BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF045E09

Length=603
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797839.1|  PREDICTED: heat shock factor protein HSF24       73.9    2e-12   Nicotiana sylvestris
dbj|BAA83710.1|  heat shock factor                                    73.9    2e-12   Nicotiana tabacum [American tobacco]
ref|XP_006339901.1|  PREDICTED: heat shock factor protein HSF24-like  73.6    2e-12   Solanum tuberosum [potatoes]
ref|XP_009589845.1|  PREDICTED: heat shock factor protein HSF24       70.1    4e-11   Nicotiana tomentosiformis
ref|XP_004232034.1|  PREDICTED: heat shock factor protein HSF24       69.3    6e-11   
sp|P22335.1|HSF24_SOLPE  RecName: Full=Heat shock factor protein ...  66.6    6e-10   Solanum peruvianum [Peruvian tomato]



>ref|XP_009797839.1| PREDICTED: heat shock factor protein HSF24 [Nicotiana sylvestris]
Length=292

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = -1

Query  525  ENGETLKLFGVLLKEKKRKRDPDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKV  346
            E G+TLKLFGVLLKE K+KR PD+N D S +  K MK ++D  N PWMK+S  PG+S KV
Sbjct  233  EKGDTLKLFGVLLKENKKKRGPDENADISGSRGKMMK-TMDY-NLPWMKMSSAPGESNKV  290

Query  345  CN  340
            CN
Sbjct  291  CN  292



>dbj|BAA83710.1| heat shock factor [Nicotiana tabacum]
Length=292

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = -1

Query  525  ENGETLKLFGVLLKEKKRKRDPDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKV  346
            E G+TLKLFGVLLKE K+KR PD+N D S +  K MK ++D  N PWMK+S  PG+S KV
Sbjct  233  EKGDTLKLFGVLLKENKKKRGPDENADISGSRGKMMK-TMDY-NLPWMKMSSAPGESNKV  290

Query  345  CN  340
            CN
Sbjct  291  CN  292



>ref|XP_006339901.1| PREDICTED: heat shock factor protein HSF24-like [Solanum tuberosum]
Length=302

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  519  GETLKLFGVLLKEKKRKRDPDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            G+TLKLFGVLLKEKK+KR PD+N D      K MK ++D  N PWMK+S   G+S KVCN
Sbjct  244  GDTLKLFGVLLKEKKKKRGPDENIDTCGGRGKMMKTTVDY-NGPWMKMSSAAGESSKVCN  302



>ref|XP_009589845.1| PREDICTED: heat shock factor protein HSF24 [Nicotiana tomentosiformis]
Length=296

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = -1

Query  525  ENGETLKLFGVLLKEKKRKRDPDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKV  346
            E G+TLKLFGVLLKE K+KR PD+N D S +  K M  ++D  N PWMK+S   G+S K+
Sbjct  237  EKGDTLKLFGVLLKENKKKRGPDENADISGSHGK-MTKTVDY-NLPWMKLSSATGESSKI  294

Query  345  CN  340
            CN
Sbjct  295  CN  296



>ref|XP_004232034.1| PREDICTED: heat shock factor protein HSF24 [Solanum lycopersicum]
Length=301

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -1

Query  519  GETLKLFGVLLKEKKRKRDPDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            G+TLKLFGVLLKEKK+KR PDDN +      K MK ++D  N PWMK+S   G+S KVCN
Sbjct  244  GDTLKLFGVLLKEKKKKRGPDDNIETCGGRGKMMK-TVDY-NGPWMKMSSTAGESSKVCN  301



>sp|P22335.1|HSF24_SOLPE RecName: Full=Heat shock factor protein HSF24; AltName: Full=Heat 
shock transcription factor 24; Short=HSTF 24; AltName: 
Full=Heat stress transcription factor [Solanum peruvianum]
 emb|CAA39034.1| heat stress transcription factor [Solanum peruvianum]
Length=301

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -1

Query  519  GETLKLFGVLLKEKKRKRDPDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  340
            G+TLKLFGVLLKEKK+KR PD+N +      K MK ++D  N PWMK+S   G+S KVCN
Sbjct  244  GDTLKLFGVLLKEKKKKRGPDENIETCGGRGKMMK-TVDY-NGPWMKMSSPAGESSKVCN  301



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370