BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF045E17

Length=563
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006385204.1|  hypothetical protein POPTR_0003s011002g            110   3e-27   
ref|XP_009390763.1|  PREDICTED: transmembrane 9 superfamily membe...    113   8e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003524235.1|  PREDICTED: transmembrane 9 superfamily membe...    113   2e-25   Glycine max [soybeans]
ref|XP_006580221.1|  PREDICTED: transmembrane 9 superfamily membe...    112   2e-25   Glycine max [soybeans]
ref|XP_003531298.1|  PREDICTED: transmembrane 9 superfamily membe...    112   2e-25   Glycine max [soybeans]
ref|XP_006585219.1|  PREDICTED: transmembrane 9 superfamily membe...    112   2e-25   Glycine max [soybeans]
ref|XP_001785033.1|  predicted protein                                  107   2e-24   
ref|XP_001785045.1|  predicted protein                                  108   6e-24   
gb|EPS65883.1|  hypothetical protein M569_08888                         107   1e-23   Genlisea aurea
ref|XP_009615816.1|  PREDICTED: transmembrane 9 superfamily membe...    100   1e-23   
ref|NP_001146830.1|  uncharacterized protein LOC100280437             99.0    6e-23   
dbj|BAF01745.1|  putative endomembrane protein EMP70 precusor isolog  98.2    2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001182857.1|  uncharacterized protein LOC100501115 precursor   99.4    3e-22   
ref|XP_011096274.1|  PREDICTED: transmembrane 9 superfamily membe...    103   3e-22   Sesamum indicum [beniseed]
ref|XP_011074960.1|  PREDICTED: transmembrane 9 superfamily membe...    103   4e-22   Sesamum indicum [beniseed]
ref|XP_010030126.1|  PREDICTED: transmembrane 9 superfamily member 3    103   4e-22   Eucalyptus grandis [rose gum]
gb|EYU28222.1|  hypothetical protein MIMGU_mgv1a003468mg                103   4e-22   Erythranthe guttata [common monkey flower]
ref|XP_004248848.1|  PREDICTED: transmembrane 9 superfamily membe...    103   6e-22   Solanum lycopersicum
ref|XP_010682931.1|  PREDICTED: transmembrane 9 superfamily member 1    103   6e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006339920.1|  PREDICTED: transmembrane 9 superfamily membe...    102   6e-22   Solanum tuberosum [potatoes]
ref|XP_006367366.1|  PREDICTED: transmembrane 9 superfamily membe...    102   7e-22   Solanum tuberosum [potatoes]
ref|XP_009600607.1|  PREDICTED: transmembrane 9 superfamily membe...    102   8e-22   Nicotiana tomentosiformis
ref|XP_004250432.1|  PREDICTED: transmembrane 9 superfamily member 3    102   8e-22   Solanum lycopersicum
ref|XP_009763454.1|  PREDICTED: transmembrane 9 superfamily membe...    102   8e-22   Nicotiana sylvestris
ref|XP_008218557.1|  PREDICTED: transmembrane 9 superfamily member 3    102   9e-22   Prunus mume [ume]
ref|XP_009796637.1|  PREDICTED: transmembrane 9 superfamily membe...    102   9e-22   Nicotiana sylvestris
ref|NP_001140443.1|  uncharacterized protein LOC100272502             96.3    1e-21   
emb|CDX94774.1|  BnaC07g17830D                                          102   1e-21   
emb|CDY20974.1|  BnaA08g25510D                                          102   1e-21   Brassica napus [oilseed rape]
emb|CDY20592.1|  BnaC08g14660D                                          102   1e-21   Brassica napus [oilseed rape]
gb|KJB47459.1|  hypothetical protein B456_008G027700                    100   1e-21   Gossypium raimondii
gb|KJB12212.1|  hypothetical protein B456_002G006200                    102   1e-21   Gossypium raimondii
gb|KFK43390.1|  hypothetical protein AALP_AA1G119800                    102   1e-21   Arabis alpina [alpine rockcress]
emb|CDY19333.1|  BnaC05g08420D                                          102   1e-21   Brassica napus [oilseed rape]
emb|CDX97924.1|  BnaA06g06750D                                          101   1e-21   
emb|CDY34861.1|  BnaA09g47870D                                          101   2e-21   Brassica napus [oilseed rape]
ref|XP_009144405.1|  PREDICTED: transmembrane 9 superfamily membe...    101   2e-21   Brassica rapa
ref|XP_006417401.1|  hypothetical protein EUTSA_v10007167mg             101   2e-21   Eutrema salsugineum [saltwater cress]
gb|KJB79239.1|  hypothetical protein B456_013G038900                    100   2e-21   Gossypium raimondii
ref|XP_009148436.1|  PREDICTED: transmembrane 9 superfamily membe...    101   2e-21   Brassica rapa
emb|CDY34667.1|  BnaC08g42260D                                          102   2e-21   Brassica napus [oilseed rape]
gb|AFX67030.1|  endomembrane protein emp70                            99.4    2e-21   Solanum tuberosum [potatoes]
ref|XP_008339497.1|  PREDICTED: transmembrane 9 superfamily membe...    101   2e-21   
ref|XP_007221993.1|  hypothetical protein PRUPE_ppa003254mg             101   2e-21   Prunus persica
ref|XP_009348753.1|  PREDICTED: transmembrane 9 superfamily membe...    101   2e-21   Pyrus x bretschneideri [bai li]
ref|XP_006431823.1|  hypothetical protein CICLE_v10000670mg             101   2e-21   Citrus clementina [clementine]
gb|ACG29787.1|  transmembrane 9 superfamily protein member 3 prec...    101   2e-21   Zea mays [maize]
ref|XP_009390071.1|  PREDICTED: transmembrane 9 superfamily membe...    101   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP38816.1|  hypothetical protein JCGZ_04973                         101   2e-21   Jatropha curcas
ref|XP_009355251.1|  PREDICTED: transmembrane 9 superfamily membe...    101   2e-21   Pyrus x bretschneideri [bai li]
ref|XP_006471014.1|  PREDICTED: transmembrane 9 superfamily membe...    101   2e-21   Citrus sinensis [apfelsine]
ref|XP_008667101.1|  PREDICTED: uncharacterized protein LOC100192...    101   2e-21   
ref|XP_008378878.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    101   2e-21   Malus domestica [apple tree]
emb|CDO97576.1|  unnamed protein product                                101   2e-21   Coffea canephora [robusta coffee]
ref|XP_008456054.1|  PREDICTED: transmembrane 9 superfamily member 3    101   2e-21   Cucumis melo [Oriental melon]
ref|XP_002449107.1|  hypothetical protein SORBIDRAFT_05g005240          101   3e-21   Sorghum bicolor [broomcorn]
ref|XP_011464826.1|  PREDICTED: transmembrane 9 superfamily member 1    101   3e-21   Fragaria vesca subsp. vesca
ref|XP_002530674.1|  endomembrane protein emp70, putative               101   3e-21   Ricinus communis
ref|XP_004146261.1|  PREDICTED: transmembrane 9 superfamily membe...    101   3e-21   
gb|KJB77692.1|  hypothetical protein B456_012G151500                    101   3e-21   Gossypium raimondii
ref|XP_007148532.1|  hypothetical protein PHAVU_006G216500g             101   3e-21   Phaseolus vulgaris [French bean]
gb|KJB79238.1|  hypothetical protein B456_013G038900                    101   3e-21   Gossypium raimondii
ref|XP_004978867.1|  PREDICTED: transmembrane 9 superfamily membe...    100   3e-21   Setaria italica
ref|NP_001065897.1|  Os11g0181100                                       100   3e-21   
gb|KGN57596.1|  hypothetical protein Csa_3G222780                       101   3e-21   Cucumis sativus [cucumbers]
gb|AAL07091.2|  putative endomembrane protein EMP70 precusor isolog   99.8    3e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AGE46034.1|  putative transmembrane 9 superfamily member 3 pro...    100   3e-21   Elaeis guineensis
gb|KHN11244.1|  Transmembrane 9 superfamily member 3                    100   3e-21   Glycine soja [wild soybean]
ref|XP_009602812.1|  PREDICTED: transmembrane 9 superfamily membe...    100   3e-21   Nicotiana tomentosiformis
gb|KHG21692.1|  Transmembrane 9 superfamily member 3                    100   3e-21   Gossypium arboreum [tree cotton]
gb|KHG27380.1|  Tm9sf3                                                  100   3e-21   Gossypium arboreum [tree cotton]
ref|XP_009776073.1|  PREDICTED: transmembrane 9 superfamily membe...    100   3e-21   Nicotiana sylvestris
ref|XP_003532994.1|  PREDICTED: transmembrane 9 superfamily membe...    100   3e-21   Glycine max [soybeans]
ref|XP_008662281.1|  PREDICTED: uncharacterized protein LOC100501...    100   3e-21   
gb|KHN45466.1|  Transmembrane 9 superfamily member 3                    100   3e-21   Glycine soja [wild soybean]
dbj|BAJ96423.1|  predicted protein                                      100   4e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB47458.1|  hypothetical protein B456_008G027700                    100   4e-21   Gossypium raimondii
ref|XP_010238659.1|  PREDICTED: transmembrane 9 superfamily membe...    100   4e-21   Brachypodium distachyon [annual false brome]
ref|XP_006349354.1|  PREDICTED: transmembrane 9 superfamily membe...    100   4e-21   Solanum tuberosum [potatoes]
ref|XP_006664390.1|  PREDICTED: transmembrane 9 superfamily membe...    100   4e-21   Oryza brachyantha
ref|NP_001066292.1|  Os12g0175700                                       100   4e-21   
ref|XP_003540158.1|  PREDICTED: transmembrane 9 superfamily membe...    100   4e-21   Glycine max [soybeans]
ref|XP_007042269.1|  Transmembrane nine 1                               100   4e-21   
dbj|BAJ86318.1|  predicted protein                                      100   4e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003577775.1|  PREDICTED: transmembrane 9 superfamily member 3    100   4e-21   Brachypodium distachyon [annual false brome]
gb|EMS58779.1|  Transmembrane 9 superfamily member 3                    100   4e-21   Triticum urartu
gb|KJB79240.1|  hypothetical protein B456_013G038900                    100   4e-21   Gossypium raimondii
ref|XP_006304923.1|  hypothetical protein CARUB_v10011995mg             100   4e-21   Capsella rubella
ref|XP_010458475.1|  PREDICTED: transmembrane 9 superfamily membe...    100   4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010492178.1|  PREDICTED: transmembrane 9 superfamily membe...    100   4e-21   Camelina sativa [gold-of-pleasure]
tpg|DAA55531.1|  TPA: hypothetical protein ZEAMMB73_446969              100   4e-21   
ref|NP_563881.1|  transmembrane nine 1                                  100   4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889842.1|  hypothetical protein ARALYDRAFT_471233             100   4e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_010930775.1|  PREDICTED: transmembrane 9 superfamily member 1    100   4e-21   Elaeis guineensis
ref|XP_008781558.1|  PREDICTED: transmembrane 9 superfamily membe...    100   5e-21   Phoenix dactylifera
ref|XP_010912522.1|  PREDICTED: transmembrane 9 superfamily membe...    100   5e-21   Elaeis guineensis
ref|XP_010912523.1|  PREDICTED: transmembrane 9 superfamily membe...    100   5e-21   
ref|XP_010475983.1|  PREDICTED: transmembrane 9 superfamily membe...    100   5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010665394.1|  PREDICTED: transmembrane 9 superfamily member 1    100   5e-21   
gb|AAB65482.1|  endomembrane protein EMP70 precusor isolog; 68664...    100   5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002442907.1|  hypothetical protein SORBIDRAFT_08g004730          100   5e-21   Sorghum bicolor [broomcorn]
ref|XP_008783371.1|  PREDICTED: transmembrane 9 superfamily membe...    100   5e-21   Phoenix dactylifera
ref|XP_010553598.1|  PREDICTED: transmembrane 9 superfamily membe...    100   5e-21   Tarenaya hassleriana [spider flower]
ref|XP_010910845.1|  PREDICTED: transmembrane 9 superfamily membe...    100   6e-21   Elaeis guineensis
emb|CAN77106.1|  hypothetical protein VITISV_037096                     100   6e-21   Vitis vinifera
ref|XP_010682854.1|  PREDICTED: transmembrane 9 superfamily membe...    100   6e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006392091.1|  hypothetical protein EUTSA_v10023368mg           99.0    6e-21   
ref|XP_004230474.1|  PREDICTED: transmembrane 9 superfamily membe...    100   7e-21   Solanum lycopersicum
ref|XP_006662781.1|  PREDICTED: transmembrane 9 superfamily membe...  99.8    7e-21   
ref|XP_008781557.1|  PREDICTED: transmembrane 9 superfamily membe...  99.8    8e-21   
dbj|BAJ87519.1|  predicted protein                                    99.8    8e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011028284.1|  PREDICTED: transmembrane 9 superfamily member 1  99.8    8e-21   Populus euphratica
emb|CDY54577.1|  BnaCnng27330D                                        99.4    8e-21   Brassica napus [oilseed rape]
gb|EYU22789.1|  hypothetical protein MIMGU_mgv1a003460mg              99.8    8e-21   Erythranthe guttata [common monkey flower]
ref|XP_010272575.1|  PREDICTED: transmembrane 9 superfamily membe...  98.6    8e-21   Nelumbo nucifera [Indian lotus]
gb|EMT08384.1|  Transmembrane 9 superfamily member 3                  99.4    9e-21   
ref|XP_006384984.1|  endomembrane protein 70                          99.4    9e-21   
ref|XP_007159578.1|  hypothetical protein PHAVU_002G249200g           99.4    9e-21   Phaseolus vulgaris [French bean]
ref|XP_004485475.1|  PREDICTED: transmembrane 9 superfamily membe...  99.4    1e-20   Cicer arietinum [garbanzo]
emb|CDY03772.1|  BnaC01g28890D                                        99.4    1e-20   
ref|XP_006392092.1|  hypothetical protein EUTSA_v10023368mg           99.4    1e-20   Eutrema salsugineum [saltwater cress]
ref|XP_011009384.1|  PREDICTED: transmembrane 9 superfamily membe...  99.4    1e-20   Populus euphratica
ref|XP_004485474.1|  PREDICTED: transmembrane 9 superfamily membe...  99.4    1e-20   Cicer arietinum [garbanzo]
emb|CDY46193.1|  BnaA01g23150D                                        99.4    1e-20   Brassica napus [oilseed rape]
emb|CDY33319.1|  BnaAnng04300D                                        99.0    1e-20   Brassica napus [oilseed rape]
ref|XP_004977232.1|  PREDICTED: transmembrane 9 superfamily membe...  99.4    1e-20   Setaria italica
ref|XP_009104187.1|  PREDICTED: transmembrane 9 superfamily membe...  99.4    1e-20   Brassica rapa
gb|KFK40744.1|  hypothetical protein AALP_AA2G035500                  99.4    1e-20   Arabis alpina [alpine rockcress]
ref|XP_009124655.1|  PREDICTED: transmembrane 9 superfamily membe...  99.4    1e-20   
emb|CDY12876.1|  BnaA09g13980D                                        99.0    1e-20   Brassica napus [oilseed rape]
emb|CDY44834.1|  BnaCnng11900D                                        99.0    1e-20   Brassica napus [oilseed rape]
ref|XP_009113237.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  99.0    1e-20   
ref|XP_004504187.1|  PREDICTED: transmembrane 9 superfamily membe...  99.0    2e-20   Cicer arietinum [garbanzo]
ref|XP_011092339.1|  PREDICTED: transmembrane 9 superfamily membe...  97.8    2e-20   
ref|XP_003592977.1|  Transmembrane 9 superfamily protein member       97.4    2e-20   
ref|XP_003629959.1|  Transmembrane 9 superfamily protein member       99.0    2e-20   Medicago truncatula
ref|XP_002269498.1|  PREDICTED: transmembrane 9 superfamily member 1  99.0    2e-20   Vitis vinifera
ref|XP_009379854.1|  PREDICTED: transmembrane 9 superfamily membe...  98.6    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010246919.1|  PREDICTED: transmembrane 9 superfamily member 3  98.6    2e-20   Nelumbo nucifera [Indian lotus]
emb|CDY54580.1|  BnaCnng27350D                                        98.6    2e-20   Brassica napus [oilseed rape]
ref|XP_008807671.1|  PREDICTED: transmembrane 9 superfamily membe...  98.6    2e-20   Phoenix dactylifera
ref|XP_010235535.1|  PREDICTED: transmembrane 9 superfamily membe...  98.6    2e-20   Brachypodium distachyon [annual false brome]
ref|XP_003592976.1|  Transmembrane 9 superfamily protein member       98.6    2e-20   Medicago truncatula
ref|XP_011092338.1|  PREDICTED: transmembrane 9 superfamily membe...  98.2    3e-20   Sesamum indicum [beniseed]
ref|XP_004952828.1|  PREDICTED: transmembrane 9 superfamily membe...  98.2    3e-20   Setaria italica
ref|XP_010547447.1|  PREDICTED: transmembrane 9 superfamily membe...  98.2    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_008681382.1|  PREDICTED: uncharacterized protein LOC100272...  97.8    3e-20   Zea mays [maize]
ref|XP_008681381.1|  PREDICTED: uncharacterized protein LOC100272...  97.8    3e-20   Zea mays [maize]
ref|XP_002452255.1|  hypothetical protein SORBIDRAFT_04g022500        97.8    4e-20   Sorghum bicolor [broomcorn]
ref|XP_009404976.1|  PREDICTED: transmembrane 9 superfamily membe...  97.8    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404975.1|  PREDICTED: transmembrane 9 superfamily membe...  97.4    5e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007509634.1|  predicted protein                                97.4    6e-20   Bathycoccus prasinos
ref|NP_001047104.1|  Os02g0552000                                     97.1    7e-20   
ref|XP_006648727.1|  PREDICTED: transmembrane 9 superfamily membe...  97.1    7e-20   
ref|XP_010533958.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  97.1    8e-20   Tarenaya hassleriana [spider flower]
ref|XP_006859169.1|  hypothetical protein AMTR_s00070p00145350        96.7    1e-19   Amborella trichopoda
gb|KDD76545.1|  endomembrane protein 70                               96.3    1e-19   Helicosporidium sp. ATCC 50920
ref|XP_005645983.1|  hypothetical protein COCSUDRAFT_53991            95.9    2e-19   Coccomyxa subellipsoidea C-169
gb|ADE75730.1|  unknown                                               87.8    2e-19   Picea sitchensis
ref|XP_011395771.1|  Transmembrane 9 superfamily member 3             94.0    1e-18   Auxenochlorella protothecoides
ref|XP_002960054.1|  hypothetical protein SELMODRAFT_163520           93.2    2e-18   Selaginella moellendorffii
ref|XP_002984084.1|  hypothetical protein SELMODRAFT_156331           93.2    2e-18   
ref|XP_005845268.1|  hypothetical protein CHLNCDRAFT_36511            92.4    3e-18   Chlorella variabilis
ref|XP_004241844.1|  PREDICTED: transmembrane 9 superfamily membe...  90.9    1e-17   Solanum lycopersicum
ref|XP_006356503.1|  PREDICTED: transmembrane 9 superfamily membe...  89.0    4e-17   Solanum tuberosum [potatoes]
ref|XP_003061693.1|  predicted protein                                89.0    5e-17   Micromonas pusilla CCMP1545
ref|XP_004335868.1|  endomembrane protein EMP70 precursor isolog,...  88.2    7e-17   Acanthamoeba castellanii str. Neff
ref|XP_009631163.1|  PREDICTED: transmembrane 9 superfamily membe...  86.3    3e-16   
ref|XP_009788011.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    5e-16   Nicotiana sylvestris
ref|XP_009631162.1|  PREDICTED: transmembrane 9 superfamily membe...  85.9    5e-16   Nicotiana tomentosiformis
ref|XP_002945998.1|  hypothetical protein VOLCADRAFT_72231            85.1    1e-15   Volvox carteri f. nagariensis
ref|XP_002509072.1|  predicted protein                                84.3    2e-15   Micromonas commoda
emb|CCA19624.1|  endomembrane protein 70like protein putative         79.7    7e-14   Albugo laibachii Nc14
gb|ETI36484.1|  hypothetical protein F443_17408                       79.0    1e-13   Phytophthora parasitica P1569
emb|CBN79799.1|  conserved unknown protein                            75.5    2e-13   Ectocarpus siliculosus
ref|XP_004347030.2|  transmembrane protein TM9SF3                     78.2    2e-13   Capsaspora owczarzaki ATCC 30864
ref|XP_005836386.1|  hypothetical protein GUITHDRAFT_67884            77.8    3e-13   Guillardia theta CCMP2712
gb|EFX85753.1|  hypothetical protein DAPPUDRAFT_313523                77.8    3e-13   Daphnia pulex
emb|CCI39563.1|  unnamed protein product                              77.4    3e-13   Albugo candida
emb|CCI39562.1|  unnamed protein product                              77.4    3e-13   Albugo candida
ref|XP_008895867.1|  hypothetical protein PPTG_03848                  77.4    3e-13   Phytophthora parasitica INRA-310
gb|ETK76715.1|  hypothetical protein L915_16929                       77.4    4e-13   Phytophthora parasitica
ref|XP_002903970.1|  endomembrane protein 70-like protein, putative   77.4    4e-13   Phytophthora infestans T30-4
gb|ETI36485.1|  hypothetical protein, variant 1                       77.4    4e-13   Phytophthora parasitica P1569
ref|XP_008895868.1|  hypothetical protein, variant 2                  77.4    4e-13   Phytophthora parasitica INRA-310
gb|ETK76717.1|  hypothetical protein, variant 2                       77.4    4e-13   Phytophthora parasitica
ref|XP_009524748.1|  hypothetical protein PHYSODRAFT_299515           77.4    4e-13   Phytophthora sojae
gb|EWM22128.1|  transmembrane 9 superfamily member 3                  77.0    5e-13   Nannochloropsis gaditana
ref|XP_005768973.1|  hypothetical protein EMIHUDRAFT_60571            72.4    9e-13   Emiliania huxleyi CCMP1516
ref|XP_008868877.1|  hypothetical protein H310_05822                  76.3    9e-13   Aphanomyces invadans
ref|XP_004622652.1|  PREDICTED: transmembrane 9 superfamily membe...  72.4    1e-12   Sorex araneus [Eurasian shrew]
ref|XP_002083749.1|  GD13184                                          75.5    2e-12   
ref|XP_009827098.1|  hypothetical protein, variant                    75.1    2e-12   Aphanomyces astaci
ref|XP_002679262.1|  predicted protein                                75.1    2e-12   Naegleria gruberi strain NEG-M
ref|XP_001698971.1|  EMP/nonaspanin domain family protein             75.1    2e-12   Chlamydomonas reinhardtii
ref|XP_008614772.1|  hypothetical protein SDRG_10554                  73.2    1e-11   Saprolegnia diclina VS20
emb|CDW55076.1|  Transmembrane 9 superfamily                          72.8    1e-11   Trichuris trichiura
ref|XP_004932208.1|  PREDICTED: transmembrane 9 superfamily membe...  72.8    1e-11   Bombyx mori [silk moth]
gb|KFO35950.1|  Phosphoinositide 3-kinase adapter protein 1           73.2    2e-11   Fukomys damarensis [Damara mole rat]
ref|XP_002426886.1|  conserved hypothetical protein                   71.6    3e-11   Pediculus humanus corporis [human body lice]
gb|EHJ69950.1|  putative endomembrane protein emp70                   71.2    4e-11   
ref|XP_001950058.1|  PREDICTED: transmembrane 9 superfamily member 3  70.9    5e-11   Acyrthosiphon pisum
gb|ETN57960.1|  hypothetical protein AND_010453                       71.2    6e-11   Anopheles darlingi [American malaria mosquito]
gb|KDO15767.1|  hypothetical protein SPRG_18692                       70.1    8e-11   Saprolegnia parasitica CBS 223.65
gb|KDO27371.1|  hypothetical protein SPRG_06957                       70.5    8e-11   Saprolegnia parasitica CBS 223.65
ref|XP_785201.2|  PREDICTED: transmembrane 9 superfamily member 3     69.7    1e-10   Strongylocentrotus purpuratus [purple urchin]
dbj|GAA29282.2|  transmembrane 9 superfamily member 3                 68.9    2e-10   Clonorchis sinensis [oriental liver fluke]
ref|XP_009511961.1|  PREDICTED: transmembrane 9 superfamily member 3  66.2    2e-10   Phalacrocorax carbo [common cormorant]
ref|XP_008471864.1|  PREDICTED: transmembrane 9 superfamily membe...  68.6    3e-10   
ref|XP_008428273.1|  PREDICTED: transmembrane 9 superfamily membe...  68.6    4e-10   Poecilia reticulata
ref|XP_007566966.1|  PREDICTED: transmembrane 9 superfamily member 3  68.6    4e-10   Poecilia formosa
ref|XP_005795250.1|  PREDICTED: transmembrane 9 superfamily membe...  68.6    4e-10   Xiphophorus maculatus
ref|XP_006630785.1|  PREDICTED: transmembrane 9 superfamily membe...  68.6    4e-10   Lepisosteus oculatus
ref|XP_010732838.1|  PREDICTED: transmembrane 9 superfamily member 3  68.2    4e-10   
ref|XP_008282853.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  68.6    4e-10   Stegastes partitus
ref|XP_006799085.1|  PREDICTED: transmembrane 9 superfamily membe...  68.6    4e-10   Neolamprologus brichardi [lyretail cichlid]
ref|XP_009976834.1|  PREDICTED: transmembrane 9 superfamily member 3  66.2    4e-10   Tauraco erythrolophus
ref|XP_009173090.1|  hypothetical protein T265_08898                  68.2    4e-10   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_007258750.1|  PREDICTED: transmembrane 9 superfamily membe...  68.2    4e-10   Astyanax mexicanus [blind cave fish]
ref|XP_004559661.1|  PREDICTED: transmembrane 9 superfamily membe...  68.2    4e-10   Maylandia zebra
ref|XP_003963762.1|  PREDICTED: transmembrane 9 superfamily membe...  68.2    4e-10   Takifugu rubripes [tiger puffer]
ref|XP_005735123.1|  PREDICTED: transmembrane 9 superfamily membe...  68.2    4e-10   Pundamilia nyererei
ref|XP_007902753.1|  PREDICTED: transmembrane 9 superfamily member 3  68.2    4e-10   Callorhinchus milii [Australian ghost shark]
ref|XP_002062013.1|  GK16877                                          68.2    4e-10   Drosophila willistoni
ref|XP_008428274.1|  PREDICTED: transmembrane 9 superfamily membe...  68.2    4e-10   Poecilia reticulata
ref|XP_003441118.1|  PREDICTED: transmembrane 9 superfamily member 3  68.2    4e-10   Oreochromis niloticus
ref|XP_001972005.1|  GG14121                                          68.2    4e-10   Drosophila erecta
ref|NP_998554.1|  transmembrane 9 superfamily member 3 precursor      68.2    4e-10   Danio rerio [leopard danio]
ref|XP_001984443.1|  GH15015                                          68.2    4e-10   Drosophila grimshawi
ref|XP_010779545.1|  PREDICTED: transmembrane 9 superfamily member 3  68.2    4e-10   Notothenia coriiceps [yellowbelly rockcod]
dbj|BAG60075.1|  unnamed protein product                              66.2    4e-10   Homo sapiens [man]
ref|XP_002093812.1|  GE20545                                          68.2    4e-10   Drosophila yakuba
ref|XP_002035457.1|  GM13907                                          68.2    4e-10   Drosophila sechellia
ref|XP_002025369.1|  GL11985                                          68.2    4e-10   
ref|XP_001957525.1|  GF10453                                          68.2    5e-10   
ref|XP_002047393.1|  GJ11952                                          68.2    5e-10   Drosophila virilis
ref|NP_647979.1|  CG10590                                             68.2    5e-10   Drosophila melanogaster
ref|XP_001662153.1|  AAEL012016-PA                                    68.2    5e-10   Aedes aegypti
ref|XP_011352435.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    5e-10   Ooceraea biroi
ref|XP_008320400.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    5e-10   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_011259429.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    5e-10   Camponotus floridanus
ref|XP_011155183.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    5e-10   Harpegnathos saltator
ref|XP_003787418.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   
ref|XP_008205311.1|  PREDICTED: transmembrane 9 superfamily membe...  67.8    6e-10   
ref|XP_007080322.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   
ref|XP_001656277.1|  AAEL012833-PA                                    67.8    6e-10   
ref|XP_001353740.2|  GA10420                                          67.8    6e-10   Drosophila pseudoobscura pseudoobscura
ref|XP_006157459.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   
ref|XP_011163701.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Solenopsis invicta [imported red fire ant]
emb|CDQ61092.1|  unnamed protein product                              67.8    6e-10   Oncorhynchus mykiss
gb|AAF21983.1|  SM-11044 binding protein                              67.8    6e-10   Homo sapiens [man]
ref|XP_011303436.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Fopius arisanus
ref|NP_001180146.1|  transmembrane 9 superfamily member 3 precursor   67.8    6e-10   Bos taurus [bovine]
ref|XP_011056752.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Acromyrmex echinatior
ref|XP_002936010.2|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Xenopus tropicalis [western clawed frog]
ref|XP_011285801.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   
ref|XP_010387883.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Rhinopithecus roxellana
ref|NP_001135200.1|  Transmembrane 9 superfamily member 3 precursor   67.8    6e-10   Salmo salar
ref|XP_004580070.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Ochotona princeps [southern American pika]
ref|XP_003704134.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Megachile rotundata
ref|XP_004409540.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Odobenus rosmarus divergens
ref|XP_849773.1|  PREDICTED: transmembrane 9 superfamily member 3...  67.8    6e-10   Canis lupus familiaris [dogs]
ref|XP_004616433.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    6e-10   Sorex araneus [Eurasian shrew]
gb|AAF98159.1|AF269150_1  transmembrane protein TM9SF3                67.8    6e-10   Homo sapiens [man]
ref|XP_003399780.1|  PREDICTED: transmembrane 9 superfamily membe...  67.8    6e-10   
ref|XP_006831254.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Chrysochloris asiatica
ref|XP_004838634.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Heterocephalus glaber [naked mole rat]
ref|XP_001101439.1|  PREDICTED: transmembrane 9 superfamily membe...  67.8    6e-10   Macaca mulatta [rhesus macaque]
dbj|BAB55110.1|  unnamed protein product                              66.6    6e-10   Homo sapiens [man]
ref|NP_064508.3|  transmembrane 9 superfamily member 3 precursor      67.8    6e-10   Homo sapiens [man]
gb|AAH20959.2|  TM9SF3 protein                                        67.4    6e-10   Homo sapiens [man]
ref|XP_008684538.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Ursus maritimus [white bear]
gb|EDL41854.1|  mCG2375, isoform CRA_a                                67.4    6e-10   Mus musculus [mouse]
ref|XP_009895972.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    6e-10   Picoides pubescens
ref|XP_006014905.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Alligator sinensis
ref|XP_010712722.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    6e-10   Meleagris gallopavo [common turkey]
ref|XP_007532693.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Erinaceus europaeus [common hedgehog]
ref|XP_005407638.1|  PREDICTED: transmembrane 9 superfamily membe...  67.8    6e-10   
ref|XP_010896390.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   Esox lucius
ref|XP_004370030.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   
ref|XP_004268440.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   
ref|XP_004625742.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    6e-10   
ref|XP_005312131.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    7e-10   
ref|XP_006610901.1|  PREDICTED: transmembrane 9 superfamily membe...  67.8    7e-10   
ref|XP_006572161.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    7e-10   
ref|XP_003479606.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    7e-10   
ref|XP_007456252.1|  PREDICTED: transmembrane 9 superfamily member 3  67.8    7e-10   
ref|XP_010712721.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
gb|AAF67014.1|AF160213_1  endomembrane protein emp70 precursor is...  67.8    7e-10   
ref|NP_579930.1|  transmembrane 9 superfamily member 3 precursor      67.8    7e-10   
ref|XP_005481354.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_002821075.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  67.8    7e-10   
ref|XP_004892237.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_005407639.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
ref|XP_008830212.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_005352330.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
gb|EHB07803.1|  Transmembrane 9 superfamily member 3                  67.4    7e-10   
ref|XP_003698368.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  67.4    7e-10   
ref|XP_005407637.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
ref|XP_008502202.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_006263564.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
gb|ERE79680.1|  transmembrane 9 superfamily member 3                  67.4    7e-10   
ref|XP_007637675.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
ref|XP_006090050.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
dbj|BAC11232.1|  unnamed protein product                              67.0    7e-10   
ref|XP_007615223.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
ref|XP_004457032.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_001917123.3|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  67.8    7e-10   
ref|XP_010969423.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
gb|ELW49306.1|  Transmembrane 9 superfamily member 3                  67.4    7e-10   
ref|XP_005984512.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
gb|KFP68674.1|  Transmembrane 9 superfamily member 3                  67.4    7e-10   
ref|XP_005407641.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
gb|AAQ89178.1|  PATY245                                               67.4    7e-10   
gb|EDL41855.1|  mCG2375, isoform CRA_b                                67.4    7e-10   
ref|XP_006756739.1|  PREDICTED: transmembrane 9 superfamily member 3  67.0    7e-10   
ref|XP_421629.4|  PREDICTED: transmembrane 9 superfamily member 3     67.4    7e-10   
gb|ELR54176.1|  Transmembrane 9 superfamily member 3                  67.4    7e-10   
dbj|BAE91187.1|  unnamed protein product                              67.4    7e-10   
ref|XP_005997314.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_009951614.1|  PREDICTED: transmembrane 9 superfamily member 3  67.0    7e-10   
gb|KFP32607.1|  Transmembrane 9 superfamily member 3                  67.4    7e-10   
ref|XP_008948979.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  67.4    7e-10   
ref|XP_008142341.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_007187499.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_004680642.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
gb|EMC79922.1|  Transmembrane 9 superfamily member 3                  67.4    7e-10   
ref|XP_007441347.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
ref|XP_008641953.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_005520596.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_004701094.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_004427950.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_003255319.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_005637634.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
ref|XP_008773120.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
gb|ETE67718.1|  Transmembrane 9 superfamily member 3                  67.4    7e-10   
ref|XP_008932762.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_007053441.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_006116276.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_005048681.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_008942019.1|  PREDICTED: transmembrane 9 superfamily member 3  67.0    7e-10   
ref|XP_008057299.1|  PREDICTED: transmembrane 9 superfamily member 3  66.6    7e-10   
ref|XP_009669621.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_009470788.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
ref|XP_005153929.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_005025241.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
ref|XP_003223180.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_009705892.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_010409948.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
gb|KFU99061.1|  Transmembrane 9 superfamily member 3                  67.0    7e-10   
ref|XP_009574595.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
ref|XP_009916579.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    7e-10   
gb|EPQ19715.1|  Transmembrane 9 superfamily member 3                  67.4    7e-10   
ref|XP_004020122.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    7e-10   
gb|AAH04799.2|  Tm9sf3 protein                                        67.4    8e-10   
ref|XP_005416571.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    8e-10   
ref|XP_001604363.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    8e-10   
ref|XP_006992484.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    8e-10   
gb|EHH19260.1|  hypothetical protein EGK_19936                        67.4    8e-10   
ref|XP_009966566.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    8e-10   
ref|XP_009470713.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    8e-10   
ref|XP_004972768.1|  PREDICTED: putative phagocytic receptor 1b-l...  67.4    8e-10   
gb|ELK35693.1|  Transmembrane 9 superfamily member 3                  67.0    8e-10   
ref|XP_004077569.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    8e-10   
ref|XP_005025240.1|  PREDICTED: transmembrane 9 superfamily membe...  67.4    8e-10   
ref|XP_009478867.1|  PREDICTED: transmembrane 9 superfamily member 3  66.6    9e-10   
ref|XP_011499824.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    9e-10   
ref|XP_010018436.1|  PREDICTED: transmembrane 9 superfamily member 3  67.0    9e-10   
dbj|BAD90204.1|  mKIAA4036 protein                                    67.4    9e-10   
ref|XP_005885527.1|  PREDICTED: transmembrane 9 superfamily member 3  67.0    9e-10   
emb|CDQ58548.1|  unnamed protein product                              67.0    9e-10   
ref|XP_007654581.1|  PREDICTED: transmembrane 9 superfamily member 3  67.0    1e-09   
ref|XP_008520069.1|  PREDICTED: transmembrane 9 superfamily member 3  67.4    1e-09   
ref|XP_006849485.1|  hypothetical protein AMTR_s00024p00115620        67.0    1e-09   
ref|XP_002193887.2|  PREDICTED: transmembrane 9 superfamily member 3  67.0    1e-09   
emb|CAF90947.1|  unnamed protein product                              61.6    1e-09   
gb|EPS62158.1|  hypothetical protein M569_12635                       66.6    1e-09   
gb|EEE68090.1|  hypothetical protein OsJ_26137                        67.0    1e-09   
ref|XP_003755285.1|  PREDICTED: transmembrane 9 superfamily member 3  66.6    1e-09   
ref|XP_007478768.1|  PREDICTED: transmembrane 9 superfamily membe...  66.6    1e-09   
ref|XP_007478767.1|  PREDICTED: transmembrane 9 superfamily membe...  66.6    1e-09   
ref|XP_002007870.1|  GI13177                                          66.6    2e-09   
emb|CEP16327.1|  hypothetical protein                                 66.2    2e-09   
emb|CEJ05344.1|  hypothetical protein RMCBS344292_19287               65.5    2e-09   
ref|XP_001746206.1|  hypothetical protein                             66.6    2e-09   
ref|XP_004526831.1|  PREDICTED: transmembrane 9 superfamily membe...  66.2    2e-09   
ref|XP_001864917.1|  endomembrane protein emp70                       60.8    2e-09   
ref|XP_011203691.1|  PREDICTED: transmembrane 9 superfamily member 3  66.2    2e-09   
ref|XP_008555159.1|  PREDICTED: transmembrane 9 superfamily member 3  66.2    2e-09   
gb|EPB84661.1|  hypothetical protein HMPREF1544_08604                 66.2    2e-09   
ref|XP_011182989.1|  PREDICTED: transmembrane 9 superfamily member 3  65.9    2e-09   
ref|XP_002115408.1|  hypothetical protein TRIADDRAFT_29152            65.9    3e-09   
ref|XP_002290902.1|  endomembrane protein EMP70 precusor              65.9    3e-09   
ref|XP_008813153.1|  PREDICTED: putative phagocytic receptor 1b       65.9    3e-09   
emb|CEG80626.1|  hypothetical protein RMATCC62417_14930               65.9    3e-09   
gb|AIC62213.1|  TM9SF3                                                65.5    3e-09   
gb|KDD75073.1|  endomembrane protein 70                               65.5    3e-09   
gb|EIE90684.1|  hypothetical protein RO3G_15395                       65.5    3e-09   
gb|KFP89360.1|  Transmembrane 9 superfamily member 3                  65.5    3e-09   
ref|XP_009868517.1|  PREDICTED: transmembrane 9 superfamily member 3  65.5    3e-09   
ref|XP_010910473.1|  PREDICTED: transmembrane 9 superfamily membe...  65.5    3e-09   
ref|XP_003573450.1|  PREDICTED: putative phagocytic receptor 1b       65.5    3e-09   
ref|XP_001770691.1|  predicted protein                                65.5    3e-09   
ref|XP_006659860.1|  PREDICTED: putative phagocytic receptor 1b-like  65.5    3e-09   
ref|XP_010910475.1|  PREDICTED: transmembrane 9 superfamily membe...  65.1    3e-09   
gb|EMT19161.1|  Putative phagocytic receptor 1b                       65.5    3e-09   
dbj|BAJ89513.1|  predicted protein                                    65.5    3e-09   
ref|XP_006854108.1|  hypothetical protein AMTR_s00048p00146310        65.5    4e-09   
gb|EMS60954.1|  Putative phagocytic receptor 1b                       65.5    4e-09   
ref|XP_005186343.1|  PREDICTED: transmembrane 9 superfamily member 3  65.5    4e-09   
gb|KDR11018.1|  hypothetical protein L798_14383                       65.1    4e-09   
gb|EEC82941.1|  hypothetical protein OsI_27915                        65.5    4e-09   
ref|XP_008791844.1|  PREDICTED: putative phagocytic receptor 1b       65.5    4e-09   
emb|CEG68095.1|  hypothetical protein RMATCC62417_04417               64.7    4e-09   
dbj|BAC57816.1|  putative syntaxin SYP111                             65.1    4e-09   
emb|CEJ03838.1|  hypothetical protein RMCBS344292_17813               64.7    4e-09   
ref|XP_011399711.1|  Putative phagocytic receptor 1b                  65.1    4e-09   
ref|XP_009064505.1|  hypothetical protein LOTGIDRAFT_196341           65.1    4e-09   
ref|XP_004225719.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  65.1    4e-09   
ref|XP_005092501.1|  PREDICTED: transmembrane 9 superfamily membe...  64.7    5e-09   
ref|XP_003737486.1|  PREDICTED: uncharacterized protein LOC100897570  65.1    5e-09   
ref|XP_011431162.1|  PREDICTED: transmembrane 9 superfamily membe...  64.7    5e-09   
ref|XP_011404231.1|  PREDICTED: transmembrane 9 superfamily membe...  64.3    5e-09   
ref|XP_001630700.1|  predicted protein                                64.7    6e-09   
gb|ETN69974.1|  endomembrane protein 70                               64.7    6e-09   
ref|XP_008788644.1|  PREDICTED: putative phagocytic receptor 1b       64.7    6e-09   
dbj|BAA91362.1|  unnamed protein product                              64.3    7e-09   
ref|XP_004990450.1|  endomembrane protein emp70                       64.7    7e-09   
gb|ERG85277.1|  transmembrane 9 superfamily member 3                  64.3    9e-09   
gb|EGT53827.1|  hypothetical protein CAEBREN_03110                    64.3    9e-09   
gb|KHG09925.1|  Putative phagocytic receptor 1b                       64.3    9e-09   
emb|CDH93341.1|  Y41D4A.4, isoform c                                  63.9    9e-09   
ref|XP_003094144.1|  hypothetical protein CRE_13729                   64.3    9e-09   
gb|EKC24508.1|  Transmembrane 9 superfamily member 3                  64.3    9e-09   
gb|KJB08470.1|  hypothetical protein B456_001G083100                  63.9    9e-09   
ref|NP_500130.1|  Protein Y41D4A.4                                    63.9    9e-09   
emb|CDH93340.1|  Y41D4A.4, isoform b                                  63.9    9e-09   
ref|XP_002634585.1|  Hypothetical protein CBG08396                    63.9    9e-09   
emb|CDP05457.1|  unnamed protein product                              63.9    1e-08   
gb|ABR16201.1|  unknown                                               63.9    1e-08   
emb|CAB62549.1|  multispanning membrane protein 70                    59.3    1e-08   
ref|XP_010276746.1|  PREDICTED: putative phagocytic receptor 1b       63.9    1e-08   
gb|AAF01248.1|AF187853_1  putative multispanning membrane protein     59.7    1e-08   
ref|NP_001148367.1|  transmembrane 9 superfamily protein member 1...  63.5    1e-08   
gb|AAX96186.1|  Endomembrane protein 70                               63.5    1e-08   
ref|XP_967117.1|  PREDICTED: transmembrane 9 superfamily member 3     63.2    2e-08   
gb|EEZ99577.1|  hypothetical protein TcasGA2_TC001563                 63.2    2e-08   
gb|ELU00390.1|  hypothetical protein CAPTEDRAFT_170344                63.2    2e-08   
gb|KFM73388.1|  Transmembrane 9 superfamily member 3                  63.2    2e-08   
ref|XP_008798135.1|  PREDICTED: putative phagocytic receptor 1b       63.2    2e-08   
gb|ABK24901.1|  unknown                                               63.2    2e-08   
ref|XP_001422764.1|  predicted protein                                63.2    2e-08   
dbj|BAD12191.1|  SM-11044 binding protein                             62.4    2e-08   
ref|XP_010939968.1|  PREDICTED: transmembrane 9 superfamily membe...  62.8    2e-08   
ref|XP_010920041.1|  PREDICTED: transmembrane 9 superfamily membe...  62.8    2e-08   
ref|XP_009389646.1|  PREDICTED: putative phagocytic receptor 1b       62.8    3e-08   
ref|XP_002892454.1|  endomembrane protein 70 family protein           62.4    3e-08   
ref|XP_009408099.1|  PREDICTED: putative phagocytic receptor 1b       62.4    3e-08   
gb|ENN73181.1|  hypothetical protein YQE_10235                        62.4    3e-08   
gb|AEE63341.1|  unknown                                               62.4    3e-08   
gb|KHG03505.1|  Putative phagocytic receptor 1b                       62.4    3e-08   
ref|XP_009009848.1|  hypothetical protein HELRODRAFT_184872           62.4    3e-08   
gb|KHN75714.1|  Transmembrane 9 superfamily member 3                  62.4    4e-08   
ref|XP_002521899.1|  transporter, putative                            62.0    4e-08   
ref|XP_003143038.1|  endomembrane protein emp70                       62.0    4e-08   
emb|CDQ00788.1|  Protein Bm6514, isoform c                            62.0    4e-08   
gb|EJW85205.1|  endomembrane protein emp70                            62.0    5e-08   
ref|XP_002596465.1|  hypothetical protein BRAFLDRAFT_286243           62.0    5e-08   
emb|CDX95066.1|  BnaC05g06050D                                        61.6    5e-08   
ref|XP_009380058.1|  PREDICTED: putative phagocytic receptor 1b       61.6    5e-08   
gb|KDO36860.1|  hypothetical protein CISIN_1g029473mg                 59.3    5e-08   
emb|CEG02174.1|  Nonaspanin (TM9SF)                                   61.6    5e-08   
ref|XP_005850808.1|  hypothetical protein CHLNCDRAFT_29709            61.6    5e-08   
ref|XP_004972769.1|  PREDICTED: putative phagocytic receptor 1b-l...  61.6    6e-08   
gb|KDO24186.1|  hypothetical protein SPRG_10614                       61.6    7e-08   
ref|XP_009404153.1|  PREDICTED: putative phagocytic receptor 1b       61.2    7e-08   
ref|XP_011005915.1|  PREDICTED: transmembrane 9 superfamily membe...  61.2    8e-08   
gb|KDO18538.1|  hypothetical protein SPRG_16087                       61.2    8e-08   
gb|KJB43179.1|  hypothetical protein B456_007G188200                  61.2    9e-08   
gb|KJB43178.1|  hypothetical protein B456_007G188200                  60.8    9e-08   
ref|XP_006819376.1|  PREDICTED: transmembrane 9 superfamily membe...  60.8    9e-08   
emb|CDS07558.1|  hypothetical protein LRAMOSA01507                    60.8    9e-08   
ref|XP_002178644.1|  predicted protein                                60.8    1e-07   
ref|XP_005822074.1|  hypothetical protein GUITHDRAFT_166088           60.5    1e-07   
emb|CDX93569.1|  BnaA06g04790D                                        60.5    1e-07   
ref|XP_006364083.1|  PREDICTED: putative phagocytic receptor 1b-like  60.5    1e-07   
ref|XP_006307081.1|  hypothetical protein CARUB_v10008667mg           60.5    1e-07   
ref|XP_008617593.1|  hypothetical protein SDRG_13291                  60.5    1e-07   
ref|XP_010475630.1|  PREDICTED: putative phagocytic receptor 1b i...  60.1    2e-07   
ref|XP_011005913.1|  PREDICTED: transmembrane 9 superfamily membe...  60.1    2e-07   
gb|ABR26036.1|  transmembrane 9 superfamily protein member 1 prec...  57.4    2e-07   
ref|XP_006661606.1|  PREDICTED: putative phagocytic receptor 1b-like  60.1    2e-07   
ref|XP_010475629.1|  PREDICTED: putative phagocytic receptor 1b i...  60.1    2e-07   
ref|XP_010475626.1|  PREDICTED: putative phagocytic receptor 1b i...  60.1    2e-07   
ref|XP_002305925.2|  endomembrane protein 70                          60.1    2e-07   
ref|XP_006384123.1|  hypothetical protein POPTR_0004s07400g           60.1    2e-07   
ref|XP_010488760.1|  PREDICTED: putative phagocytic receptor 1b i...  59.7    2e-07   
ref|XP_006417702.1|  hypothetical protein EUTSA_v10007170mg           59.7    2e-07   
ref|XP_010488740.1|  PREDICTED: putative phagocytic receptor 1b i...  59.7    2e-07   
ref|NP_563812.1|  endomembrane protein 70                             59.7    2e-07   



>ref|XP_006385204.1| hypothetical protein POPTR_0003s011002g, partial [Populus trichocarpa]
 gb|ERP63001.1| hypothetical protein POPTR_0003s011002g, partial [Populus trichocarpa]
Length=113

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIYY+YVKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  56   YSIYYFYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  113



>ref|XP_009390763.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIYYYYVKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  530  YSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  587



>ref|XP_003524235.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN06492.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIYY+YVKTKMSGFFQ SFY GYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  533  YSIYYFYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  590



>ref|XP_006580221.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIYY+YVKTKMSGFFQ SFY GYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  530  YSIYYFYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  587



>ref|XP_003531298.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN48095.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIYY+YVKTKMSGFFQ SFY GYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  533  YSIYYFYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  590



>ref|XP_006585219.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIYY+YVKTKMSGFFQ SFY GYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  530  YSIYYFYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  587



>ref|XP_001785033.1| predicted protein [Physcomitrella patens]
 gb|EDQ50148.1| predicted protein, partial [Physcomitrella patens]
Length=325

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS+YY+Y+KTKMSGFFQ+SFY GYTLMFCLGLGI CGAVG+LGS++FVRRIYRNIKCD
Sbjct  268  YSVYYFYMKTKMSGFFQISFYFGYTLMFCLGLGIFCGAVGYLGSSMFVRRIYRNIKCD  325



>ref|XP_001785045.1| predicted protein [Physcomitrella patens]
 gb|EDQ50160.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS+YY+Y+KTKMSGFFQ+SFY GYTLMFCLGLGI CGAVG+LGS++FVRRIYRNIKCD
Sbjct  533  YSVYYFYMKTKMSGFFQISFYFGYTLMFCLGLGIFCGAVGYLGSSMFVRRIYRNIKCD  590



>gb|EPS65883.1| hypothetical protein M569_08888, partial [Genlisea aurea]
Length=558

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS+YYY+VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS+LFV+RIYRNIK D
Sbjct  501  YSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSDLFVKRIYRNIKLD  558



>ref|XP_009615816.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=106

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  55   HVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  106



>ref|NP_001146830.1| uncharacterized protein LOC100280437 [Zea mays]
 gb|ACL54836.1| unknown [Zea mays]
Length=106

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  55   HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  106



>dbj|BAF01745.1| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
Length=136

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  87   KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  136



>ref|NP_001182857.1| uncharacterized protein LOC100501115 precursor [Zea mays]
 gb|ACR34922.1| unknown [Zea mays]
Length=195

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  144  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  195



>ref|XP_011096274.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=583

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  532  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  583



>ref|XP_011074960.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=578

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  527  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  578



>ref|XP_010030126.1| PREDICTED: transmembrane 9 superfamily member 3 [Eucalyptus grandis]
 gb|KCW57092.1| hypothetical protein EUGRSUZ_I02743 [Eucalyptus grandis]
Length=585

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  534  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  585



>gb|EYU28222.1| hypothetical protein MIMGU_mgv1a003468mg [Erythranthe guttata]
Length=583

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  532  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  583



>ref|XP_004248848.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  539  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  588



>ref|XP_010682931.1| PREDICTED: transmembrane 9 superfamily member 1 [Beta vulgaris 
subsp. vulgaris]
Length=590

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKM+GFFQ+SFY GYT+MFCLGLGILCGAVGFLGSNLFVRRIY+NIKCD
Sbjct  539  HVKTKMTGFFQISFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYKNIKCD  590



>ref|XP_006339920.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  539  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  588



>ref|XP_006367366.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=582

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  531  HVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  582



>ref|XP_009600607.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  539  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  588



>ref|XP_004250432.1| PREDICTED: transmembrane 9 superfamily member 3 [Solanum lycopersicum]
Length=582

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  531  HVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  582



>ref|XP_009763454.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=582

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  531  HVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  582



>ref|XP_008218557.1| PREDICTED: transmembrane 9 superfamily member 3 [Prunus mume]
Length=589

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            + KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  538  HAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_009796637.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  539  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  588



>ref|NP_001140443.1| uncharacterized protein LOC100272502 [Zea mays]
 gb|ACF83850.1| unknown [Zea mays]
Length=125

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            ++KTKMSGFFQ SFY GYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  74   HMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  125



>emb|CDX94774.1| BnaC07g17830D [Brassica napus]
Length=585

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  536  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  585



>emb|CDY20974.1| BnaA08g25510D [Brassica napus]
Length=585

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  536  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  585



>emb|CDY20592.1| BnaC08g14660D [Brassica napus]
Length=585

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  536  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  585



>gb|KJB47459.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=400

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  351  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  400



>gb|KJB12212.1| hypothetical protein B456_002G006200 [Gossypium raimondii]
Length=592

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGA+GFLGSNLFVRRIYRNIKCD
Sbjct  543  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGFLGSNLFVRRIYRNIKCD  592



>gb|KFK43390.1| hypothetical protein AALP_AA1G119800 [Arabis alpina]
Length=587

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  538  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  587



>emb|CDY19333.1| BnaC05g08420D [Brassica napus]
Length=587

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  538  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  587



>emb|CDX97924.1| BnaA06g06750D [Brassica napus]
Length=590

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  541  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  590



>emb|CDY34861.1| BnaA09g47870D [Brassica napus]
Length=586

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  537  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  586



>ref|XP_009144405.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=585

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  536  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  585



>ref|XP_006417401.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
 gb|ESQ35754.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
Length=586

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  537  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  586



>gb|KJB79239.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=461

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  412  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  461



>ref|XP_009148436.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=590

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  541  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  590



>emb|CDY34667.1| BnaC08g42260D [Brassica napus]
Length=665

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  616  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  665



>gb|AFX67030.1| endomembrane protein emp70, partial [Solanum tuberosum]
Length=346

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  297  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  346



>ref|XP_008339497.1| PREDICTED: transmembrane 9 superfamily member 3-like [Malus domestica]
Length=589

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
             KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  539  AKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_007221993.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
 gb|EMJ23192.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
Length=589

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
             KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  539  AKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_009348753.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
             KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  539  AKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_006431823.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
 gb|ESR45063.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
Length=587

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  538  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587



>gb|ACG29787.1| transmembrane 9 superfamily protein member 3 precursor [Zea mays]
Length=586

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  535  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  586



>ref|XP_009390071.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=588

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  537  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  588



>gb|KDP38816.1| hypothetical protein JCGZ_04973 [Jatropha curcas]
Length=596

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  547  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  596



>ref|XP_009355251.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
             KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  539  AKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_006471014.1| PREDICTED: transmembrane 9 superfamily member 3-like [Citrus 
sinensis]
Length=587

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  538  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587



>ref|XP_008667101.1| PREDICTED: uncharacterized protein LOC100192672 isoform X1 [Zea 
mays]
 tpg|DAA38952.1| TPA: transmembrane 9 family protein member 3 [Zea mays]
Length=586

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  535  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  586



>ref|XP_008378878.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Malus domestica]
Length=589

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
             KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  539  AKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>emb|CDO97576.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  538  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587



>ref|XP_008456054.1| PREDICTED: transmembrane 9 superfamily member 3 [Cucumis melo]
Length=632

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  583  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  632



>ref|XP_002449107.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
 gb|EES08095.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
Length=590

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  539  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  590



>ref|XP_011464826.1| PREDICTED: transmembrane 9 superfamily member 1 [Fragaria vesca 
subsp. vesca]
Length=598

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
             KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  548  AKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  598



>ref|XP_002530674.1| endomembrane protein emp70, putative [Ricinus communis]
 gb|EEF31705.1| endomembrane protein emp70, putative [Ricinus communis]
Length=602

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  553  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  602



>ref|XP_004146261.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
 ref|XP_004159874.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
Length=593

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  544  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  593



>gb|KJB77692.1| hypothetical protein B456_012G151500 [Gossypium raimondii]
Length=592

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  543  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  592



>ref|XP_007148532.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
 gb|ESW20526.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
Length=630

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  581  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  630



>gb|KJB79238.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=593

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  544  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  593



>ref|XP_004978867.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=586

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  535  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  586



>ref|NP_001065897.1| Os11g0181100 [Oryza sativa Japonica Group]
 gb|ABA91795.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA91796.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27742.1| Os11g0181100 [Oryza sativa Japonica Group]
 dbj|BAG94676.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67792.1| hypothetical protein OsI_35351 [Oryza sativa Indica Group]
 gb|EEE51756.1| hypothetical protein OsJ_33190 [Oryza sativa Japonica Group]
Length=593

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  542  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  593



>gb|KGN57596.1| hypothetical protein Csa_3G222780 [Cucumis sativus]
Length=664

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  615  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  664



>gb|AAL07091.2| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
Length=461

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  412  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  461



>gb|AGE46034.1| putative transmembrane 9 superfamily member 3 protein [Elaeis 
guineensis]
Length=586

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  537  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  586



>gb|KHN11244.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=583

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  534  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  583



>ref|XP_009602812.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  539  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  588



>gb|KHG21692.1| Transmembrane 9 superfamily member 3 [Gossypium arboreum]
Length=587

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  538  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587



>gb|KHG27380.1| Tm9sf3 [Gossypium arboreum]
Length=614

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  565  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  614



>ref|XP_009776073.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  539  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  588



>ref|XP_003532994.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=585

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  536  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  585



>ref|XP_008662281.1| PREDICTED: uncharacterized protein LOC100501115 isoform X1 [Zea 
mays]
 gb|AFW56219.1| hypothetical protein ZEAMMB73_922033 [Zea mays]
Length=596

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  545  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  596



>gb|KHN45466.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=584

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  535  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  584



>dbj|BAJ96423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  534  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  585



>gb|KJB47458.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=590

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  541  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  590



>ref|XP_010238659.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=594

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  543  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  594



>ref|XP_006349354.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  539  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  588



>ref|XP_006664390.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=580

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  529  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  580



>ref|NP_001066292.1| Os12g0175700 [Oryza sativa Japonica Group]
 gb|ABA96600.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29311.1| Os12g0175700 [Oryza sativa Japonica Group]
 dbj|BAG91282.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68944.1| hypothetical protein OsI_37659 [Oryza sativa Indica Group]
 gb|EEE52854.1| hypothetical protein OsJ_35401 [Oryza sativa Japonica Group]
Length=598

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  547  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  598



>ref|XP_003540158.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=584

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  535  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  584



>ref|XP_007042269.1| Transmembrane nine 1 [Theobroma cacao]
 gb|EOX98100.1| Transmembrane nine 1 [Theobroma cacao]
Length=640

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  591  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  640



>dbj|BAJ86318.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  534  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  585



>ref|XP_003577775.1| PREDICTED: transmembrane 9 superfamily member 3 [Brachypodium 
distachyon]
Length=585

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  534  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  585



>gb|EMS58779.1| Transmembrane 9 superfamily member 3 [Triticum urartu]
Length=571

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  520  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  571



>gb|KJB79240.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=591

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  542  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  591



>ref|XP_006304923.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
 gb|EOA37821.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
Length=589

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  540  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_010458475.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=589

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  540  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_010492178.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Camelina sativa]
Length=589

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  540  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>tpg|DAA55531.1| TPA: hypothetical protein ZEAMMB73_446969 [Zea mays]
Length=592

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  541  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  592



>ref|NP_563881.1| transmembrane nine 1 [Arabidopsis thaliana]
 sp|Q940G0.1|TMN1_ARATH RecName: Full=Transmembrane 9 superfamily member 1; AltName: 
Full=Endomembrane protein 12; AltName: Full=Transmembrane nine 
protein 1; Short=AtTMN1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL48237.1|AF446365_1 At1g10950/T19D16_13 [Arabidopsis thaliana]
 gb|AAK96857.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAL36263.1| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
 gb|AAM10098.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAP40425.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 gb|AEE28668.1| transmembrane nine 1 [Arabidopsis thaliana]
Length=589

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  540  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_002889842.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66101.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  539  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  588



>ref|XP_010930775.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
 ref|XP_010930776.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
Length=586

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  535  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  586



>ref|XP_008781558.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Phoenix 
dactylifera]
Length=558

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  507  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  558



>ref|XP_010912522.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Elaeis 
guineensis]
Length=587

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  537  VKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  587



>ref|XP_010912523.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Elaeis 
guineensis]
Length=581

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  531  VKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  581



>ref|XP_010475983.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=587

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  538  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587



>ref|XP_010665394.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI39323.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +KTKMSGFFQ SFY GYTLM CLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  699  MKTKMSGFFQTSFYFGYTLMLCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  749



>gb|AAB65482.1| endomembrane protein EMP70 precusor isolog; 68664-64364 [Arabidopsis 
thaliana]
Length=589

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  540  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_002442907.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
 gb|EES16745.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
Length=594

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  543  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  594



>ref|XP_008783371.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=586

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  537  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  586



>ref|XP_010553598.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=592

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  543  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  592



>ref|XP_010910845.1| PREDICTED: transmembrane 9 superfamily member 1-like [Elaeis 
guineensis]
Length=586

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  537  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  586



>emb|CAN77106.1| hypothetical protein VITISV_037096 [Vitis vinifera]
Length=600

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +KTKMSGFFQ SFY GYTLM CLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  550  MKTKMSGFFQTSFYFGYTLMLCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  600



>ref|XP_010682854.1| PREDICTED: transmembrane 9 superfamily member 1-like [Beta vulgaris 
subsp. vulgaris]
Length=595

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYT+MFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  544  HVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSKLFVRRIYRNIKCD  595



>ref|XP_006392091.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
 gb|ESQ29377.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
Length=471

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  422  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  471



>ref|XP_004230474.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  539  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  588



>ref|XP_006662781.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Oryza brachyantha]
Length=583

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            ++KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  532  HMKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  583



>ref|XP_008781557.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Phoenix 
dactylifera]
Length=616

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  565  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  616



>dbj|BAJ87519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G++GS LFVRRIYRNIKCD
Sbjct  544  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYVGSTLFVRRIYRNIKCD  595



>ref|XP_011028284.1| PREDICTED: transmembrane 9 superfamily member 1 [Populus euphratica]
Length=590

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  541  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  590



>emb|CDY54577.1| BnaCnng27330D [Brassica napus]
Length=513

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  464  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  513



>gb|EYU22789.1| hypothetical protein MIMGU_mgv1a003460mg [Erythranthe guttata]
Length=583

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YVKTKMSGFFQ SFY GYTLMFC+GLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  532  YVKTKMSGFFQTSFYFGYTLMFCMGLGILCGAVGYLGSNLFVRRIYRNIKCD  583



>ref|XP_010272575.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nelumbo 
nucifera]
Length=466

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  417  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  466



>gb|EMT08384.1| Transmembrane 9 superfamily member 3 [Aegilops tauschii]
Length=552

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G++GS LFVRRIYRNIKCD
Sbjct  501  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYVGSTLFVRRIYRNIKCD  552



>ref|XP_006384984.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP62781.1| endomembrane protein 70 [Populus trichocarpa]
Length=586

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  537  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  586



>ref|XP_007159578.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
 gb|ESW31572.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
Length=589

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +KTKMSGFFQ SFY GYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  539  MKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  589



>ref|XP_004485475.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Cicer arietinum]
Length=583

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVG LGSNLFVRRIYRNIKCD
Sbjct  534  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGHLGSNLFVRRIYRNIKCD  583



>emb|CDY03772.1| BnaC01g28890D [Brassica napus]
Length=594

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  545  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  594



>ref|XP_006392092.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
 gb|ESQ29378.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
Length=591

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  542  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  591



>ref|XP_011009384.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
 ref|XP_011009385.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
Length=593

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  544  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  593



>ref|XP_004485474.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Cicer arietinum]
Length=583

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT+MFCLGLGILCGAVG LGSNLFVRRIYRNIKCD
Sbjct  534  KTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGHLGSNLFVRRIYRNIKCD  583



>emb|CDY46193.1| BnaA01g23150D [Brassica napus]
Length=575

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  526  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  575



>emb|CDY33319.1| BnaAnng04300D [Brassica napus]
Length=544

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  495  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  544



>ref|XP_004977232.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=597

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +VKTKMSGFFQ SFY GYTLMFCLGLGILCGA+G++GS LFVRRIYRNIKCD
Sbjct  546  HVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYVGSTLFVRRIYRNIKCD  597



>ref|XP_009104187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=594

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  545  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  594



>gb|KFK40744.1| hypothetical protein AALP_AA2G035500 [Arabis alpina]
Length=595

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  546  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  595



>ref|XP_009124655.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=627

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  578  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  627



>emb|CDY12876.1| BnaA09g13980D [Brassica napus]
Length=564

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  515  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  564



>emb|CDY44834.1| BnaCnng11900D [Brassica napus]
Length=547

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  498  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  547



>ref|XP_009113237.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3-like [Brassica rapa]
Length=570

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  521  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  570



>ref|XP_004504187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cicer arietinum]
Length=591

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YVKTKMSGFFQ SFY GYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  540  YVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  591



>ref|XP_011092339.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Sesamum 
indicum]
Length=460

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSG FQ SFY GYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  411  KTKMSGLFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  460



>ref|XP_003592977.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
Length=446

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT MFCLGLGILCGAVG LGSNLFVRRIYRNIKCD
Sbjct  397  KTKMSGFFQTSFYFGYTAMFCLGLGILCGAVGHLGSNLFVRRIYRNIKCD  446



>ref|XP_003629959.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AET04435.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=589

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YVKTKMSGFFQ SFY GYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  538  YVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  589



>ref|XP_002269498.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI29766.3| unnamed protein product [Vitis vinifera]
Length=592

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  543  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  592



>ref|XP_009379854.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=591

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  542  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  591



>ref|XP_010246919.1| PREDICTED: transmembrane 9 superfamily member 3 [Nelumbo nucifera]
Length=591

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  542  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  591



>emb|CDY54580.1| BnaCnng27350D [Brassica napus]
Length=589

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  540  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  589



>ref|XP_008807671.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=591

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            VKTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS  FVRRIYRNIKCD
Sbjct  541  VKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTFFVRRIYRNIKCD  591



>ref|XP_010235535.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=588

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            VKTKMSGFFQ SFY GYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  538  VKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  588



>ref|XP_003592976.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES63227.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=583

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYT MFCLGLGILCGAVG LGSNLFVRRIYRNIKCD
Sbjct  534  KTKMSGFFQTSFYFGYTAMFCLGLGILCGAVGHLGSNLFVRRIYRNIKCD  583



>ref|XP_011092338.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Sesamum 
indicum]
Length=588

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSG FQ SFY GYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  539  KTKMSGLFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  588



>ref|XP_004952828.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=585

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            ++KTKMSGFFQ SFY GYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  534  HMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  585



>ref|XP_010547447.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=591

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS+LF+RRIYRNIKCD
Sbjct  542  KTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSSLFIRRIYRNIKCD  591



>ref|XP_008681382.1| PREDICTED: uncharacterized protein LOC100272502 isoform X2 [Zea 
mays]
Length=585

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            ++KTKMSGFFQ SFY GYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  534  HMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  585



>ref|XP_008681381.1| PREDICTED: uncharacterized protein LOC100272502 isoform X1 [Zea 
mays]
Length=588

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            ++KTKMSGFFQ SFY GYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  537  HMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  588



>ref|XP_002452255.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
 gb|EES05231.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
Length=585

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            ++KTKMSGFFQ SFY GYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  534  HMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  585



>ref|XP_009404976.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=588

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  538  MKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  588



>ref|XP_009404975.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=635

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            +KTKMSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  585  MKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  635



>ref|XP_007509634.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19437.1| predicted protein [Bathycoccus prasinos]
Length=629

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIYY+  KTKM+GFFQ  FY GYT MFCLGLG++CGAVG+ G+N FVRRIYRNIKCD
Sbjct  572  YSIYYFIFKTKMTGFFQTCFYFGYTAMFCLGLGLMCGAVGYFGANAFVRRIYRNIKCD  629



>ref|NP_001047104.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAD15485.1| putative transmembrane protein TM9SF3 (66.6 kD) [Oryza sativa 
Japonica Group]
 dbj|BAF09018.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAG90570.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93963.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73381.1| hypothetical protein OsI_07622 [Oryza sativa Indica Group]
Length=590

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  541  KTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  590



>ref|XP_006648727.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=568

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ SFY GYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  519  KTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  568



>ref|XP_010533958.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Tarenaya hassleriana]
Length=598

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM GFFQ SFY GYTLMFCLGLGILCGAVG++GSNLFVRRIYRNIKCD
Sbjct  549  KTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGYMGSNLFVRRIYRNIKCD  598



>ref|XP_006859169.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
 gb|ERN20636.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
Length=590

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKMSGFFQ  FY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  541  KTKMSGFFQTGFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  590



>gb|KDD76545.1| endomembrane protein 70 [Helicosporidium sp. ATCC 50920]
Length=572

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/58 (69%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS++Y++VKTKM+GFFQ +FY GYTLMFC+GL ++CG+VG+LG++ FVRRIY+NIKCD
Sbjct  515  YSVHYFFVKTKMTGFFQTTFYFGYTLMFCIGLSVMCGSVGYLGASAFVRRIYKNIKCD  572



>ref|XP_005645983.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21439.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
Length=610

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+++Y++VKTKM+GFFQ  FY GYTLMFCLGL I+ GA+G+LGS +FVRRIYRNIKCD
Sbjct  553  YAVHYFFVKTKMTGFFQTCFYFGYTLMFCLGLSIMTGALGYLGSAIFVRRIYRNIKCD  610



>gb|ADE75730.1| unknown [Picea sitchensis]
Length=47

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  530  MSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            MSGFFQ SFY GYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  1    MSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  47



>ref|XP_011395771.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
 gb|KFM22905.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
Length=591

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS++Y++ KTKM+GFFQ +FY GYTLMFC+GL ++CGAVG LG+ +FVRRIYRNIKCD
Sbjct  534  YSVHYFFWKTKMTGFFQTAFYFGYTLMFCVGLSVMCGAVGHLGAGVFVRRIYRNIKCD  591



>ref|XP_002960054.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
 gb|EFJ37593.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
Length=586

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            ++KTKMSGFFQ SFY GYTLM C+GLG LCGAVG+LGS++FVRRIYRNIKCD
Sbjct  535  FMKTKMSGFFQTSFYFGYTLMLCVGLGSLCGAVGYLGSSVFVRRIYRNIKCD  586



>ref|XP_002984084.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
 gb|EFJ15096.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
Length=587

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            ++KTKMSGFFQ SFY GYTLM C+GLG LCGAVG+LGS++FVRRIYRNIKCD
Sbjct  536  FMKTKMSGFFQTSFYFGYTLMLCVGLGSLCGAVGYLGSSVFVRRIYRNIKCD  587



>ref|XP_005845268.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
 gb|EFN53166.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
Length=589

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS++Y+ +KTKM+GFFQ +FY GYTLMFCLGL I+CGA+G+LGS  FVRRI+RN+K D
Sbjct  532  YSVHYFVMKTKMTGFFQTAFYFGYTLMFCLGLSIMCGAIGYLGSLAFVRRIFRNVKVD  589



>ref|XP_004241844.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=584

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            + KTKMSG  Q SFY GYTLMFCLG+GILCGAVG+LGSNLF+RRI+ NIKCD
Sbjct  533  HSKTKMSGLLQTSFYFGYTLMFCLGVGILCGAVGYLGSNLFIRRIFGNIKCD  584



>ref|XP_006356503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=584

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  545  YVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            + KT MSG  Q SFY GYTLMFCLG+GILCGAVG+LGSNLF+RRI+ NIKCD
Sbjct  533  HAKTSMSGLLQTSFYFGYTLMFCLGVGILCGAVGYLGSNLFIRRIFGNIKCD  584



>ref|XP_003061693.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54323.1| predicted protein [Micromonas pusilla CCMP1545]
Length=623

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS+YY+  KTKM+GFFQ  FY GYT MFCL L ++CGA G++ +N FVRRIYRNIKCD
Sbjct  566  YSVYYFVFKTKMTGFFQTCFYFGYTAMFCLVLALVCGATGYVAANAFVRRIYRNIKCD  623



>ref|XP_004335868.1| endomembrane protein EMP70 precursor isolog, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR13855.1| endomembrane protein EMP70 precursor isolog, putative [Acanthamoeba 
castellanii str. Neff]
Length=591

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS+YY+Y+KTKMSGFFQ  FY GY  MFCLGL  LCGA+GF+G+++FVRRIY  IK D
Sbjct  534  YSVYYFYMKTKMSGFFQTVFYFGYMAMFCLGLATLCGAIGFIGTSMFVRRIYTMIKGD  591



>ref|XP_009631163.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=468

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KT+M G FQ S Y GYTLMFCLGLG LCGAVG++GSNLFVRRI+ NIKCD
Sbjct  419  KTRMFGLFQTSVYFGYTLMFCLGLGTLCGAVGYIGSNLFVRRIFSNIKCD  468



>ref|XP_009788011.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=583

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KT+M G FQ S Y GYTLMFCLGLG LCGAVG++GSNLFVRRI+ NIKCD
Sbjct  534  KTRMFGLFQTSVYFGYTLMFCLGLGTLCGAVGYIGSNLFVRRIFSNIKCD  583



>ref|XP_009631162.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=583

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  542  VKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
             KT+M G FQ S Y GYTLMFCLGLG LCGAVG++GSNLFVRRI+ NIKCD
Sbjct  533  AKTRMFGLFQTSVYFGYTLMFCLGLGTLCGAVGYIGSNLFVRRIFSNIKCD  583



>ref|XP_002945998.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
 gb|EFJ52993.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
Length=596

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS++Y+  KTKM+G FQ  FY GYT MFCLGL +LCGAVG++ +  FVR IYRN+KCD
Sbjct  539  YSVHYFLFKTKMTGLFQTCFYFGYTSMFCLGLALLCGAVGYMAAAAFVRTIYRNVKCD  596



>ref|XP_002509072.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70330.1| predicted protein [Micromonas sp. RCC299]
Length=613

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIYY+  KTKM+GFFQ  FY GYT MFCL LGI  GA+G+ G++ FVR+IYRNIK D
Sbjct  556  YSIYYFAFKTKMTGFFQTCFYFGYTAMFCLALGITTGAIGYCGASAFVRKIYRNIKVD  613



>emb|CCA19624.1| endomembrane protein 70like protein putative [Albugo laibachii 
Nc14]
 emb|CCA22874.1| endomembrane protein 70like protein putative [Albugo laibachii 
Nc14]
Length=583

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIY+Y+ KT MSGF Q  FY GY  +FC    ++CG VGFLGS+ F RRIYRNIKC+
Sbjct  526  YSIYFYFYKTNMSGFLQTYFYFGYMSLFCFAFFLMCGTVGFLGSSAFTRRIYRNIKCE  583



>gb|ETI36484.1| hypothetical protein F443_17408 [Phytophthora parasitica P1569]
Length=605

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+IY+Y+ KT MSGF Q  FY GY  +FC    I+CG VG+LGS++F +RIYRNIKC+
Sbjct  548  YAIYFYFFKTNMSGFLQTCFYFGYMGLFCFAFFIMCGTVGYLGSSVFTKRIYRNIKCE  605



>emb|CBN79799.1| conserved unknown protein [Ectocarpus siliculosus]
Length=231

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS YY + KT  SGF Q+SFY GY  +FC  LG++CG++G +GS +FV++IYRNIK D
Sbjct  174  YSGYYLWFKTHQSGFMQISFYFGYMGLFCAALGVMCGSIGVMGSTVFVKQIYRNIKVD  231



>ref|XP_004347030.2| transmembrane protein TM9SF3 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94757.1| transmembrane protein TM9SF3 [Capsaspora owczarzaki ATCC 30864]
Length=596

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIYY+  KT M G FQ SFY GY  +FC+GLG+LCG +G  G+++FVR+IY N+K D
Sbjct  539  YSIYYFLFKTTMYGLFQTSFYFGYMALFCIGLGVLCGTIGHAGTSVFVRQIYHNVKLD  596



>ref|XP_005836386.1| hypothetical protein GUITHDRAFT_67884 [Guillardia theta CCMP2712]
 gb|EKX49406.1| hypothetical protein GUITHDRAFT_67884 [Guillardia theta CCMP2712]
Length=584

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+IY++  KTKM G FQ  FY G TLM C+GLGI+CGA+G+LG+ +FV RI+R++K D
Sbjct  527  YAIYFFMAKTKMYGLFQTCFYFGQTLMMCVGLGIICGAIGYLGARVFVWRIFRSVKSD  584



>gb|EFX85753.1| hypothetical protein DAPPUDRAFT_313523 [Daphnia pulex]
Length=580

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+IYY++ KTKM G FQ +FY GY  +F LGLG+LCG VG++GS+ FVR+IY  +K D
Sbjct  523  YAIYYFFFKTKMYGLFQTAFYFGYMALFSLGLGVLCGTVGYIGSSFFVRKIYSTVKID  580



>emb|CCI39563.1| unnamed protein product [Albugo candida]
Length=542

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIY+Y+ KT MSGF Q  FY GY  +FC    ++CG VG++GS+ F RRIYRNIKC+
Sbjct  485  YSIYFYFYKTNMSGFLQTYFYFGYMSLFCFAFFLMCGTVGYMGSSAFTRRIYRNIKCE  542



>emb|CCI39562.1| unnamed protein product [Albugo candida]
Length=583

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIY+Y+ KT MSGF Q  FY GY  +FC    ++CG VG++GS+ F RRIYRNIKC+
Sbjct  526  YSIYFYFYKTNMSGFLQTYFYFGYMSLFCFAFFLMCGTVGYMGSSAFTRRIYRNIKCE  583



>ref|XP_008895867.1| hypothetical protein PPTG_03848 [Phytophthora parasitica INRA-310]
 ref|XP_008895870.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETL83372.1| hypothetical protein L917_16665 [Phytophthora parasitica]
 gb|ETL83373.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM36594.1| hypothetical protein L914_16746 [Phytophthora parasitica]
 gb|ETM36595.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETN18162.1| hypothetical protein PPTG_03848 [Phytophthora parasitica INRA-310]
 gb|ETN18163.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETP06307.1| hypothetical protein F441_17276 [Phytophthora parasitica CJ01A1]
 gb|ETP06308.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
 gb|ETP34418.1| hypothetical protein F442_17259 [Phytophthora parasitica P10297]
Length=605

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+IY+Y+ KT MSGF Q  FY GY  +FC    I+CG VG+LGS++F +RIYRNIKC+
Sbjct  548  YAIYFYFFKTNMSGFLQTCFYFGYMGLFCFAFFIMCGTVGYLGSSVFTKRIYRNIKCE  605



>gb|ETK76715.1| hypothetical protein L915_16929 [Phytophthora parasitica]
 gb|ETK76716.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL30146.1| hypothetical protein L916_16832 [Phytophthora parasitica]
 gb|ETL30147.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETO65214.1| hypothetical protein F444_17445 [Phytophthora parasitica P1976]
 gb|ETO65215.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
Length=605

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+IY+Y+ KT MSGF Q  FY GY  +FC    I+CG VG+LGS++F +RIYRNIKC+
Sbjct  548  YAIYFYFFKTNMSGFLQTCFYFGYMGLFCFAFFIMCGTVGYLGSSVFTKRIYRNIKCE  605



>ref|XP_002903970.1| endomembrane protein 70-like protein, putative [Phytophthora 
infestans T30-4]
 gb|EEY55025.1| endomembrane protein 70-like protein, putative [Phytophthora 
infestans T30-4]
Length=605

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+IY+Y+ KT MSGF Q  FY GY  +FC    I+CG VG+LGS++F +RIYRNIKC+
Sbjct  548  YAIYFYFFKTNMSGFLQTCFYFGYMGLFCFAFFIMCGTVGYLGSSVFTKRIYRNIKCE  605



>gb|ETI36485.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
Length=590

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+IY+Y+ KT MSGF Q  FY GY  +FC    I+CG VG+LGS++F +RIYRNIKC+
Sbjct  533  YAIYFYFFKTNMSGFLQTCFYFGYMGLFCFAFFIMCGTVGYLGSSVFTKRIYRNIKCE  590



>ref|XP_008895868.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETL83374.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETM36596.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETN18164.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETP06309.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
 gb|ETP34419.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
Length=590

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+IY+Y+ KT MSGF Q  FY GY  +FC    I+CG VG+LGS++F +RIYRNIKC+
Sbjct  533  YAIYFYFFKTNMSGFLQTCFYFGYMGLFCFAFFIMCGTVGYLGSSVFTKRIYRNIKCE  590



>gb|ETK76717.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL30148.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETO65216.1| hypothetical protein, variant 2 [Phytophthora parasitica P1976]
Length=590

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+IY+Y+ KT MSGF Q  FY GY  +FC    I+CG VG+LGS++F +RIYRNIKC+
Sbjct  533  YAIYFYFFKTNMSGFLQTCFYFGYMGLFCFAFFIMCGTVGYLGSSVFTKRIYRNIKCE  590



>ref|XP_009524748.1| hypothetical protein PHYSODRAFT_299515 [Phytophthora sojae]
 gb|EGZ22031.1| hypothetical protein PHYSODRAFT_299515 [Phytophthora sojae]
Length=606

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+IY+Y+ KT MSGF Q  FY GY  +FC    I+CG VG+LGS++F +RIYRNIKC+
Sbjct  549  YAIYFYFFKTNMSGFLQTCFYFGYMGLFCFAFFIMCGTVGYLGSSVFTKRIYRNIKCE  606



>gb|EWM22128.1| transmembrane 9 superfamily member 3 [Nannochloropsis gaditana]
Length=601

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIYY+ VKT+M+G  Q +FY GYT +FC GL +LCGA+G +G +LFVRRIY  +K D
Sbjct  544  YSIYYFAVKTQMTGLLQTAFYFGYTFVFCAGLFLLCGALGVIGGSLFVRRIYSGLKID  601



>ref|XP_005768973.1| hypothetical protein EMIHUDRAFT_60571, partial [Emiliania huxleyi 
CCMP1516]
 ref|XP_005772541.1| hypothetical protein EMIHUDRAFT_60532, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD16544.1| hypothetical protein EMIHUDRAFT_60571, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD20112.1| hypothetical protein EMIHUDRAFT_60532, partial [Emiliania huxleyi 
CCMP1516]
Length=136

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS+YY+ VKTKMSGF+Q  FYL Y  +F L LG++CGA+G+ G  LFVRRIY NIK D
Sbjct  79   YSLYYFVVKTKMSGFYQTVFYLCYMGIFSLALGLMCGALGYGGCRLFVRRIYSNIKND  136



>ref|XP_008868877.1| hypothetical protein H310_05822 [Aphanomyces invadans]
 gb|ETW02272.1| hypothetical protein H310_05822 [Aphanomyces invadans]
Length=664

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS+Y+Y+ KT MSGF Q SFY GY  +FC    I+CG +G+ GS++F +RIYRNIK +
Sbjct  607  YSVYFYFFKTSMSGFVQTSFYFGYMALFCFAFFIMCGTIGYFGSSIFTKRIYRNIKVE  664



>ref|XP_004622652.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Sorex araneus]
Length=169

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS+YY++ K+KM G FQ  FY GYTL+FC+ LGI+CG +GFL S+ FV +IY ++K D
Sbjct  112  YSVYYFFFKSKMYGLFQTVFYFGYTLVFCVCLGIMCGTIGFLASSRFVGKIYSSVKID  169



>ref|XP_002083749.1| GD13184 [Drosophila simulans]
 gb|EDX09334.1| GD13184 [Drosophila simulans]
Length=645

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS++Y++ KTKM G FQ +FY GY  +F   LGI+CG VG++G+NLFVR+IY N+K D
Sbjct  588  YSLHYFFFKTKMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID  645



>ref|XP_009827098.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV83668.1| hypothetical protein, variant [Aphanomyces astaci]
Length=608

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS+Y+Y+ KT MSGF Q SFY GY  +FC    I+CG +G+ GS+ F +RIYRNIK +
Sbjct  551  YSVYFYFCKTHMSGFLQTSFYFGYMALFCFAFFIMCGTIGYFGSSAFTKRIYRNIKVE  608



>ref|XP_002679262.1| predicted protein [Naegleria gruberi]
 gb|EFC46518.1| predicted protein [Naegleria gruberi]
Length=625

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YSIY++  KT+M GFFQ+ FY G T MFC+G+  LCGA+ F  + +FV+RIY++IK D
Sbjct  568  YSIYFFNTKTRMRGFFQIVFYYGITFMFCVGMAFLCGAIAFSATYVFVKRIYKDIKVD  625



>ref|XP_001698971.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDO99025.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=598

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS++Y+ +KTKM+GFFQ  FY GYT MFCLGL +LCGA+G++ +  FVR IYRN+KCD
Sbjct  541  YSVHYFLLKTKMTGFFQTCFYFGYTSMFCLGLALLCGAMGYMAAAAFVRTIYRNVKCD  598



>ref|XP_008614772.1| hypothetical protein SDRG_10554 [Saprolegnia diclina VS20]
 gb|EQC31765.1| hypothetical protein SDRG_10554 [Saprolegnia diclina VS20]
Length=605

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+IY+Y+ KT MSGF Q SFY GY  +FC    I+CG++G+ GS+ F +RIYRNIK +
Sbjct  548  YAIYFYFFKTNMSGFLQTSFYFGYMGLFCFSFFIMCGSIGYYGSSAFTKRIYRNIKIE  605



>emb|CDW55076.1| Transmembrane 9 superfamily [Trichuris trichiura]
Length=561

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y++YY++ KTKM GFFQ  FY GYT +FC+ LGI+CG +GF+ ++ FV +IY ++K D
Sbjct  504  YAVYYFFYKTKMYGFFQTIFYFGYTSIFCVALGIMCGTIGFIAASRFVGKIYSSVKID  561



>ref|XP_004932208.1| PREDICTED: transmembrane 9 superfamily member 3-like [Bombyx 
mori]
Length=575

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS YY+  KTKM G FQ +FY GY  +F L LGI+CG VG++G+++FVR+IY  +K D
Sbjct  518  YSFYYFLFKTKMYGLFQTTFYFGYMALFSLALGIICGTVGYVGTSIFVRKIYSTVKID  575



>gb|KFO35950.1| Phosphoinositide 3-kinase adapter protein 1 [Fukomys damarensis]
Length=1303

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539   KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
             KTKM G FQ SFY GY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  1254  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  1303



>ref|XP_002426886.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB14148.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=555

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS YY+  KTKM G FQ +FY GY  +F L LG++CG VG++GS+ FVR+IY  +K D
Sbjct  498  YSFYYFLFKTKMYGLFQTAFYFGYMALFSLALGLMCGTVGYIGSSAFVRKIYSTVKID  555



>gb|EHJ69950.1| putative endomembrane protein emp70 [Danaus plexippus]
Length=543

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS YY+  KTKM G FQ +FY GY  +F L LGI+CG VG++G++ FVR+IY  +K D
Sbjct  486  YSFYYFLFKTKMYGLFQTTFYFGYMALFSLTLGIICGTVGYIGTSFFVRKIYATVKID  543



>ref|XP_001950058.1| PREDICTED: transmembrane 9 superfamily member 3 [Acyrthosiphon 
pisum]
Length=589

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS YY+  KTKM G FQ +FY GY  +F + LGI+CG VG++G++ FVR+IY  +K D
Sbjct  532  YSFYYFMFKTKMYGLFQTAFYFGYMALFSIALGIMCGTVGYIGAHAFVRKIYTTVKID  589



>gb|ETN57960.1| hypothetical protein AND_010453 [Anopheles darlingi]
Length=1505

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -1

Query  539   KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
             KTKM G FQ SFY GY  +F   LG++CG VG+ G+N+FVR+IY N+K D
Sbjct  1456  KTKMYGLFQTSFYFGYMALFSGALGMICGTVGYFGTNIFVRKIYSNVKID  1505



>gb|KDO15767.1| hypothetical protein SPRG_18692, partial [Saprolegnia parasitica 
CBS 223.65]
Length=467

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+IY+Y+ KT MSGF Q  FY GY  +FC    I+CG++G+ GS+ F +RIYRNIK +
Sbjct  410  YAIYFYFCKTNMSGFLQTCFYFGYMGLFCFAFFIMCGSIGYYGSSAFTKRIYRNIKIE  467



>gb|KDO27371.1| hypothetical protein SPRG_06957 [Saprolegnia parasitica CBS 223.65]
Length=605

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            Y+IY+Y+ KT MSGF Q  FY GY  +FC    I+CG++G+ GS+ F +RIYRNIK +
Sbjct  548  YAIYFYFCKTNMSGFLQTCFYFGYMGLFCFAFFIMCGSIGYYGSSAFTKRIYRNIKIE  605



>ref|XP_785201.2| PREDICTED: transmembrane 9 superfamily member 3 [Strongylocentrotus 
purpuratus]
Length=582

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS YY+  KTKM G FQ +FY GY  +F L LG++CG +G+ G+ +FVR+IY  +K D
Sbjct  525  YSFYYFLFKTKMYGLFQTTFYFGYMALFSLSLGVMCGTIGYAGTGIFVRKIYSTVKID  582



>dbj|GAA29282.2| transmembrane 9 superfamily member 3 [Clonorchis sinensis]
Length=532

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS YY+  KTKM+GFFQ SF+  Y  +FC+ LG+LCG+V +L ++ FVR+IY  +K D
Sbjct  475  YSAYYFIFKTKMNGFFQTSFFFVYMGLFCMYLGVLCGSVAYLAASRFVRKIYSTVKVD  532



>ref|XP_009511961.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Phalacrocorax 
carbo]
 ref|XP_009806564.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Gavia stellata]
 ref|XP_010146260.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Eurypyga helias]
Length=194

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  145  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  194



>ref|XP_008471864.1| PREDICTED: transmembrane 9 superfamily member 3-like [Diaphorina 
citri]
Length=483

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F LGLGI+CG VG++G++LFVR+IY  +K D
Sbjct  434  KTKMYGLFQTTFYFGYMALFSLGLGIMCGTVGYVGTSLFVRKIYATVKID  483



>ref|XP_008428273.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Poecilia 
reticulata]
Length=586

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  537  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_007566966.1| PREDICTED: transmembrane 9 superfamily member 3 [Poecilia formosa]
Length=586

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  537  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_005795250.1| PREDICTED: transmembrane 9 superfamily member 3-like [Xiphophorus 
maculatus]
Length=586

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  537  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_006630785.1| PREDICTED: transmembrane 9 superfamily member 3-like [Lepisosteus 
oculatus]
Length=586

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  537  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_010732838.1| PREDICTED: transmembrane 9 superfamily member 3 [Larimichthys 
crocea]
Length=581

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  532  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  581



>ref|XP_008282853.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Stegastes partitus]
Length=624

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  575  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  624



>ref|XP_006799085.1| PREDICTED: transmembrane 9 superfamily member 3-like [Neolamprologus 
brichardi]
Length=624

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  575  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  624



>ref|XP_009976834.1| PREDICTED: transmembrane 9 superfamily member 3 [Tauraco erythrolophus]
Length=266

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  217  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  266



>ref|XP_009173090.1| hypothetical protein T265_08898 [Opisthorchis viverrini]
 gb|KER23168.1| hypothetical protein T265_08898 [Opisthorchis viverrini]
Length=576

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  563  YSIYYYYVKTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            YS YY+  KTKM+GFFQ SF+  Y  +FC+ LG+LCG++ +L ++ FVR+IY  +K D
Sbjct  519  YSAYYFIFKTKMNGFFQTSFFFVYMGLFCMYLGVLCGSIAYLAASRFVRKIYSTVKVD  576



>ref|XP_007258750.1| PREDICTED: transmembrane 9 superfamily member 3-like [Astyanax 
mexicanus]
Length=587

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  538  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  587



>ref|XP_004559661.1| PREDICTED: transmembrane 9 superfamily member 3-like [Maylandia 
zebra]
Length=624

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  575  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  624



>ref|XP_003963762.1| PREDICTED: transmembrane 9 superfamily member 3-like [Takifugu 
rubripes]
Length=586

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  537  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_005735123.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pundamilia 
nyererei]
 ref|XP_005927107.1| PREDICTED: transmembrane 9 superfamily member 3-like [Haplochromis 
burtoni]
Length=586

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  537  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_007902753.1| PREDICTED: transmembrane 9 superfamily member 3 [Callorhinchus 
milii]
Length=585

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  536  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  585



>ref|XP_002062013.1| GK16877 [Drosophila willistoni]
 gb|EDW72999.1| GK16877 [Drosophila willistoni]
Length=586

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F   LGI+CG VG++G+NLFVR+IY N+K D
Sbjct  537  KTKMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID  586



>ref|XP_008428274.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Poecilia 
reticulata]
Length=545

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  496  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  545



>ref|XP_003441118.1| PREDICTED: transmembrane 9 superfamily member 3 [Oreochromis 
niloticus]
Length=586

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  537  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_001972005.1| GG14121 [Drosophila erecta]
 gb|EDV51031.1| GG14121 [Drosophila erecta]
Length=592

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F   LGI+CG VG++G+NLFVR+IY N+K D
Sbjct  543  KTKMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID  592



>ref|NP_998554.1| transmembrane 9 superfamily member 3 precursor [Danio rerio]
 gb|AAH46021.1| Transmembrane 9 superfamily member 3 [Danio rerio]
Length=586

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  537  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_001984443.1| GH15015 [Drosophila grimshawi]
 gb|EDV96791.1| GH15015 [Drosophila grimshawi]
Length=585

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F   LGI+CG VG++G+NLFVR+IY N+K D
Sbjct  536  KTKMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID  585



>ref|XP_010779545.1| PREDICTED: transmembrane 9 superfamily member 3 [Notothenia coriiceps]
Length=586

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  537  KTKMYGLFQTSFYFGYMAVFSTSLGIMCGAVGYMGTSAFVRKIYTNVKID  586



>dbj|BAG60075.1| unnamed protein product [Homo sapiens]
Length=254

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  205  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  254



>ref|XP_002093812.1| GE20545 [Drosophila yakuba]
 gb|EDW93524.1| GE20545 [Drosophila yakuba]
Length=593

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F   LGI+CG VG++G+NLFVR+IY N+K D
Sbjct  544  KTKMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID  593



>ref|XP_002035457.1| GM13907 [Drosophila sechellia]
 gb|EDW50593.1| GM13907 [Drosophila sechellia]
Length=592

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F   LGI+CG VG++G+NLFVR+IY N+K D
Sbjct  543  KTKMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID  592



>ref|XP_002025369.1| GL11985 [Drosophila persimilis]
 gb|EDW30880.1| GL11985 [Drosophila persimilis]
Length=590

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F   LGI+CG VG++G+NLFVR+IY N+K D
Sbjct  541  KTKMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID  590



>ref|XP_001957525.1| GF10453 [Drosophila ananassae]
 gb|EDV40331.1| GF10453 [Drosophila ananassae]
Length=599

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F   LGI+CG VG++G+NLFVR+IY N+K D
Sbjct  550  KTKMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID  599



>ref|XP_002047393.1| GJ11952 [Drosophila virilis]
 gb|EDW69735.1| GJ11952 [Drosophila virilis]
Length=585

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F   LGI+CG VG++G+NLFVR+IY N+K D
Sbjct  536  KTKMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID  585



>ref|NP_647979.1| CG10590 [Drosophila melanogaster]
 gb|AAL49023.1| RE48767p [Drosophila melanogaster]
 gb|AAF50762.2| CG10590 [Drosophila melanogaster]
 gb|ACL87044.1| CG10590-PA, partial [synthetic construct]
Length=592

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F   LGI+CG VG++G+NLFVR+IY N+K D
Sbjct  543  KTKMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID  592



>ref|XP_001662153.1| AAEL012016-PA [Aedes aegypti]
 gb|EAT35846.1| AAEL012016-PA [Aedes aegypti]
Length=584

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F   LGI+CG VG++G+N+FVR+IY N+K D
Sbjct  535  KTKMYGLFQTAFYFGYMALFSGALGIICGTVGYIGTNIFVRKIYSNVKID  584



>ref|XP_011352435.1| PREDICTED: transmembrane 9 superfamily member 3 [Cerapachys biroi]
 gb|EZA60571.1| Transmembrane 9 superfamily member [Cerapachys biroi]
Length=588

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F L LGI+CG VG++G+N FVR+IY  +K D
Sbjct  539  KTKMYGLFQTAFYFGYMALFSLALGIMCGTVGYIGTNAFVRKIYSTVKID  588



>ref|XP_008320400.1| PREDICTED: transmembrane 9 superfamily member 3 [Cynoglossus 
semilaevis]
Length=585

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  536  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYVGTSAFVRKIYTNVKID  585



>ref|XP_011259429.1| PREDICTED: transmembrane 9 superfamily member 3 [Camponotus floridanus]
 gb|EFN66277.1| Transmembrane 9 superfamily member 3 [Camponotus floridanus]
Length=588

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F L LGI+CG VG++G+N FVR+IY  +K D
Sbjct  539  KTKMYGLFQTAFYFGYMALFSLALGIMCGTVGYIGTNAFVRKIYSTVKID  588



>ref|XP_011155183.1| PREDICTED: transmembrane 9 superfamily member 3 [Harpegnathos 
saltator]
 ref|XP_011155184.1| PREDICTED: transmembrane 9 superfamily member 3 [Harpegnathos 
saltator]
 gb|EFN87604.1| Transmembrane 9 superfamily member 3 [Harpegnathos saltator]
Length=584

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F L LGI+CG VG++G+N FVR+IY  +K D
Sbjct  535  KTKMYGLFQTAFYFGYMALFSLALGIMCGTVGYIGTNAFVRKIYSTVKID  584



>ref|XP_003787418.1| PREDICTED: transmembrane 9 superfamily member 3 [Otolemur garnettii]
Length=541

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  492  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  541



>ref|XP_008205311.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Nasonia 
vitripennis]
Length=550

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F L LGI+CG VG++G++LFVR+IY  +K D
Sbjct  501  KTKMYGLFQTAFYFGYMALFSLALGIMCGTVGYIGTSLFVRKIYSTVKID  550



>ref|XP_007080322.1| PREDICTED: transmembrane 9 superfamily member 3 [Panthera tigris 
altaica]
Length=608

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  559  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  608



>ref|XP_001656277.1| AAEL012833-PA [Aedes aegypti]
 gb|EAT34964.1| AAEL012833-PA [Aedes aegypti]
Length=584

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F   LGI+CG VG++G+N+FVR+IY N+K D
Sbjct  535  KTKMYGLFQTAFYFGYMALFSGALGIICGTVGYIGTNVFVRKIYSNVKID  584



>ref|XP_001353740.2| GA10420 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL29474.2| GA10420 [Drosophila pseudoobscura pseudoobscura]
Length=591

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F   LGI+CG VG++G+NLFVR+IY N+K D
Sbjct  542  KTKMFGLFQTAFYFGYMALFSGALGIICGTVGYVGTNLFVRKIYSNVKID  591



>ref|XP_006157459.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Tupaia 
chinensis]
Length=577

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  528  KTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  577



>ref|XP_011163701.1| PREDICTED: transmembrane 9 superfamily member 3 [Solenopsis invicta]
Length=584

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ +FY GY  +F L LGI+CG VG++G+N FVR+IY  +K D
Sbjct  535  KTKMYGLFQTAFYFGYMALFSLALGIMCGTVGYIGTNAFVRKIYSTVKID  584



>emb|CDQ61092.1| unnamed protein product [Oncorhynchus mykiss]
Length=640

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  539  KTKMSGFFQVSFYLGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  390
            KTKM G FQ SFY GY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  591  KTKMYGLFQTSFYFGYMAVFSTSLGIMCGAVGYVGTSAFVRKIYTNVKID  640



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880