ref|XP_006300617.1|  hypothetical protein CARUB_v10019838mg           57.0    2e-06   Capsella rubella
ref|NP_177463.1|  putative integral membrane protein                  57.0    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004512701.1|  PREDICTED: uncharacterized protein LOC101503...  56.6    3e-06   Cicer arietinum [garbanzo]
ref|XP_004512702.1|  PREDICTED: uncharacterized protein LOC101503...  56.6    3e-06   Cicer arietinum [garbanzo]
ref|XP_003573002.1|  PREDICTED: testis-expressed sequence 2 prote...  56.6    3e-06   Brachypodium distachyon [annual false brome]
ref|XP_011072097.1|  PREDICTED: uncharacterized protein LOC105157385  56.2    4e-06   
ref|XP_010428228.1|  PREDICTED: testis-expressed sequence 2 prote...  55.8    5e-06   Camelina sativa [gold-of-pleasure]
dbj|BAK04177.1|  predicted protein                                    55.5    7e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX72963.1|  BnaC06g34110D                                        53.9    3e-05   
ref|XP_006390581.1|  hypothetical protein EUTSA_v10018153mg           53.9    3e-05   Eutrema salsugineum [saltwater cress]
ref|XP_009105967.1|  PREDICTED: testis-expressed sequence 2 prote...  53.5    3e-05   Brassica rapa
emb|CDX96454.1|  BnaA07g30650D                                        53.5    3e-05   
ref|XP_010069545.1|  PREDICTED: uncharacterized protein LOC104456...  52.4    7e-05   Eucalyptus grandis [rose gum]
gb|EYU22323.1|  hypothetical protein MIMGU_mgv1a007789mg              52.4    7e-05   Erythranthe guttata [common monkey flower]
ref|XP_010069546.1|  PREDICTED: uncharacterized protein LOC104456...  52.4    7e-05   Eucalyptus grandis [rose gum]
ref|XP_006599667.1|  PREDICTED: uncharacterized protein LOC100812...  51.6    1e-04   Glycine max [soybeans]
gb|KHN24469.1|  Testis-expressed sequence 2 protein                   51.6    1e-04   Glycine soja [wild soybean]
ref|XP_006599669.1|  PREDICTED: uncharacterized protein LOC100812...  51.6    1e-04   Glycine max [soybeans]
ref|XP_007152502.1|  hypothetical protein PHAVU_004G135600g           51.2    2e-04   Phaseolus vulgaris [French bean]



>emb|CDP18515.1| unnamed protein product [Coffea canephora]
Length=664

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 3/48 (6%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            A+ KR+G   TRA+MLG  KKMGEKLEEKR+HIEE+GRHIVEKM+G Q
Sbjct  618  AKHKRIG---TRARMLGFGKKMGEKLEEKRKHIEERGRHIVEKMKGPQ  662



>ref|XP_002525667.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36785.1| conserved hypothetical protein [Ricinus communis]
Length=792

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            + PKRMG    RA+ML L KKMGEKLEEKRRHIEEKGR+IVEKMRG
Sbjct  749  SRPKRMG---RRARMLDLGKKMGEKLEEKRRHIEEKGRNIVEKMRG  791



>gb|KDP46473.1| hypothetical protein JCGZ_08445 [Jatropha curcas]
Length=788

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            + PKRMG    RA+ML L KKMGEKLEEKRRHIEEKGR+IVEKMRG
Sbjct  745  SRPKRMG---RRARMLDLGKKMGEKLEEKRRHIEEKGRNIVEKMRG  787



>ref|XP_010248365.1| PREDICTED: uncharacterized protein LOC104591254 [Nelumbo nucifera]
Length=796

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
             +PKR+G    R +M+GL KKMGEK EEKRRHIEEKGRHIVEKMRG
Sbjct  753  VKPKRIG---RRERMMGLGKKMGEKFEEKRRHIEEKGRHIVEKMRG  795



>ref|XP_011046106.1| PREDICTED: uncharacterized protein LOC105140810 [Populus euphratica]
Length=791

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            + PK+MG    RAKML L KKMGEKLEEKRRHIEEKGR+IV+KMRG
Sbjct  748  SRPKKMG---RRAKMLDLGKKMGEKLEEKRRHIEEKGRNIVDKMRG  790



>ref|XP_011017543.1| PREDICTED: uncharacterized protein LOC105120863 [Populus euphratica]
 ref|XP_011017544.1| PREDICTED: uncharacterized protein LOC105120863 [Populus euphratica]
 ref|XP_011017545.1| PREDICTED: uncharacterized protein LOC105120863 [Populus euphratica]
Length=797

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 3/44 (7%)
 Frame = -1

Query  320  PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            PK+MG    RAKML L KKMGEK EEKRRHIEEKGR+IV+KMRG
Sbjct  756  PKKMG---RRAKMLDLGKKMGEKFEEKRRHIEEKGRNIVDKMRG  796



>ref|XP_006372281.1| hypothetical protein POPTR_0018s14940g [Populus trichocarpa]
 gb|ERP50078.1| hypothetical protein POPTR_0018s14940g [Populus trichocarpa]
Length=776

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 3/44 (7%)
 Frame = -1

Query  320  PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            PK+MG    RAKML L KKMGEK EEKRRHIEEKGR+IV+KMRG
Sbjct  735  PKKMG---RRAKMLDLGKKMGEKFEEKRRHIEEKGRNIVDKMRG  775



>ref|XP_009789864.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X3 
[Nicotiana sylvestris]
Length=728

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 8/59 (14%)
 Frame = -1

Query  344  LEEY-HIAE----PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            LEE+ H  E    PKR G   TRA+M GL KKMGEKLEEK+RHIEEKGRH+VE+MR  +
Sbjct  670  LEEHNHFTEDDMKPKRTG---TRARMHGLRKKMGEKLEEKKRHIEEKGRHLVERMRSHK  725



>gb|KJB56356.1| hypothetical protein B456_009G116400 [Gossypium raimondii]
Length=539

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            + PK+MG    +A+M+ L+KKMGEK EEK+RHIEE+GRHIVEKMRG
Sbjct  496  SRPKKMG---RKARMIDLTKKMGEKFEEKKRHIEERGRHIVEKMRG  538



>ref|XP_007022967.1| Integral membrane protein conserved region (DUF2404), putative 
[Theobroma cacao]
 gb|EOY25589.1| Integral membrane protein conserved region (DUF2404), putative 
[Theobroma cacao]
Length=761

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 43/63 (68%), Gaps = 12/63 (19%)
 Frame = -1

Query  350  RPLEEY---------HIAEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEK  198
            RPL E+         + + PK+MG    +A+ML L KKMGEK EEKRRHIEEK RHIVEK
Sbjct  701  RPLVEFERQSDVIDDNDSRPKKMG---RKARMLDLGKKMGEKFEEKRRHIEEKSRHIVEK  757

Query  197  MRG  189
            MRG
Sbjct  758  MRG  760



>gb|KHG07655.1| Testis-expressed sequence 2 [Gossypium arboreum]
Length=744

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            + PK+MG    +A+M+ L+KKMGEK EEK+RHIEE+GRHIVEKMRG
Sbjct  701  SRPKKMG---RKARMIDLTKKMGEKFEEKKRHIEERGRHIVEKMRG  743



>gb|KJB56353.1| hypothetical protein B456_009G116400 [Gossypium raimondii]
Length=744

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            + PK+MG    +A+M+ L+KKMGEK EEK+RHIEE+GRHIVEKMRG
Sbjct  701  SRPKKMG---RKARMIDLTKKMGEKFEEKKRHIEERGRHIVEKMRG  743



>ref|XP_009789863.1| PREDICTED: uncharacterized protein LOC104237408 isoform X2 [Nicotiana 
sylvestris]
Length=814

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 8/59 (14%)
 Frame = -1

Query  344  LEEY-HIAE----PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            LEE+ H  E    PKR G   TRA+M GL KKMGEKLEEK+RHIEEKGRH+VE+MR  +
Sbjct  756  LEEHNHFTEDDMKPKRTG---TRARMHGLRKKMGEKLEEKKRHIEEKGRHLVERMRSHK  811



>ref|XP_009789860.1| PREDICTED: uncharacterized protein LOC104237408 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009789861.1| PREDICTED: uncharacterized protein LOC104237408 isoform X1 [Nicotiana 
sylvestris]
Length=819

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 8/59 (14%)
 Frame = -1

Query  344  LEEY-HIAE----PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            LEE+ H  E    PKR G   TRA+M GL KKMGEKLEEK+RHIEEKGRH+VE+MR  +
Sbjct  761  LEEHNHFTEDDMKPKRTG---TRARMHGLRKKMGEKLEEKKRHIEEKGRHLVERMRSHK  816



>ref|XP_010537536.1| PREDICTED: testis-expressed sequence 2 protein [Tarenaya hassleriana]
Length=771

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            RA+ML L KKMGEKLEEKRRHIEEK RHIVEKMRG Q
Sbjct  735  RARMLDLGKKMGEKLEEKRRHIEEKSRHIVEKMRGPQ  771



>ref|XP_006347390.1| PREDICTED: uncharacterized protein LOC102602040 [Solanum tuberosum]
Length=832

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            RA+MLGL KKMGEKLEE+ RHIEEKGR++VE+MRGQQ
Sbjct  796  RARMLGLGKKMGEKLEERARHIEEKGRNLVERMRGQQ  832



>ref|XP_004241487.1| PREDICTED: uncharacterized protein LOC101251098 [Solanum lycopersicum]
Length=830

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            RA+MLGL KKMGEKLEE+ RHIEEKGR++VE+MRGQQ
Sbjct  794  RARMLGLGKKMGEKLEERARHIEEKGRNLVERMRGQQ  830



>ref|XP_009761972.1| PREDICTED: uncharacterized protein LOC104214066 isoform X1 [Nicotiana 
sylvestris]
Length=831

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            RA+MLGL KKMGEKLEE+ RHIEEKGR++VE+MRGQQ
Sbjct  795  RARMLGLGKKMGEKLEERARHIEEKGRNLVERMRGQQ  831



>ref|XP_009761973.1| PREDICTED: uncharacterized protein LOC104214066 isoform X2 [Nicotiana 
sylvestris]
Length=827

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            RA+MLGL KKMGEKLEE+ RHIEEKGR++VE+MRGQQ
Sbjct  791  RARMLGLGKKMGEKLEERARHIEEKGRNLVERMRGQQ  827



>ref|XP_009594853.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Nicotiana tomentosiformis]
Length=830

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            RA+MLGL KKMGEKLEE+ RHIEEKGR++VE+MRGQQ
Sbjct  794  RARMLGLGKKMGEKLEERARHIEEKGRNLVERMRGQQ  830



>ref|XP_009594854.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Nicotiana tomentosiformis]
Length=826

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            RA+MLGL KKMGEKLEE+ RHIEEKGR++VE+MRGQQ
Sbjct  790  RARMLGLGKKMGEKLEERARHIEEKGRNLVERMRGQQ  826



>ref|XP_006372649.1| hypothetical protein POPTR_0017s03560g [Populus trichocarpa]
 gb|ERP50446.1| hypothetical protein POPTR_0017s03560g [Populus trichocarpa]
Length=802

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            + PK+MG    RAKML L KKMGEK EEKRR+IEEKGR+IV+KMRG
Sbjct  759  SRPKKMG---RRAKMLDLGKKMGEKFEEKRRNIEEKGRNIVDKMRG  801



>ref|XP_010104942.1| hypothetical protein L484_004290 [Morus notabilis]
 gb|EXC02509.1| hypothetical protein L484_004290 [Morus notabilis]
Length=796

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 3/48 (6%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            + PK++G   TRA+ML L KKMGEK EEKRRHIEEK + IVEKMRG +
Sbjct  749  SRPKKIG---TRARMLDLGKKMGEKFEEKRRHIEEKSKQIVEKMRGSE  793



>ref|XP_004234314.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Solanum lycopersicum]
Length=689

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  299  STRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            S RAKMLGL KKMGEKLEEK+RHIEEKGRH+V +MR  +
Sbjct  648  SARAKMLGLRKKMGEKLEEKKRHIEEKGRHLVTRMRSHK  686



>ref|XP_010317541.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X3 
[Solanum lycopersicum]
Length=689

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  299  STRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            S RAKMLGL KKMGEKLEEK+RHIEEKGRH+V +MR  +
Sbjct  648  SARAKMLGLRKKMGEKLEEKKRHIEEKGRHLVTRMRSHK  686



>ref|XP_010317540.1| PREDICTED: uncharacterized protein LOC101250278 isoform X1 [Solanum 
lycopersicum]
Length=812

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  299  STRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            S RAKMLGL KKMGEKLEEK+RHIEEKGRH+V +MR  +
Sbjct  771  SARAKMLGLRKKMGEKLEEKKRHIEEKGRHLVTRMRSHK  809



>emb|CBI26392.3| unnamed protein product [Vitis vinifera]
Length=751

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 3/44 (7%)
 Frame = -1

Query  320  PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            PKRMG    +A+ML L KKMGEKLEEKRR+IEEKGR+IVE+MRG
Sbjct  710  PKRMG---RKARMLDLGKKMGEKLEEKRRNIEEKGRNIVERMRG  750



>ref|XP_010662020.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Vitis vinifera]
Length=798

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 3/44 (7%)
 Frame = -1

Query  320  PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            PKRMG    +A+ML L KKMGEKLEEKRR+IEEKGR+IVE+MRG
Sbjct  757  PKRMG---RKARMLDLGKKMGEKLEEKRRNIEEKGRNIVERMRG  797



>ref|XP_010662022.1| PREDICTED: uncharacterized protein LOC100244234 isoform X2 [Vitis 
vinifera]
Length=796

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 3/44 (7%)
 Frame = -1

Query  320  PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            PKRMG    +A+ML L KKMGEKLEEKRR+IEEKGR+IVE+MRG
Sbjct  755  PKRMG---RKARMLDLGKKMGEKLEEKRRNIEEKGRNIVERMRG  795



>ref|XP_006589245.1| PREDICTED: uncharacterized protein LOC100816218 isoform X2 [Glycine 
max]
Length=653

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 3/44 (7%)
 Frame = -1

Query  320  PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            PK+MG    R +ML L KKM EKLEEKRRHIEEK RHIVEKMRG
Sbjct  612  PKKMG---RRERMLDLGKKMSEKLEEKRRHIEEKSRHIVEKMRG  652



>ref|XP_009631470.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Nicotiana tomentosiformis]
Length=810

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 41/57 (72%), Gaps = 7/57 (12%)
 Frame = -1

Query  341  EEYHIAE----PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            E+ H  E    PKR G   TR +M GL KKMGEKLEEK+RHIEEKGRH+VE+MR  +
Sbjct  754  EQKHFTEDDMKPKRTG---TRDRMHGLRKKMGEKLEEKKRHIEEKGRHLVERMRSHK  807



>ref|XP_009631469.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Nicotiana tomentosiformis]
Length=815

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 41/57 (72%), Gaps = 7/57 (12%)
 Frame = -1

Query  341  EEYHIAE----PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            E+ H  E    PKR G   TR +M GL KKMGEKLEEK+RHIEEKGRH+VE+MR  +
Sbjct  759  EQKHFTEDDMKPKRTG---TRDRMHGLRKKMGEKLEEKKRHIEEKGRHLVERMRSHK  812



>ref|XP_003535400.1| PREDICTED: uncharacterized protein LOC100816218 isoform X1 [Glycine 
max]
 gb|KHN14743.1| Testis-expressed sequence 2 protein [Glycine soja]
Length=789

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 3/44 (7%)
 Frame = -1

Query  320  PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            PK+MG    R +ML L KKM EKLEEKRRHIEEK RHIVEKMRG
Sbjct  748  PKKMG---RRERMLDLGKKMSEKLEEKRRHIEEKSRHIVEKMRG  788



>ref|XP_006351568.1| PREDICTED: uncharacterized protein LOC102588484 [Solanum tuberosum]
Length=815

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 3/47 (6%)
 Frame = -1

Query  323  EPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            +PKR G    RAKMLGL KKMGEKLEEK+RHIEEKG H+V +MR  +
Sbjct  769  KPKRTG---ARAKMLGLRKKMGEKLEEKKRHIEEKGIHLVTRMRSHK  812



>ref|XP_006649193.1| PREDICTED: testis-expressed sequence 2 protein-like [Oryza brachyantha]
Length=815

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  302  GSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMR  192
            G  RA+M+   KKMG+KLEEKRRHIEEKGRHIVEKMR
Sbjct  759  GGRRARMMDFGKKMGDKLEEKRRHIEEKGRHIVEKMR  795



>emb|CDY21730.1| BnaA09g44810D [Brassica napus]
Length=768

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+MLGL KKMGEKLEEKRRH+EEK R IVEKMRG
Sbjct  732  RARMLGLGKKMGEKLEEKRRHMEEKSRQIVEKMRG  766



>emb|CDX81851.1| BnaC08g37500D [Brassica napus]
Length=771

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+MLGL KKMGEKLEEKRRH+EEK R IVEKMRG
Sbjct  735  RARMLGLGKKMGEKLEEKRRHMEEKSRQIVEKMRG  769



>ref|XP_009117641.1| PREDICTED: uncharacterized protein LOC103842732 [Brassica rapa]
Length=786

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+MLGL KKMGEKLEEKRRH+EEK R IVEKMRG
Sbjct  750  RARMLGLGKKMGEKLEEKRRHMEEKSRQIVEKMRG  784



>gb|KDO56008.1| hypothetical protein CISIN_1g003631mg [Citrus sinensis]
Length=585

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L K M EKLEEKRRHIEEKGRHIVEKMRG
Sbjct  550  RARMLDLGKNMKEKLEEKRRHIEEKGRHIVEKMRG  584



>ref|XP_006441502.1| hypothetical protein CICLE_v100194782mg [Citrus clementina]
 gb|ESR54742.1| hypothetical protein CICLE_v100194782mg [Citrus clementina]
Length=576

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L K M EKLEEKRRHIEEKGRHIVEKMRG
Sbjct  541  RARMLDLGKNMKEKLEEKRRHIEEKGRHIVEKMRG  575



>ref|XP_004495486.1| PREDICTED: testis-expressed sequence 2 protein-like [Cicer arietinum]
Length=787

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 8/53 (15%)
 Frame = -1

Query  332  HIAE-----PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            HI E     PK+MG    + +M  L KKMGEKLEEKRRH+EEK RHIVEKMRG
Sbjct  737  HIFEQEDELPKKMG---RKERMFDLGKKMGEKLEEKRRHLEEKSRHIVEKMRG  786



>ref|XP_007210364.1| hypothetical protein PRUPE_ppa001510mg [Prunus persica]
 gb|EMJ11563.1| hypothetical protein PRUPE_ppa001510mg [Prunus persica]
Length=811

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 3/43 (7%)
 Frame = -1

Query  317  KRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            KRMG    +A+ML L KKMGEKLEEKRRHIEEK R+IVEKMRG
Sbjct  771  KRMG---RKARMLDLGKKMGEKLEEKRRHIEEKSRNIVEKMRG  810



>gb|KDO56007.1| hypothetical protein CISIN_1g003631mg [Citrus sinensis]
Length=806

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L K M EKLEEKRRHIEEKGRHIVEKMRG
Sbjct  771  RARMLDLGKNMKEKLEEKRRHIEEKGRHIVEKMRG  805



>ref|XP_008240431.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103338940 
[Prunus mume]
Length=807

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 3/43 (7%)
 Frame = -1

Query  317  KRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            KRMG    +A+ML L KKMGEKLEEKRRHIEEK R+IVEKMRG
Sbjct  767  KRMG---RKARMLDLGKKMGEKLEEKRRHIEEKSRNIVEKMRG  806



>ref|XP_006478163.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Citrus sinensis]
Length=806

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L K M EKLEEKRRHIEEKGRHIVEKMRG
Sbjct  771  RARMLDLGKNMKEKLEEKRRHIEEKGRHIVEKMRG  805



>gb|KEH42874.1| integral membrane protein, putative [Medicago truncatula]
Length=798

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 3/44 (7%)
 Frame = -1

Query  320  PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            PK+MG    + +M  L KKMGEKLEEKRRH+EEK RHIVEKMRG
Sbjct  757  PKKMG---RKERMFDLRKKMGEKLEEKRRHLEEKSRHIVEKMRG  797



>ref|XP_008437259.1| PREDICTED: uncharacterized protein LOC103482740 [Cucumis melo]
Length=792

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 3/44 (7%)
 Frame = -1

Query  320  PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            PKR+G    RA+ML + KKMGEKLEEKRR+IEEK R+IVEKMRG
Sbjct  751  PKRIG---RRARMLEIGKKMGEKLEEKRRNIEEKSRNIVEKMRG  791



>ref|XP_004164497.1| PREDICTED: uncharacterized LOC101209104 [Cucumis sativus]
Length=792

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 3/44 (7%)
 Frame = -1

Query  320  PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            PKR+G    RA+ML + KKMGEKLEEKRR+IEEK R+IVEKMRG
Sbjct  751  PKRIG---RRARMLEIGKKMGEKLEEKRRNIEEKSRNIVEKMRG  791



>ref|XP_004137541.1| PREDICTED: uncharacterized protein LOC101209104 [Cucumis sativus]
 gb|KGN64230.1| hypothetical protein Csa_1G043320 [Cucumis sativus]
Length=792

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 3/44 (7%)
 Frame = -1

Query  320  PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            PKR+G    RA+ML + KKMGEKLEEKRR+IEEK R+IVEKMRG
Sbjct  751  PKRIG---RRARMLEIGKKMGEKLEEKRRNIEEKSRNIVEKMRG  791



>ref|XP_009408155.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=673

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 3/44 (7%)
 Frame = -1

Query  323  EPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMR  192
            +PKR    S RAKM+   K+MG+KLEEKRRHIEEK RHIVEKMR
Sbjct  628  KPKRT---SRRAKMMDFGKRMGDKLEEKRRHIEEKSRHIVEKMR  668



>dbj|BAD94762.1| hypothetical protein [Arabidopsis thaliana]
Length=438

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L KKMGEKLEEKRRH+EEK R IVEKMRG
Sbjct  402  RARMLDLGKKMGEKLEEKRRHMEEKSRQIVEKMRG  436



>ref|XP_009408154.1| PREDICTED: uncharacterized protein LOC103990667 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=799

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 3/44 (7%)
 Frame = -1

Query  323  EPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMR  192
            +PKR    S RAKM+   K+MG+KLEEKRRHIEEK RHIVEKMR
Sbjct  754  KPKRT---SRRAKMMDFGKRMGDKLEEKRRHIEEKSRHIVEKMR  794



>ref|XP_007161563.1| hypothetical protein PHAVU_001G080200g [Phaseolus vulgaris]
 gb|ESW33557.1| hypothetical protein PHAVU_001G080200g [Phaseolus vulgaris]
Length=787

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 3/44 (7%)
 Frame = -1

Query  320  PKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            PK+MG    R +M  L KKM EKLEEKRRHIEEK RHIVEK+RG
Sbjct  746  PKKMG---RRERMFDLGKKMSEKLEEKRRHIEEKSRHIVEKIRG  786



>gb|EEC74285.1| hypothetical protein OsI_09535 [Oryza sativa Indica Group]
Length=819

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  302  GSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMR  192
            G  RA+M+   KKMG+KLEEKRRHIEEKGR+IVEKMR
Sbjct  760  GGRRARMMDFGKKMGDKLEEKRRHIEEKGRNIVEKMR  796



>dbj|BAD23057.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE58095.1| hypothetical protein OsJ_08966 [Oryza sativa Japonica Group]
Length=819

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  302  GSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMR  192
            G  RA+M+   KKMG+KLEEKRRHIEEKGR+IVEKMR
Sbjct  760  GGRRARMMDFGKKMGDKLEEKRRHIEEKGRNIVEKMR  796



>ref|XP_006306770.1| hypothetical protein CARUB_v10008308mg [Capsella rubella]
 gb|EOA39668.1| hypothetical protein CARUB_v10008308mg [Capsella rubella]
Length=838

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L KKMGEKLEEKRRH+EEK R IVEKMRG
Sbjct  802  RARMLDLGKKMGEKLEEKRRHMEEKSRQIVEKMRG  836



>ref|XP_010476945.1| PREDICTED: uncharacterized protein LOC104756113 [Camelina sativa]
Length=803

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L KKMGEKLEEKRRH+EEK R IVEKMRG
Sbjct  767  RARMLDLGKKMGEKLEEKRRHMEEKSRQIVEKMRG  801



>ref|XP_010498158.1| PREDICTED: uncharacterized protein LOC104775894 [Camelina sativa]
Length=805

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L KKMGEKLEEKRRH+EEK R IVEKMRG
Sbjct  769  RARMLDLGKKMGEKLEEKRRHMEEKSRQIVEKMRG  803



>gb|AAF97262.1|AC034106_5 Strong similarity to a hypothetical protein T18K17.13 gi|6598861 
from Arabidopsis thaliana BAC T18K17 gb|AC010556 and contains 
a PH PF|00169 domain [Arabidopsis thaliana]
Length=797

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L KKMGEKLEEKRRH+EEK R IVEKMRG
Sbjct  761  RARMLDLGKKMGEKLEEKRRHMEEKSRQIVEKMRG  795



>ref|XP_002892968.1| hypothetical protein ARALYDRAFT_889192 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69227.1| hypothetical protein ARALYDRAFT_889192 [Arabidopsis lyrata subsp. 
lyrata]
Length=797

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L KKMGEKLEEKRRH+EEK R IVEKMRG
Sbjct  761  RARMLDLGKKMGEKLEEKRRHMEEKSRQIVEKMRG  795



>ref|NP_173224.2| putative integral membrane protein conserved region (DUF2404) 
[Arabidopsis thaliana]
 gb|AAM91570.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ56797.1| At1g17820 [Arabidopsis thaliana]
 gb|AEE29640.1| putative integral membrane protein conserved region (DUF2404) 
[Arabidopsis thaliana]
Length=803

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L KKMGEKLEEKRRH+EEK R IVEKMRG
Sbjct  767  RARMLDLGKKMGEKLEEKRRHMEEKSRQIVEKMRG  801



>ref|XP_010459394.1| PREDICTED: testis-expressed sequence 2 protein-like [Camelina 
sativa]
Length=804

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L KKMGEKLEEKRRH+EEK R IVEKMRG
Sbjct  768  RARMLDLGKKMGEKLEEKRRHMEEKSRQIVEKMRG  802



>ref|XP_010687269.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=787

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            +A+M  L KKMGEKLEEKRRHIEEK R+IVEKMRG
Sbjct  752  KARMFDLGKKMGEKLEEKRRHIEEKSRNIVEKMRG  786



>ref|XP_010687270.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687271.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=771

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            +A+M  L KKMGEKLEEKRRHIEEK R+IVEKMRG
Sbjct  736  KARMFDLGKKMGEKLEEKRRHIEEKSRNIVEKMRG  770



>ref|XP_006416664.1| hypothetical protein EUTSA_v10006829mg [Eutrema salsugineum]
 gb|ESQ35017.1| hypothetical protein EUTSA_v10006829mg [Eutrema salsugineum]
Length=802

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+M  L KKMGEKLEEKRRH+EEK R IVEKMRG
Sbjct  766  RARMFDLGKKMGEKLEEKRRHMEEKSRQIVEKMRG  800



>gb|EPS70705.1| hypothetical protein M569_04055, partial [Genlisea aurea]
Length=378

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = -1

Query  317  KRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMR  192
            +RMG   TR +M GL KKMGEKLE KRRHIEEKGR +VEKMR
Sbjct  331  RRMG---TRERMRGLGKKMGEKLETKRRHIEEKGRSLVEKMR  369



>ref|XP_006848627.1| hypothetical protein AMTR_s00171p00040960 [Amborella trichopoda]
 gb|ERN10208.1| hypothetical protein AMTR_s00171p00040960 [Amborella trichopoda]
Length=796

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRGQQ  183
            RA+M+  SKKMGEKLEEKRRH+EEK +H+VEKM+G +
Sbjct  759  RARMMDFSKKMGEKLEEKRRHLEEKSKHLVEKMKGYE  795



>ref|XP_004301206.1| PREDICTED: uncharacterized protein LOC101303523 [Fragaria vesca 
subsp. vesca]
Length=803

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 3/43 (7%)
 Frame = -1

Query  317  KRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            KR+G    RA+ML L KKMGEKLEEKRR IEEK R+IVEKMRG
Sbjct  763  KRVG---RRARMLDLGKKMGEKLEEKRRSIEEKSRNIVEKMRG  802



>emb|CDY26213.1| BnaA06g12040D [Brassica napus]
Length=779

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L KKMGEKL+EKRRH+EEK R IV+KMRG
Sbjct  743  RARMLSLGKKMGEKLDEKRRHMEEKSRQIVDKMRG  777



>ref|XP_009149234.1| PREDICTED: uncharacterized protein LOC103872560 [Brassica rapa]
Length=779

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L KKMGEKL+EKRRH+EEK R IV+KMRG
Sbjct  743  RARMLSLGKKMGEKLDEKRRHMEEKSRQIVDKMRG  777



>emb|CDY19177.1| BnaC05g13780D [Brassica napus]
Length=762

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            RA+ML L KKMGEKL+EKRRH+EEK R IV+KMRG
Sbjct  726  RARMLSLGKKMGEKLDEKRRHMEEKSRQIVDKMRG  760



>ref|XP_002453085.1| hypothetical protein SORBIDRAFT_04g038050 [Sorghum bicolor]
 gb|EES06061.1| hypothetical protein SORBIDRAFT_04g038050 [Sorghum bicolor]
Length=782

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  302  GSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMR  192
            G  RA+M+   K+MG+KLEEKRR IEEKGRHIVEKMR
Sbjct  733  GGRRARMMDFGKRMGDKLEEKRRTIEEKGRHIVEKMR  769



>ref|XP_008802615.1| PREDICTED: uncharacterized protein LOC103716408 [Phoenix dactylifera]
Length=804

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 5/52 (10%)
 Frame = -1

Query  347  PLEEYHIAEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMR  192
            PLEE   A+PK++G    RA+M  + K++G+KLEEKRRH+EEK RHIVEKMR
Sbjct  753  PLEED--AKPKKIG---RRARMKEIGKRVGDKLEEKRRHLEEKSRHIVEKMR  799



>ref|XP_010497157.1| PREDICTED: uncharacterized protein C23G7.06c-like [Camelina sativa]
Length=241

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  305  LGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            +G+ +A+M    KK+GEK EEK+RH+EE+ R IVEKMRG
Sbjct  202  MGAAKARMFDFRKKVGEKFEEKKRHVEERSRQIVEKMRG  240



>ref|XP_010935611.1| PREDICTED: testis-expressed sequence 2 protein-like [Elaeis guineensis]
Length=804

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 72/127 (57%), Gaps = 15/127 (12%)
 Frame = -1

Query  554  QEGIQEGWNNSGSPLQEAPNDCLDPKDQSTMKSSVKELQAPLL-Tceeqqecerssssse  378
            QE + E   + G  L    N       QS+  S  +EL+ PLL T E Q+ C++S   S 
Sbjct  682  QESVSEFSTSHGGSLASVSNG------QSSFDSINEELRIPLLRTNETQESCDQSGVESP  735

Query  377  kvecysspSRPLEEYHI-----AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGR  213
            +    S+    +EE  I     A+PK++   + RA+M  + K+MG+KLEEKRRH+EEK R
Sbjct  736  RTSSSSAIVTTVEETTIPSEEDAKPKKI---TRRARMKEIGKRMGDKLEEKRRHLEEKSR  792

Query  212  HIVEKMR  192
            HIVEKMR
Sbjct  793  HIVEKMR  799



>ref|XP_004954472.1| PREDICTED: uncharacterized protein LOC101777078 [Setaria italica]
Length=890

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  302  GSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMR  192
            G  RA+M+   K+MG+KLEEKRR IEE+GRHIVEKMR
Sbjct  841  GGRRARMMDFGKRMGDKLEEKRRTIEERGRHIVEKMR  877



>ref|XP_002888912.1| hypothetical protein ARALYDRAFT_895179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65171.1| hypothetical protein ARALYDRAFT_895179 [Arabidopsis lyrata subsp. 
lyrata]
Length=779

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = -1

Query  317  KRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            KRMG  + +A+M    KK+GEK EEK+RH+EEK R IVEKMRG
Sbjct  738  KRMG--TAKARMFDFRKKVGEKFEEKKRHVEEKSRQIVEKMRG  778



>gb|AFW63912.1| hypothetical protein ZEAMMB73_732140 [Zea mays]
Length=796

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMR  192
            RA+M+   K+MG+KLEEKRR IEEKGRHIVEKMR
Sbjct  750  RARMMDFGKRMGDKLEEKRRTIEEKGRHIVEKMR  783



>gb|KFK41758.1| hypothetical protein AALP_AA2G168400 [Arabis alpina]
Length=764

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  305  LGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            +G+ +A+M    KK+GEK EEK+RH+EEK R IVEKMRG
Sbjct  725  MGTAKARMFDFRKKVGEKFEEKKRHVEEKSRQIVEKMRG  763



>ref|XP_006300617.1| hypothetical protein CARUB_v10019838mg [Capsella rubella]
 gb|EOA33515.1| hypothetical protein CARUB_v10019838mg [Capsella rubella]
Length=775

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  305  LGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            +G+ +A+M    KK+GEK EEK+RH+EEK R IVEKMRG
Sbjct  736  MGAAKARMFDFRKKVGEKFEEKKRHVEEKSRQIVEKMRG  774



>ref|NP_177463.1| putative integral membrane protein [Arabidopsis thaliana]
 gb|AAG52130.1|AC010556_12 hypothetical protein; 41134-44253 [Arabidopsis thaliana]
 gb|AEE35428.1| putative integral membrane protein [Arabidopsis thaliana]
Length=779

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  305  LGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            +G+ +A+M    KK+GEK EEK+RH+EEK R IVEKMRG
Sbjct  740  MGAAKARMFDFRKKVGEKFEEKKRHVEEKSRQIVEKMRG  778



>ref|XP_004512701.1| PREDICTED: uncharacterized protein LOC101503148 isoform X1 [Cicer 
arietinum]
Length=825

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            ++PK++G    R +M  L KKM EK EEK+RHIEEK RHIVEKMR 
Sbjct  779  SKPKKVG---RRERMFDLRKKMSEKFEEKKRHIEEKSRHIVEKMRA  821



>ref|XP_004512702.1| PREDICTED: uncharacterized protein LOC101503148 isoform X2 [Cicer 
arietinum]
Length=808

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            ++PK++G    R +M  L KKM EK EEK+RHIEEK RHIVEKMR 
Sbjct  762  SKPKKVG---RRERMFDLRKKMSEKFEEKKRHIEEKSRHIVEKMRA  804



>ref|XP_003573002.1| PREDICTED: testis-expressed sequence 2 protein-like [Brachypodium 
distachyon]
Length=799

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMR  192
            R++M+ L KK+G+KLEEKRR +EEKGRHIVEKMR
Sbjct  750  RSRMMDLGKKVGDKLEEKRRQVEEKGRHIVEKMR  783



>ref|XP_011072097.1| PREDICTED: uncharacterized protein LOC105157385 [Sesamum indicum]
 ref|XP_011072098.1| PREDICTED: uncharacterized protein LOC105157385 [Sesamum indicum]
Length=793

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 3/43 (7%)
 Frame = -1

Query  317  KRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            KR+G   TR +M GL KKMGEKLE KRRH EEKGR  VE++RG
Sbjct  753  KRIG---TRERMRGLGKKMGEKLEVKRRHFEEKGRSFVERIRG  792



>ref|XP_010428228.1| PREDICTED: testis-expressed sequence 2 protein-like [Camelina 
sativa]
Length=776

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  305  LGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            +G+ +A+M    KK+GEK EEK+RH+EE+ R IVEKMRG
Sbjct  737  MGAAKARMFDFRKKVGEKFEEKKRHVEERSRQIVEKMRG  775



>dbj|BAK04177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=813

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  293  RAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMR  192
            R++M+ L KKMG+KLEEKRR  EEKGRHI+EKMR
Sbjct  766  RSRMMDLGKKMGDKLEEKRRQAEEKGRHIIEKMR  799



>emb|CDX72963.1| BnaC06g34110D [Brassica napus]
Length=749

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 3/43 (7%)
 Frame = -1

Query  317  KRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            K+MG   TR +M    KK+GEK EEK+RH+EE+ R IVEKMRG
Sbjct  709  KKMG---TRERMFDFRKKVGEKFEEKKRHMEERSRQIVEKMRG  748



>ref|XP_006390581.1| hypothetical protein EUTSA_v10018153mg [Eutrema salsugineum]
 gb|ESQ27867.1| hypothetical protein EUTSA_v10018153mg [Eutrema salsugineum]
Length=779

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 3/43 (7%)
 Frame = -1

Query  317  KRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            K+MG   T+ +M    KK+GEK EEK+RH+EE+ R IVEKMRG
Sbjct  739  KKMG---TKERMFDFRKKVGEKFEEKKRHVEERSRQIVEKMRG  778



>ref|XP_009105967.1| PREDICTED: testis-expressed sequence 2 protein-like [Brassica 
rapa]
Length=744

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 3/43 (7%)
 Frame = -1

Query  317  KRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            K+MG   TR +M    KK+GEK EEK+RH+EE+ R IVEKMRG
Sbjct  704  KKMG---TRERMFDFRKKVGEKFEEKKRHMEERSRQIVEKMRG  743



>emb|CDX96454.1| BnaA07g30650D [Brassica napus]
Length=745

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 3/43 (7%)
 Frame = -1

Query  317  KRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            K+MG   TR +M    KK+GEK EEK+RH+EE+ R IVEKMRG
Sbjct  705  KKMG---TRERMFDFRKKVGEKFEEKKRHMEERSRQIVEKMRG  744



>ref|XP_010069545.1| PREDICTED: uncharacterized protein LOC104456447 isoform X1 [Eucalyptus 
grandis]
 gb|KCW57933.1| hypothetical protein EUGRSUZ_H00671 [Eucalyptus grandis]
Length=783

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 6/50 (12%)
 Frame = -1

Query  338  EYHIAEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            E+  A PKR+G    RA+ML L KKMGEKLE   R IEEK +H+VEKMRG
Sbjct  738  EHDDARPKRVG---RRARMLDLGKKMGEKLE---RQIEEKRKHLVEKMRG  781



>gb|EYU22323.1| hypothetical protein MIMGU_mgv1a007789mg [Erythranthe guttata]
Length=395

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 3/43 (7%)
 Frame = -1

Query  317  KRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            +R+G   TR +M GL KK+GEKL+ KRR IEEKGR  VE+MRG
Sbjct  355  RRIG---TRERMRGLGKKVGEKLDVKRRTIEEKGRSFVERMRG  394



>ref|XP_010069546.1| PREDICTED: uncharacterized protein LOC104456447 isoform X2 [Eucalyptus 
grandis]
 gb|KCW57932.1| hypothetical protein EUGRSUZ_H00671 [Eucalyptus grandis]
Length=781

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 6/50 (12%)
 Frame = -1

Query  338  EYHIAEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            E+  A PKR+G    RA+ML L KKMGEKLE   R IEEK +H+VEKMRG
Sbjct  736  EHDDARPKRVG---RRARMLDLGKKMGEKLE---RQIEEKRKHLVEKMRG  779



>ref|XP_006599667.1| PREDICTED: uncharacterized protein LOC100812281 isoform X1 [Glycine 
max]
 ref|XP_006599668.1| PREDICTED: uncharacterized protein LOC100812281 isoform X2 [Glycine 
max]
Length=820

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            + PK++G    R K+L L K++ EKLEE++R+ EEK RHIVEKMRG
Sbjct  777  SRPKKIG---RREKILDLKKRVSEKLEEQKRNFEEKSRHIVEKMRG  819



>gb|KHN24469.1| Testis-expressed sequence 2 protein [Glycine soja]
Length=815

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            + PK++G    R K+L L K++ EKLEE++R+ EEK RHIVEKMRG
Sbjct  772  SRPKKIG---RREKILDLKKRVSEKLEEQKRNFEEKSRHIVEKMRG  814



>ref|XP_006599669.1| PREDICTED: uncharacterized protein LOC100812281 isoform X3 [Glycine 
max]
Length=815

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            + PK++G    R K+L L K++ EKLEE++R+ EEK RHIVEKMRG
Sbjct  772  SRPKKIG---RREKILDLKKRVSEKLEEQKRNFEEKSRHIVEKMRG  814



>ref|XP_007152502.1| hypothetical protein PHAVU_004G135600g [Phaseolus vulgaris]
 gb|ESW24496.1| hypothetical protein PHAVU_004G135600g [Phaseolus vulgaris]
Length=808

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = -1

Query  326  AEPKRMGLGSTRAKMLGLSKKMGEKLEEKRRHIEEKGRHIVEKMRG  189
            + P+++G    + +ML L K+M EK EEK+R+ EEKGR+IVEKMRG
Sbjct  765  SRPRKIG---RKERMLDLKKRMSEKFEEKKRNFEEKGRNIVEKMRG  807



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 778590373395