BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF045B06

Length=440
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFY26882.1|  catalase                                              91.3    7e-20   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                              92.4    6e-19   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                        92.4    6e-19   Ipomoea batatas [batate]
gb|AFN85536.1|  catalase                                              78.6    4e-16   Olea europaea
gb|ABS72010.1|  putative catalase                                     78.6    7e-16   Olea europaea
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                    82.8    1e-15   Nicotiana tomentosiformis
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                        82.4    2e-15   Soldanella alpina
emb|CAC04509.1|  catalase                                             79.3    5e-15   Digitalis lanata [Grecian foxglove]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                    81.3    6e-15   Nicotiana sylvestris
ref|XP_008365914.1|  PREDICTED: catalase isozyme 3-like               76.3    8e-15   
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                    80.5    9e-15   Solanum lycopersicum
gb|AAY34915.1|  catalase                                              74.7    9e-15   Prunus armeniaca
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg              80.5    1e-14   Erythranthe guttata [common monkey flower]
ref|XP_008348923.1|  PREDICTED: catalase isozyme 3-like               75.9    1e-14   
gb|AFR42412.1|  catalase                                              76.3    1e-14   Eperua falcata
ref|NP_001291326.1|  catalase isozyme 1                               80.1    1e-14   Sesamum indicum [beniseed]
gb|AFR42410.1|  catalase                                              76.3    1e-14   Eperua falcata
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1             80.1    1e-14   Solanum tuberosum [potatoes]
gb|ABC01913.1|  catalase isozyme 1-like protein                       80.1    1e-14   Solanum tuberosum [potatoes]
ref|NP_001234827.1|  catalase isozyme 1                               80.1    2e-14   Solanum lycopersicum
gb|AAR84578.1|  catalase 1a                                           79.7    2e-14   Lotus japonicus
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg              79.7    2e-14   Erythranthe guttata [common monkey flower]
dbj|BAF91369.1|  catalase                                             79.7    2e-14   Capsicum annuum
emb|CAA85470.1|  catalase                                             79.7    2e-14   Solanum tuberosum [potatoes]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2             79.7    2e-14   Solanum tuberosum [potatoes]
ref|NP_001274863.1|  catalase isozyme 1                               79.7    2e-14   Solanum tuberosum [potatoes]
gb|AAR97905.1|  catalase                                              79.7    2e-14   Solanum tuberosum [potatoes]
ref|XP_010094556.1|  Catalase isozyme 1                               79.3    2e-14   Morus notabilis
gb|AAM97542.1|  catalase 3                                            79.3    2e-14   Capsicum annuum
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3             79.3    3e-14   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ACJ11733.1|  catalase                                              79.0    3e-14   Gossypium hirsutum [American cotton]
gb|AAB62892.1|  catalase-1                                            78.6    5e-14   Nicotiana glutinosa
emb|CDY33636.1|  BnaC08g19360D                                        78.6    5e-14   Brassica napus [oilseed rape]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                       78.6    5e-14   Brassica rapa
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                        78.6    5e-14   Solanum melongena [aubergine]
emb|CDY01364.1|  BnaA07g11370D                                        78.6    6e-14   
dbj|BAD94702.1|  catalase                                             73.9    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2         78.2    6e-14   
emb|CDY29519.1|  BnaA06g14510D                                        78.2    6e-14   Brassica napus [oilseed rape]
ref|XP_009110221.1|  PREDICTED: catalase-3                            78.2    6e-14   Brassica rapa
ref|XP_002301920.1|  catalase family protein                          78.2    6e-14   Populus trichocarpa [western balsam poplar]
emb|CAI43948.1|  catalase                                             78.2    6e-14   Populus deltoides
ref|NP_001289779.1|  catalase isozyme 1                               78.2    6e-14   Nelumbo nucifera [Indian lotus]
gb|KHG12976.1|  Catalase isozyme 2                                    78.2    6e-14   Gossypium arboreum [tree cotton]
ref|XP_010498496.1|  PREDICTED: catalase-3                            78.2    6e-14   Camelina sativa [gold-of-pleasure]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2             78.2    6e-14   Gossypium hirsutum [American cotton]
emb|CDY31488.1|  BnaC05g15970D                                        78.2    7e-14   Brassica napus [oilseed rape]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like               78.2    7e-14   Populus euphratica
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg           78.2    7e-14   Eutrema salsugineum [saltwater cress]
dbj|BAJ33995.1|  unnamed protein product                              78.2    7e-14   Eutrema halophilum
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144           78.2    7e-14   
ref|XP_009149539.1|  PREDICTED: catalase-3                            78.2    7e-14   Brassica rapa
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg           78.2    7e-14   Eutrema salsugineum [saltwater cress]
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1  77.8    8e-14   Capsicum annuum
emb|CDP01802.1|  unnamed protein product                              77.8    8e-14   Coffea canephora [robusta coffee]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3         77.8    8e-14   Sesamum indicum [beniseed]
gb|KFK30147.1|  catalase                                              77.8    8e-14   Arabis alpina [alpine rockcress]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg           77.8    8e-14   Capsella rubella
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                    77.8    9e-14   Prunus mume [ume]
ref|XP_010692544.1|  PREDICTED: catalase-like                         77.8    9e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg           77.8    9e-14   Prunus persica
emb|CAD42908.1|  catalase                                             77.8    9e-14   Prunus persica
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                    77.8    9e-14   
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                    77.8    9e-14   
gb|KHG25152.1|  Catalase isozyme 1                                    77.8    9e-14   Gossypium arboreum [tree cotton]
ref|XP_010437527.1|  PREDICTED: catalase-2                            77.8    9e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                       77.8    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                       77.8    1e-13   Camelina sativa [gold-of-pleasure]
gb|ACV92695.1|  catalase                                              77.8    1e-13   Brassica oleracea
gb|AAK96854.1|  catalase                                              77.8    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54297.1|  peroxisomal catalase                                  77.8    1e-13   Phaseolus vulgaris [French bean]
gb|AAB86582.2|  catalase                                              77.8    1e-13   Raphanus sativus
prf||1906388A  catalase                                               77.8    1e-13
emb|CAA45564.1|  catalase                                             77.8    1e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CAA10286.1|  catalase                                             73.9    1e-13   Cicer arietinum [garbanzo]
emb|CDX72514.1|  BnaC07g45360D                                        77.4    1e-13   
gb|KEH36312.1|  catalase heme-binding enzyme                          77.4    1e-13   Medicago truncatula
gb|AAF71742.1|AF248491_1  catalase                                    77.4    1e-13   Raphanus sativus
ref|NP_195235.1|  catalase 2                                          77.4    1e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CAA64220.1|  catalase                                             77.4    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g           77.4    1e-13   Phaseolus vulgaris [French bean]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1              77.4    1e-13   Citrus sinensis [apfelsine]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg           77.4    1e-13   Citrus clementina [clementine]
dbj|BAH20283.1|  AT1G20620                                            73.9    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AET97564.1|  catalase                                              77.4    1e-13   Ziziphus jujuba [Chinese jujube]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like               77.4    1e-13   Nicotiana sylvestris
emb|CDP07287.1|  unnamed protein product                              77.4    1e-13   Coffea canephora [robusta coffee]
gb|EPS69543.1|  catalase                                              77.0    1e-13   Genlisea aurea
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2            77.0    1e-13   
gb|KJB14250.1|  hypothetical protein B456_002G115900                  77.0    1e-13   Gossypium raimondii
gb|KDP43757.1|  hypothetical protein JCGZ_22384                       77.0    1e-13   Jatropha curcas
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like               77.0    1e-13   Prunus mume [ume]
emb|CDY40645.1|  BnaA03g53180D                                        77.0    2e-13   Brassica napus [oilseed rape]
ref|NP_001240021.1|  catalase                                         77.0    2e-13   Glycine max [soybeans]
ref|XP_009138342.1|  PREDICTED: catalase-2                            77.0    2e-13   Brassica rapa
dbj|BAH20307.1|  AT1G20620                                            77.0    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530333.1|  PREDICTED: catalase-2                            77.0    2e-13   Tarenaya hassleriana [spider flower]
gb|AAD17933.1|  catalase                                              77.0    2e-13   Brassica juncea [brown mustard]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like               77.0    2e-13   Solanum tuberosum [potatoes]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g           77.0    2e-13   Phaseolus vulgaris [French bean]
emb|CDY31878.1|  BnaC07g15280D                                        77.0    2e-13   Brassica napus [oilseed rape]
gb|AAM65021.1|  unknown                                               77.0    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564120.1|  catalase 3                                          77.0    2e-13   Arabidopsis thaliana [mouse-ear cress]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                        77.0    2e-13   Vigna radiata var. radiata [golden gram]
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg           76.6    2e-13   Capsella rubella
emb|CAB56850.1|  catalase                                             76.3    2e-13   Prunus persica
emb|CDX76313.1|  BnaA08g10870D                                        76.6    2e-13   
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like               76.6    2e-13   Nicotiana tomentosiformis
gb|AAD17935.1|  catalase                                              76.6    2e-13   Brassica juncea [brown mustard]
gb|AAB88173.1|  catalase                                              74.7    2e-13   Glycine max [soybeans]
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                  76.6    2e-13   Arabis alpina [alpine rockcress]
ref|XP_009106100.1|  PREDICTED: catalase-2                            76.6    2e-13   Brassica rapa
gb|AJE26131.1|  catalase                                              76.3    3e-13   Salix matsudana [tortured willow]
emb|CDP01803.1|  unnamed protein product                              76.3    3e-13   Coffea canephora [robusta coffee]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                    76.3    3e-13   Populus euphratica
gb|AAD17936.1|  catalase                                              76.3    3e-13   Brassica juncea [brown mustard]
gb|ACL27272.1|  catalase                                              76.3    3e-13   Nicotiana benthamiana
gb|AFU48609.1|  catalase 1                                            76.3    3e-13   Nicotiana benthamiana
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                    76.3    3e-13   Nicotiana sylvestris
gb|AAC19397.1|  leaf catalase                                         76.3    3e-13   Mesembryanthemum crystallinum
gb|AAO17721.1|  catalase                                              76.3    3e-13   Hypericum perforatum
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                    76.3    3e-13   Nicotiana tomentosiformis
emb|CCP37650.1|  catalase-1                                           76.3    3e-13   Nicotiana tabacum [American tobacco]
gb|AIX10947.1|  putative catalase                                     76.3    3e-13   Gardenia jasminoides
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2            76.3    3e-13   Cicer arietinum [garbanzo]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1            76.3    3e-13   
emb|CDY52649.1|  BnaAnng11640D                                        75.9    3e-13   Brassica napus [oilseed rape]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1             76.3    3e-13   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CBI29556.3|  unnamed protein product                              72.0    3e-13   Vitis vinifera
ref|XP_002306976.2|  catalase family protein                          76.3    3e-13   
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1    76.3    3e-13   Nelumbo nucifera [Indian lotus]
dbj|BAC79443.1|  catalase                                             76.3    3e-13   Acacia ampliceps
ref|XP_009103333.1|  PREDICTED: catalase-1                            75.9    4e-13   Brassica rapa
gb|KJB14249.1|  hypothetical protein B456_002G115900                  74.7    4e-13   Gossypium raimondii
emb|CDY01363.1|  BnaA07g11360D                                        75.9    4e-13   
gb|KJB57963.1|  hypothetical protein B456_009G187600                  75.9    4e-13   Gossypium raimondii
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like               75.9    4e-13   Vitis vinifera
ref|NP_001268098.1|  catalase                                         75.9    4e-13   Vitis vinifera
ref|XP_002890395.1|  F5M15.5                                          76.6    4e-13   
emb|CDY31877.1|  BnaC07g15270D                                        75.9    4e-13   Brassica napus [oilseed rape]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like               75.9    4e-13   Eucalyptus grandis [rose gum]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                    75.9    4e-13   Phoenix dactylifera
gb|AAR14052.2|  catalase                                              75.9    4e-13   Solanum tuberosum [potatoes]
emb|CDX69111.1|  BnaC01g03420D                                        75.9    4e-13   
gb|AAD30292.1|AF139539_1  catalase 3                                  75.9    4e-13   Raphanus sativus
ref|XP_010061175.1|  PREDICTED: catalase-like                         75.9    4e-13   Eucalyptus grandis [rose gum]
gb|AIS20825.1|  CAT                                                   75.9    4e-13   Pyrus x bretschneideri [bai li]
gb|AAM97541.1|  catalase 2                                            75.9    4e-13   Capsicum annuum
ref|XP_010523643.1|  PREDICTED: catalase-2-like                       75.9    5e-13   Tarenaya hassleriana [spider flower]
gb|AAF79625.1|AC027665_26  F5M15.5                                    76.6    5e-13   Arabidopsis thaliana [mouse-ear cress]
gb|ADU56199.1|  catalase                                              75.5    5e-13   Hevea brasiliensis [jebe]
ref|NP_001235974.1|  catalase-3                                       75.5    5e-13   Glycine max [soybeans]
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg           72.8    6e-13   
gb|AAK67359.2|AF390210_1  catalase                                    75.5    6e-13   Suaeda salsa
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like               75.5    6e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001237556.1|  catalase-1/2                                     75.5    6e-13   Glycine max [soybeans]
gb|ACJ73905.1|  CAT1                                                  72.4    6e-13   Solanum nigrum
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                    75.5    6e-13   Vitis vinifera
gb|ACJ73906.1|  CAT2                                                  73.9    6e-13   Solanum nigrum
ref|NP_001031072.3|  catalase 3                                       74.7    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                    75.5    6e-13   
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                   75.5    6e-13   Eucalyptus grandis [rose gum]
gb|AAB71764.1|  catalase 1                                            75.1    7e-13   Nicotiana tabacum [American tobacco]
gb|ABR25882.1|  catalase isozyme b                                    70.1    7e-13   Oryza sativa Indica Group [Indian rice]
gb|ACA50528.1|  putative catalase 2                                   75.1    7e-13   Brassica napus [oilseed rape]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like               75.1    8e-13   Elaeis guineensis
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                    75.1    8e-13   Nicotiana tomentosiformis
ref|NP_001234186.1|  catalase isozyme 2                               75.1    8e-13   
gb|ACV30589.1|  catalase                                              72.0    8e-13   Carica papaya [mamon]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                    75.1    8e-13   Solanum tuberosum [potatoes]
gb|AGC65520.1|  catalase                                              75.1    9e-13   Eriobotrya japonica [loquat]
gb|AIA61608.1|  catalase                                              75.1    9e-13   Gynostemma pentaphyllum [jiaogulan]
gb|KJB17473.1|  hypothetical protein B456_003G002800                  74.7    9e-13   Gossypium raimondii
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                    74.7    9e-13   Cucumis melo [Oriental melon]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg           74.7    9e-13   Prunus persica
emb|CAD42909.1|  catalase                                             74.7    9e-13   Prunus persica
emb|CDP07288.1|  unnamed protein product                              74.7    9e-13   Coffea canephora [robusta coffee]
gb|ADZ45556.1|  catalase                                              74.7    9e-13   Vigna radiata [mung bean]
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...  74.7    1e-12   Nicotiana tabacum [American tobacco]
gb|ADZ45555.1|  catalase                                              74.7    1e-12   Vigna radiata [mung bean]
emb|CDY17510.1|  BnaC03g65530D                                        74.7    1e-12   Brassica napus [oilseed rape]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                    74.7    1e-12   Nicotiana sylvestris
ref|NP_564121.1|  catalase 1                                          74.3    1e-12   Arabidopsis thaliana [mouse-ear cress]
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2             74.3    1e-12   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAA57551.1|  catalase                                              73.6    1e-12   Nicotiana sylvestris
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                   74.3    1e-12   Sesamum indicum [beniseed]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                    74.3    1e-12   Elaeis guineensis
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1             74.3    2e-12   Gossypium hirsutum [American cotton]
gb|AAD30291.2|AF139538_1  catalase 2                                  74.3    2e-12   Raphanus sativus
gb|AAC17731.1|  catalase 1                                            73.9    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237571.1|  catalase-4                                       73.9    2e-12   Glycine max [soybeans]
ref|XP_010692546.1|  PREDICTED: catalase                              73.9    2e-12   Beta vulgaris subsp. vulgaris [field beet]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                        73.9    2e-12   Avicennia marina
gb|KGN55499.1|  hypothetical protein Csa_4G658590                     73.9    2e-12   Cucumis sativus [cucumbers]
gb|AHF27433.1|  catalase                                              73.9    2e-12   Cucurbita maxima [Boston marrow]
gb|AHF27430.1|  catalase                                              73.9    2e-12   Cucurbita moschata [ayote]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g           73.6    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g           73.6    2e-12   
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                  73.6    3e-12   Arabis alpina [alpine rockcress]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2    73.6    3e-12   Eucalyptus grandis [rose gum]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                    73.6    3e-12   Cucumis melo [Oriental melon]
gb|AFK46618.1|  unknown                                               69.7    3e-12   Lotus japonicus
gb|AHF21552.1|  catalase                                              73.6    3e-12   Hylocereus undatus [dragon fruit]
emb|CAE82295.1|  catalase                                             73.2    3e-12   Homogyne alpina
gb|AFU90822.1|  catalase                                              73.2    3e-12   Populus tomentosa [Chinese white poplar]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like               73.2    3e-12   Phoenix dactylifera
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1    73.2    4e-12   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like               73.2    4e-12   
ref|XP_011022275.1|  PREDICTED: catalase-like                         72.8    4e-12   Populus euphratica
gb|AFU90823.1|  catalase                                              72.8    4e-12   Populus x beijingensis
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like               72.8    4e-12   
gb|ADM96039.1|  catalase                                              72.8    4e-12   Cucumis sativus [cucumbers]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg           72.8    4e-12   Citrus clementina [clementine]
emb|CDY31866.1|  BnaC07g15160D                                        70.5    5e-12   Brassica napus [oilseed rape]
ref|XP_010536470.1|  PREDICTED: catalase-2-like                       72.8    5e-12   Tarenaya hassleriana [spider flower]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4    72.8    5e-12   Citrus sinensis [apfelsine]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1             72.8    5e-12   Cucurbita pepo
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1            72.8    5e-12   Populus euphratica
ref|XP_007046520.1|  Catalase 2                                       72.4    5e-12   Theobroma cacao [chocolate]
gb|AAF19965.1|AF207906_1  catalase 1                                  72.4    6e-12   Zantedeschia aethiopica [arum-lily]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2            72.4    7e-12   Populus euphratica
gb|AAC49807.1|  catalase 3                                            72.4    7e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AHF27428.1|  catalase                                              71.2    7e-12   Cucurbita moschata [ayote]
ref|NP_001048861.1|  Os03g0131200                                     72.4    7e-12   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                    72.4    7e-12   
ref|XP_006649332.1|  PREDICTED: catalase-1-like                       72.4    7e-12   Oryza brachyantha
dbj|BAA34205.1|  catalase                                             72.0    7e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                    72.0    8e-12   Phoenix dactylifera
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                    72.0    8e-12   Fragaria vesca subsp. vesca
dbj|BAA05494.1|  catalase                                             72.0    9e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg           72.0    9e-12   Eutrema salsugineum [saltwater cress]
ref|NP_001058635.1|  Os06g0727200                                     72.0    9e-12   
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...  72.0    9e-12   Oryza sativa Indica Group [Indian rice]
dbj|BAA34204.1|  catalase                                             72.0    9e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like               72.0    9e-12   Oryza brachyantha
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like               72.0    1e-11   Cucumis melo [Oriental melon]
gb|ACH63223.1|  catalase                                              72.0    1e-11   Rheum australe [Himalayan rhubarb]
gb|AAF61734.1|AF243519_1  catalase 4                                  72.0    1e-11   Helianthus annuus
gb|ABY21704.1|  catalase-1 precursor                                  71.6    1e-11   Panax ginseng [Asiatic ginseng]
ref|XP_007018034.1|  Catalase 2                                       71.6    1e-11   
gb|AAY59707.1|  catalase                                              71.6    1e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_003558892.1|  PREDICTED: catalase-1                            71.6    1e-11   Brachypodium distachyon [annual false brome]
pir||S40265  catalase (EC 1.11.1.6) - eggplant                        71.6    1e-11
gb|AGE15298.2|  catalase 1                                            71.6    1e-11   Eriobotrya japonica [loquat]
dbj|BAA34714.1|  catalase                                             71.2    1e-11   Oryza sativa [red rice]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                    71.2    1e-11   Elaeis guineensis
ref|XP_002521709.1|  catalase, putative                               71.2    1e-11   Ricinus communis
gb|AIP93616.1|  CAT1                                                  71.2    2e-11   Bassia scoparia [burning bush]
gb|AAB07026.1|  catalase 1                                            71.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADC95629.1|  catalase                                              71.2    2e-11   Bruguiera gymnorhiza [Burma mangrove]
gb|AAF61733.1|AF243518_1  catalase 3                                  71.2    2e-11   Helianthus annuus
gb|AAL00886.1|  catalase                                              69.3    2e-11   Suaeda salsa
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2             71.2    2e-11   Ricinus communis
ref|XP_004985840.1|  PREDICTED: catalase-1-like                       70.9    2e-11   Setaria italica
gb|AFN81243.1|  catalase 1                                            70.9    2e-11   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160        70.9    2e-11   Amborella trichopoda
dbj|BAQ21275.1|  catalase                                             70.5    3e-11   Citrus tamurana
gb|AFR53082.1|  CAT                                                   70.5    3e-11   Anthurium andraeanum [flamingo-lily]
gb|AAD37788.1|AF149283_1  catalase 1                                  70.5    3e-11   Phaseolus vulgaris [French bean]
gb|ABY19573.1|  catalase                                              68.6    3e-11   Manihot esculenta [manioc]
gb|ABM47415.1|  catalase                                              70.5    3e-11   Prunus avium [gean]
gb|AHB72694.1|  catalase                                              70.5    3e-11   Beta vulgaris subsp. maritima [sea beet]
gb|AFD29285.1|  catalase                                              70.5    3e-11   Vicia faba [broad bean]
gb|AAX84671.1|  catalase CAT2                                         68.6    3e-11   Manihot esculenta [manioc]
emb|CAG23920.1|  catalase                                             70.5    3e-11   Festuca arundinacea [tall fescue]
gb|AAC19398.1|  root catalase                                         70.1    3e-11   Mesembryanthemum crystallinum
gb|AHF27432.1|  catalase                                              70.1    3e-11   Cucurbita maxima [Boston marrow]
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3             70.1    4e-11   Cucurbita pepo
gb|AHF27429.1|  catalase                                              70.1    4e-11   Cucurbita moschata [ayote]
dbj|BAH37035.1|  catalase 1                                           70.1    4e-11   Pisum sativum [garden pea]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like               70.1    4e-11   Tarenaya hassleriana [spider flower]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                    70.1    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2             69.7    5e-11   Cucurbita pepo
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                          69.7    5e-11   Pisum sativum [garden pea]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                       69.7    5e-11   Tarenaya hassleriana [spider flower]
ref|NP_001241808.1|  catalase isozyme B                               69.7    6e-11   Zea mays [maize]
emb|CAA42720.1|  catalase-1                                           69.7    6e-11   Zea mays [maize]
gb|AAG43363.1|AF151368_1  catalase                                    69.7    6e-11   Hevea brasiliensis [jebe]
dbj|BAJ88747.1|  predicted protein                                    69.7    6e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAC48918.1|  salicylic acid binding catalase                       69.3    7e-11   
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                        69.3    7e-11   
prf||2104177A  catalase                                               69.3    8e-11
gb|AHA50082.1|  catalase                                              69.3    8e-11   
dbj|BAJ90861.1|  predicted protein                                    68.9    8e-11   
gb|AEQ30070.1|  catalase                                              68.9    9e-11   
gb|AAZ29552.1|  catalase-C                                            68.9    9e-11   
gb|KHG21219.1|  Catalase isozyme 1                                    68.9    9e-11   
gb|AIU99486.1|  catalase                                              68.9    9e-11   
gb|ABR15776.1|  catalase                                              67.4    1e-10   
gb|AIU99485.1|  catalase                                              68.9    1e-10   
gb|AIU99484.1|  catalase                                              68.9    1e-10   
gb|AIU99481.1|  catalase                                              68.9    1e-10   
gb|AIM43584.1|  catalase                                              68.9    1e-10   
gb|AIU99482.1|  catalase                                              68.9    1e-10   
gb|AIU99479.1|  catalase                                              68.9    1e-10   
gb|ABQ44283.1|  catalase                                              67.8    1e-10   
gb|ABB72796.1|  catalase isozyme 1-like protein                       68.6    1e-10   
gb|ACB11496.1|  catalase                                              68.6    1e-10   
gb|AFW69584.1|  catalase1                                             67.8    1e-10   
gb|ABK24453.1|  unknown                                               68.6    1e-10   
gb|AIU99488.1|  catalase                                              68.6    1e-10   
gb|AIU99480.1|  catalase                                              68.6    1e-10   
gb|AAG61140.2|AF332973_1  catalase 2                                  68.6    1e-10   
gb|EMT05040.1|  Catalase-1                                            68.6    2e-10   
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                     68.2    2e-10   
gb|ACJ22771.1|  catalase 1                                            68.2    2e-10   
ref|XP_002510677.1|  catalase, putative                               68.6    2e-10   
tpg|DAA43177.1|  TPA: catalase2                                       67.8    2e-10   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                       67.8    2e-10   
gb|ACJ76836.3|  catalase                                              67.8    2e-10   
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2             67.8    2e-10   
ref|NP_001105310.1|  catalase isozyme 2                               67.8    2e-10   
prf||1803522A  catalase                                               67.8    2e-10
ref|XP_010459749.1|  PREDICTED: catalase-1-like                       67.8    2e-10   
gb|AIU99487.1|  catalase                                              67.8    2e-10   
ref|XP_010477308.1|  PREDICTED: catalase-1                            67.8    2e-10   
gb|AIU99483.1|  catalase                                              67.8    3e-10   
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840        67.8    3e-10   
ref|NP_001105415.1|  catalase isozyme 1                               67.8    3e-10   
ref|XP_002963082.1|  hypothetical protein SELMODRAFT_79329            63.2    3e-10   
gb|ACN36234.1|  unknown                                               66.6    3e-10   
ref|XP_002980255.1|  hypothetical protein SELMODRAFT_112561           62.4    3e-10   
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like               67.8    4e-10   
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550        67.0    4e-10   
ref|XP_002980252.1|  hypothetical protein SELMODRAFT_112333           63.5    4e-10   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1             67.0    5e-10   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                       66.6    5e-10   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1             66.6    6e-10   
tpg|DAA43178.1|  TPA: catalase2                                       66.6    7e-10   
dbj|BAJ87148.1|  predicted protein                                    65.1    7e-10   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313           66.2    8e-10   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like               66.6    8e-10   
gb|ACL35349.1|  catalase                                              66.2    8e-10   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171           66.2    9e-10   
gb|AAF61732.1|AF243517_1  catalase 2                                  66.2    9e-10   
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...  65.5    1e-09   
gb|AAC17729.1|  catalase 1                                            65.1    1e-09   
emb|CDY31490.1|  BnaC05g15990D                                        65.5    1e-09   
emb|CDY29518.1|  BnaA06g14520D                                        65.5    2e-09   
gb|AIZ77475.1|  catalase                                              65.5    2e-09   
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1             65.5    2e-09   
ref|XP_009149540.1|  PREDICTED: catalase-1                            65.1    2e-09   
gb|KGN55500.1|  hypothetical protein Csa_4G658600                     64.7    2e-09   
gb|AAD50974.1|AF170272_1  catalase CAT1                               65.1    2e-09   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2    64.7    3e-09   
gb|ADU56198.1|  catalase                                              64.7    3e-09   
ref|XP_001779509.1|  predicted protein                                64.7    3e-09   
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656           62.0    3e-09   
emb|CAA42026.1|  catalase                                             60.5    3e-09   
dbj|BAK04899.1|  predicted protein                                    59.7    4e-09   
gb|EMS35721.1|  Catalase isozyme 1                                    63.2    4e-09   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                    63.9    5e-09   
gb|ADN94253.1|  catalase                                              62.8    1e-08   
gb|KCW44990.1|  hypothetical protein EUGRSUZ_L01419                   61.6    2e-08   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                    61.6    3e-08   
gb|ABV55108.1|  catalase 2                                            61.2    3e-08   
gb|AAX88799.1|  catalase                                              60.5    6e-08   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901           60.1    1e-07   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                    59.7    1e-07   
gb|ADK25939.1|  catalase                                              57.8    2e-07   
dbj|BAD07937.1|  catalase catA-like protein                           56.6    2e-07   
gb|AJF34884.1|  catalase                                              59.3    2e-07   
gb|AAC17730.1|  catalase 2                                            57.8    4e-07   
gb|ADY02963.1|  catalase                                              57.8    6e-07   
gb|ACL81498.1|  catalase                                              57.8    6e-07   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...  57.8    6e-07   
emb|CAH61266.1|  catalase                                             57.8    6e-07   
dbj|BAJ92414.1|  predicted protein                                    57.8    6e-07   
gb|EMS51034.1|  Catalase isozyme 2                                    57.4    7e-07   
ref|XP_001752315.1|  predicted protein                                57.4    8e-07   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2             57.0    9e-07   
gb|EMT06167.1|  Catalase isozyme 2                                    57.0    1e-06   
ref|NP_001031073.1|  catalase 3                                       56.2    2e-06   
ref|XP_001784759.1|  predicted protein                                56.2    2e-06   
ref|NP_001045673.1|  Os02g0115700                                     56.2    2e-06   
gb|ABN71233.2|  catalase                                              56.2    2e-06   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                        55.8    2e-06   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                        55.8    2e-06   
gb|AHZ13843.1|  catalase                                              55.5    3e-06   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2    55.5    3e-06   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130        54.7    5e-06   
gb|AGT15888.1|  catalase                                              54.7    5e-06   
gb|AGT16054.1|  catalase                                              54.7    5e-06   
gb|AGT16188.1|  catalase                                              54.7    5e-06   
gb|AGT16310.1|  catalase                                              54.7    5e-06   
emb|CAB64452.1|  catalase                                             50.4    6e-06   
gb|AGT16203.1|  catalase                                              54.7    6e-06   
gb|ADQ28492.1|  catalase                                              53.9    1e-05   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                         53.5    1e-05
emb|CAA43814.1|  catalase                                             53.5    1e-05   
gb|ABK24449.1|  unknown                                               51.6    5e-05   
gb|ABR16304.1|  unknown                                               50.8    9e-05   
gb|AFW66787.1|  catalase3                                             50.4    1e-04   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3             50.4    1e-04   
gb|ABK24543.1|  unknown                                               50.1    2e-04   
ref|XP_005645077.1|  catalase                                         49.7    3e-04   



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  130  RWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  173



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  449  RWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  492



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  449  RWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  492



>gb|AFN85536.1| catalase, partial [Olea europaea]
Length=60

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRLN+RPTM
Sbjct  17   KWVDALSDPRVTHEIRSIWISYCSQADRSLGQKLASRLNVRPTM  60



>gb|ABS72010.1| putative catalase, partial [Olea europaea]
Length=86

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRLN+RPTM
Sbjct  43   KWVDALSDPRVTHEIRSIWISYCSQADRSLGQKLASRLNVRPTM  86



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNIRPTM  492



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY TQAD+SLGQK+ASRLN+RPTM
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+THEIRS W+SY TQAD+SLGQK+ASRLNIRPTM
Sbjct  222  RWVDALSDPRLTHEIRSIWVSYWTQADKSLGQKLASRLNIRPTM  265



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD++LGQK+ASRLN+RPTM
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADKTLGQKIASRLNVRPTM  492



>ref|XP_008365914.1| PREDICTED: catalase isozyme 3-like [Malus domestica]
Length=108

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV  LSEPRVTHEIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  65   RWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  108



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 35/44 (80%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR THEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  449  RWVDALSDPRATHEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>gb|AAY34915.1| catalase [Prunus armeniaca]
Length=56

 Score = 74.7 bits (182),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  13   RWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  56



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RPTM
Sbjct  449  RWVDALSDPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>ref|XP_008348923.1| PREDICTED: catalase isozyme 3-like [Malus domestica]
Length=103

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV  LSEPRVTHEIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  60   RWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  103



>gb|AFR42412.1| catalase, partial [Eperua falcata]
Length=131

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ L++PRVTHEIRS WISYL+QADRSLGQKVAS LN+RP++
Sbjct  88   RWVEVLADPRVTHEIRSIWISYLSQADRSLGQKVASHLNMRPSI  131



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RPTM
Sbjct  449  RWVEALSDPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>gb|AFR42410.1| catalase, partial [Eperua falcata]
Length=135

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ L++PRVTHEIRS WISYL+QADRSLGQKVAS LN+RP++
Sbjct  92   RWVEVLADPRVTHEIRSIWISYLSQADRSLGQKVASHLNMRPSI  135



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  449  KWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  449  KWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  449  KWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRSTWISY +QADRSLGQK+AS LN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSTWISYWSQADRSLGQKIASHLNLRPSI  492



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+THEIR  WISY TQAD+SLGQK+ASRLN+RPTM
Sbjct  449  RWVDALSDPRLTHEIRGIWISYWTQADKSLGQKLASRLNVRPTM  492



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  449  KWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>emb|CAA85470.1| catalase [Solanum tuberosum]
Length=491

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  448  KWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  491



>sp|P55312.1|CATA2_SOLTU RecName: Full=Catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  449  KWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  449  KWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|AAR97905.1| catalase [Solanum tuberosum]
Length=492

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  449  KWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  449  RWVNALSDPRVTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LSEPRVTHEIR+ W+SY +QAD+SLGQK+ASRLN++PTM
Sbjct  449  RWVDALSEPRVTHEIRTIWLSYWSQADKSLGQKLASRLNVKPTM  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS W SY +QAD++LGQK+ASRLN+RPTM
Sbjct  449  RWVDALSDPRVTHEIRSIWFSYWSQADKTLGQKIASRLNVRPTM  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVEALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  449  RWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  449  RWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  449  KWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLLVKPTM  492



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  513  RWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  556



>dbj|BAD94702.1| catalase [Arabidopsis thaliana]
Length=108

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  65   RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  108



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+THEIRS W+SY +QAD+SLGQK+ASRLN+RP M
Sbjct  449  RWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKLASRLNVRPAM  492



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  449  RWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  449  RWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN++P+M
Sbjct  449  RWIDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVKPSM  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  449  RWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  457  RWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  500



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  500  RWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  543



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  475  RWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  518



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+SLS+PR THEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  449  KWVESLSDPRATHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>emb|CDP01802.1| unnamed protein product [Coffea canephora]
Length=469

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVT+EIRS WISY +QAD+SLGQK+ASRLNIRP++
Sbjct  426  RWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRLNIRPSI  469



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+THEIRS W+SY +QAD+SLGQK+AS LN+RPTM
Sbjct  449  RWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKLASHLNVRPTM  492



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010692544.1| PREDICTED: catalase-like [Beta vulgaris subsp. vulgaris]
Length=492

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 35/44 (80%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            R+VK+LS+PR+T+EIRS W+SYLTQAD+SLG KVASRLNIRPTM
Sbjct  449  RFVKALSDPRLTYEIRSIWVSYLTQADKSLGMKVASRLNIRPTM  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV  LSEPRVTHEIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  449  RWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV  LSEPRVTHEIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  449  RWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++ S+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVEAFSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  449  RWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  448  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>prf||1906388A catalase
Length=492

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAA10286.1| catalase [Cicer arietinum]
Length=125

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PRVTHE+RS WISY +QADRSLGQK+AS LN+RP++
Sbjct  82   RWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  125



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  437  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  480



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNMRPSI  492



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  449  RWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+K+L +PRVTHE+RS W+SY +QADRSLGQK+ASRLN+RP++
Sbjct  434  RWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  477



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+K+L +PRVTHE+RS W+SY +QADRSLGQK+ASRLN+RP++
Sbjct  450  RWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  493



>dbj|BAH20283.1| AT1G20620 [Arabidopsis thaliana]
Length=145

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  102  RWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  145



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PRVTHEIR  WISY +QAD+SLG+K+ASRLN+RPTM
Sbjct  449  RWINALSDPRVTHEIRIIWISYWSQADKSLGEKIASRLNVRPTM  492



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+ RVTHEIRS WISY +QAD+SLGQK+A+RLN+RPTM
Sbjct  449  RWVDALSDARVTHEIRSIWISYWSQADKSLGQKIATRLNVRPTM  492



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+T EIRS WISY TQAD+SLGQK+ASRLN+RPTM
Sbjct  449  RWVDALSDPRLTQEIRSIWISYWTQADKSLGQKLASRLNVRPTM  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  453  RWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  496



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+ASRLN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPSI  492



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RPTM
Sbjct  449  RWVEALSDPRVTYEIRSIWISYWSQADKSLGQKIASHLNMRPTM  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  442  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  485



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRL++RP +
Sbjct  449  RWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPNI  492



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  449  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  415  RWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  458



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIEALSDPRITHEIRSIWISYWSQADQSLGQKLASRLNVRPSI  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  453  RWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  496



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+ R THEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  449  RWVDALSDLRATHEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LSEPRVTHEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  449  RWVDALSEPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  449  RWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  449  RWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  449  RWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  449  RWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  449  RWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  380  RWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  423



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  434  RWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  477



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PRVTHEI + WISY +QAD+SLG+K+ASRLN+RPTM
Sbjct  449  RWINALSDPRVTHEIHTIWISYWSQADKSLGEKIASRLNVRPTM  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  449  RWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRL++RP +
Sbjct  265  RWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPNI  308



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  449  RWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  449  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVDALSDPRATHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVT+EIRS WISY +QAD+SLGQK+ASRLNIRP++
Sbjct  449  RWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRLNIRPSI  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LSEPRVTHE+RS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  449  RWVDALSEPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPSI  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+A+RLN+RP++
Sbjct  449  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLANRLNVRPSI  492



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  448  RWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+THEIR+ WISY +QAD+S+G K+ASRLN+RPTM
Sbjct  449  RWVDALSDPRITHEIRNIWISYWSQADKSVGMKLASRLNVRPTM  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ SLS+PRVTHEIR+ W++Y  QAD+SLGQK+ASRLN+RP M
Sbjct  449  RWISSLSDPRVTHEIRAIWVTYWYQADKSLGQKLASRLNVRPNM  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+THEIRS WISY +QAD+SLGQK+A RLN+RPTM
Sbjct  449  RWVDALSDPRLTHEIRSIWISYWSQADKSLGQKIAFRLNVRPTM  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PRVTHE+RS WISY +QADRSLGQK+AS LN+RP++
Sbjct  449  RWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PRVTHE+RS WISY +QADRSLGQK+AS LN+RP++
Sbjct  450  RWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  493



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  406  RWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  449



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  442  RWVETLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  485



>emb|CBI29556.3| unnamed protein product [Vitis vinifera]
 emb|CBI37653.3| unnamed protein product [Vitis vinifera]
Length=112

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            RWV++LS+PRVT+EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  69   RWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  110



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LSEPRVTHE+RS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  449  RWVDALSEPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPSV  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW  +LS+PRVTHEIRS WISY +QAD+SLGQK+A+RLN++P+M
Sbjct  449  RWFDALSDPRVTHEIRSIWISYWSQADKSLGQKLATRLNVKPSM  492



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+  LS+P+VTHE+RS WISYL+QADRSLGQKVAS LN+RP++
Sbjct  449  RWIGVLSDPKVTHEVRSIWISYLSQADRSLGQKVASHLNMRPSI  492



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            R+V++L+EPRVTHEIRS WISY TQAD+SLGQK+ASRLN+RP
Sbjct  449  RFVEALAEPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  490



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+ASRLN+RP++
Sbjct  301  RWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPSI  344



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            R+V++L+EPRVTHEIRS WISY TQAD+SLGQK+ASRLN+RP
Sbjct  449  RFVEALAEPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  490



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV ++S+PRVTHEIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVDAMSDPRVTHEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            RWV++LS+PRVT+EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  449  RWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            RWV++LS+PRVT+EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  449  RWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  312
            RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  456  RWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  498


 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            R+V++LSEPRVTHEIRS WISY +QAD+SLGQK+A+RLN+RP
Sbjct  938  RFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRP  979



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            R+V++L+EPRVTHEIRS WISY TQAD+SLGQK+ASRLN+RP
Sbjct  449  RFVEALAEPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  490



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+K+L+EPRVTHE RS WISY TQAD+SLGQK+ASRL+ RP+M
Sbjct  449  RWIKALTEPRVTHEHRSIWISYWTQADKSLGQKLASRLSARPSM  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PRVT+EIRS WISY +Q DRSLGQK+A+RLN++P+M
Sbjct  449  RWVEALSDPRVTYEIRSIWISYWSQCDRSLGQKIATRLNVKPSM  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  432  RWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  475



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  437  RWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASHLNVRPNI  480



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIRS WISY +QAD SLGQK+ASRLN+RP++
Sbjct  449  RWVEILSEPRLTHEIRSIWISYWSQADASLGQKLASRLNVRPSI  492



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PRVT EIRS WISY TQAD+SLGQK+AS LN+RP+M
Sbjct  449  RWVEALSDPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPSM  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVT+EIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  449  RWVDALSDPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  441  RWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  484



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASR+N+RP +
Sbjct  449  RWIEALSDPRITHEIRSIWISYWSQADQSLGQKLASRMNVRPNI  492



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  312
            RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  488  RWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  530


 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -1

Query  440   RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
             R+V++LSEPRVTHEIRS WISY +QAD+SLGQK+A+RLN+RP
Sbjct  970   RFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRP  1011



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+++S+PRVT+EIRS WISY  QAD+SLGQK+AS LN+RPTM
Sbjct  449  RWVEAMSDPRVTYEIRSIWISYWYQADKSLGQKIASHLNMRPTM  492



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>ref|XP_006306503.1| hypothetical protein CARUB_v10012491mg [Capsella rubella]
 gb|EOA39401.1| hypothetical protein CARUB_v10012491mg [Capsella rubella]
Length=201

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            R+V++LSEPRVTHEIRS WISY +QAD+SLGQK+A+RLN+RP +
Sbjct  158  RFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRPNI  201



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            R V +LS+PRVTHEIRS WISY +QAD+SLG KVASRLN+RPTM
Sbjct  449  RVVDALSDPRVTHEIRSIWISYWSQADKSLGMKVASRLNVRPTM  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIR  WISY +Q D+SLGQK+A+RLN++PTM
Sbjct  449  RWVDALSDPRVTHEIRDIWISYWSQCDKSLGQKIATRLNVKPTM  492



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>gb|ACJ73905.1| CAT1 [Solanum nigrum]
Length=168

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  125  RWVEPLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  168



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVT+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+SLS+PRVTHEI S WISYL+QAD+S GQKVASRL ++P M
Sbjct  272  KWVESLSDPRVTHEIPSIWISYLSQADKSCGQKVASRLTVKPPM  315



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  334  RWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  377



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVT+EIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  449  RWVDALSDPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PRVT EIRS WISY TQAD+SLGQK+AS LN+RP+M
Sbjct  541  RWVEALSDPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPSM  584



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+T+EIR+ WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVEALSDPRITYEIRTIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ABR25882.1| catalase isozyme b [Oryza sativa Indica Group]
Length=65

 Score = 70.1 bits (170),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  22   RWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  65



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            R+V++L+EPRVTHEIRS WISY TQAD+SLGQK+ASRLN+RP
Sbjct  449  RFVEALAEPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  490



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PRVT+EIR+ WISY +Q DRSLGQK+A+RLN++P+M
Sbjct  449  RWVEALSDPRVTYEIRTIWISYWSQCDRSLGQKIATRLNVKPSM  492



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  449  KWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+T+EIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVEALSDPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACV30589.1| catalase [Carica papaya]
Length=170

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWVK+LSEPR+THEIRS WI +L++AD SLG+KVA RLNIRP++
Sbjct  127  RWVKALSEPRITHEIRSIWIDWLSRADESLGRKVAMRLNIRPSI  170



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PR+T+EIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWVEALSDPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV  LSEPRVT+EIRS WISY +QADRS GQK+A+RLN+RP++
Sbjct  449  RWVDVLSEPRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRS+GQK+AS LN+RP++
Sbjct  449  RWVNALSDPRVTHEIRSIWISYWSQADRSVGQKLASHLNMRPSI  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+ RVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  RWIDALSDSRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRS+GQK+AS LN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADRSVGQKLASHLNVRPSI  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ SRLN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ SRLN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV  LS+ RVTHEIRS WISY +QAD+SLGQK+A+RLN+RPTM
Sbjct  449  RWVDILSDARVTHEIRSIWISYWSQADKSLGQKMATRLNVRPTM  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS L++RP +
Sbjct  449  RWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  449  KWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS L++RP +
Sbjct  449  RWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+++LS+PR+THEIRS WISY +QAD++LGQK+AS LN+RP++
Sbjct  434  RWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASHLNVRPSI  477



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  449  KWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            R+V++LSEPRVTHEIRS WISY +QAD+SLGQK+A+RLN+RP
Sbjct  449  RFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRP  490



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  449  KWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            +WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  340  KWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  383



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+T EIRS W+SY TQAD+SLGQK+ASRLN+RP M
Sbjct  470  RWIDALSDPRLTAEIRSIWVSYWTQADKSLGQKLASRLNVRPAM  513



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PRVTHEI+S WISY +Q D+SLGQK+A+RLN++P M
Sbjct  449  RWVEALSDPRVTHEIQSIWISYWSQCDKSLGQKIATRLNVKPCM  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+AS LN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASLLNVRPSI  492



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSE R+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  449  RWVEILSELRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            R+V++LSEPRVTHEIRS WISY +QAD+SLGQK+A+RLN+RP
Sbjct  449  RFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRP  490



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS L+ RP +
Sbjct  449  RWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSTRPNI  492



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            R V +LS+PR+THEIRS W+SY +QAD+SLG KVASRLN+RPTM
Sbjct  449  RVVDALSDPRITHEIRSIWVSYWSQADKSLGMKVASRLNVRPTM  492



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+T EIRS W+SY +QAD+S GQK+ASRLN+RPTM
Sbjct  449  RWVDALSDPRLTLEIRSIWVSYWSQADKSFGQKLASRLNVRPTM  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WI+Y +QADRS+GQK+AS LN+RP++
Sbjct  449  RWVDALSDPRVTHEIRSIWITYWSQADRSVGQKLASHLNVRPSI  492



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASRLN+RP +
Sbjct  449  RFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASRLN+RP +
Sbjct  449  RFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  449  RWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPSI  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  447  RWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPSI  490



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  312
            R+V++L+EPRVTHEIRS WISY +QAD+SLGQK+ASRLN RP+
Sbjct  449  RFVEALAEPRVTHEIRSIWISYWSQADKSLGQKLASRLNARPS  491



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+K+LSEPRVTHE RS WISY TQAD+S+GQK+AS L+ RP+M
Sbjct  449  RWIKALSEPRVTHEHRSIWISYWTQADKSIGQKLASSLSARPSM  492



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASR+N+RP++
Sbjct  449  RFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPSI  492



>gb|AFK46618.1| unknown [Lotus japonicus]
Length=112

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WISY +QADRS GQK+A  LN+ P++
Sbjct  69   RWVDALSDPRVTHEIRSAWISYWSQADRSFGQKIAFHLNLGPSI  112



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV  LS+PRVT E+RS W+SYL+Q DRSLG KVA+RLN+RPTM
Sbjct  449  RWVDVLSDPRVTLELRSIWVSYLSQCDRSLGMKVATRLNMRPTM  492



>emb|CAE82295.1| catalase [Homogyne alpina]
Length=492

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            R VK LS+PRVTHE+RS WISY TQAD+SLGQK+ASRLN+RP
Sbjct  449  RMVKMLSDPRVTHELRSIWISYWTQADQSLGQKIASRLNVRP  490



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNI  321
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+
Sbjct  448  RWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  487



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PRVTHEI+S WISY +Q D+SLG+K+A+RLN++P+M
Sbjct  449  RWVEALSDPRVTHEIQSIWISYWSQCDKSLGRKIATRLNVKPSM  492



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  469  RWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  512



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASR+N+RP +
Sbjct  449  RFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPNI  492



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP
Sbjct  433  RWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRP  474



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNI  321
            RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+
Sbjct  407  RWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  446



>ref|XP_004144240.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
Length=483

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASR+N+RP +
Sbjct  440  RFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPNI  483



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASR+N+RP +
Sbjct  449  RFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPNI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  449  RWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>emb|CDY31866.1| BnaC07g15160D [Brassica napus]
Length=201

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+P +THEIR+ WISY +QA++SLGQK+ASRLN+RP +
Sbjct  158  RWIDALSDPPITHEIRNIWISYCSQANKSLGQKLASRLNVRPGI  201



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  312
            RWV++LS+ R THEIRS WISY +QAD+SLGQK+ASRLN+RP+
Sbjct  449  RWVEALSDKRCTHEIRSIWISYWSQADKSLGQKLASRLNVRPS  491



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  449  RWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+ RVTHEIRS WISY +QADRSLGQK+AS LN+RP++
Sbjct  449  RWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP
Sbjct  468  RWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRP  509



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVT+EIRS WISY ++AD+SLGQK+ASRL++RP++
Sbjct  449  RWVDALSDPRVTYEIRSIWISYWSKADKSLGQKLASRLSVRPSI  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PRVTHEIR+ WI+Y +Q D+ LGQK+ASRLNI+PT+
Sbjct  449  RWIDALSDPRVTHEIRTIWITYWSQCDKFLGQKLASRLNIKPTL  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP
Sbjct  449  RWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRP  490



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV+ LSEPR+THEIR  W SY  +ADRSLGQK+ASRLN+RP++
Sbjct  449  RWVEILSEPRLTHEIRGIWTSYWLKADRSLGQKLASRLNVRPSI  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+ RVTHEIRS WISY +QADRSLGQK+AS LN+RP++
Sbjct  301  RWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI  344



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  449  RWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW +SL  P+V+HE+RS WI+YLTQ D SLGQKVA+RLN++P+M
Sbjct  449  RWAESLGHPKVSHELRSIWITYLTQCDVSLGQKVANRLNVKPSM  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  449  RWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  449  RWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW +SL  P+V+HE+RS WI+YLTQ D SLGQKVA+RLN++P+M
Sbjct  449  RWAESLGHPKVSHELRSIWITYLTQCDVSLGQKVANRLNVKPSM  492



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            RWV +LS+PR THEIRS WISY +QAD+SLGQK+AS LN+RP
Sbjct  449  RWVDALSDPRCTHEIRSIWISYWSQADKSLGQKLASHLNVRP  490



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  449  RWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            R+V++L+EPRVTHEIRS WISY +QAD+SLGQK+A+RLN++P
Sbjct  449  RFVEALAEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVKP  490



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  449  RWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  449  RWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  449  RWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  449  RWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIR  318
            RWV +LS+PRVTHEIR+ WISY +QAD+SLGQK+ASRLN++
Sbjct  449  RWVDALSDPRVTHEIRNIWISYWSQADKSLGQKLASRLNVK  489



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PRVT EIRS WISY +QAD+SLG K+A+RLN++PTM
Sbjct  449  RWIGALSDPRVTPEIRSIWISYWSQADKSLGMKLANRLNVKPTM  492



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            R  K LS+PRVTHE+RS WISY TQAD+SLGQK+ASRLN+RP
Sbjct  449  RMCKMLSDPRVTHELRSIWISYWTQADKSLGQKIASRLNVRP  490



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            R V +LS+PRVTHEIRS WISY +QAD+SLG+K+ASRLN+RP++
Sbjct  449  RVVDALSDPRVTHEIRSIWISYWSQADKSLGEKIASRLNVRPSI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PRVTHEIRS WI+Y +QA +SLGQK+ASRLN++P +
Sbjct  449  RWVDALSDPRVTHEIRSIWITYWSQACKSLGQKLASRLNVKPNI  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  449  RWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEI+S W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  449  RWIDALSDPRLTHEIKSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRL  327
            +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL
Sbjct  449  KWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRL  486



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV  LSE RVT+EIRS WISY +QADRS GQK+A+RLN+RP++
Sbjct  449  RWVDVLSESRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  449  RWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+ RVTHEIR  WI+Y +Q D+SLGQK+A+RLN+RP+M
Sbjct  449  RWVEALSDTRVTHEIRGIWITYWSQCDKSLGQKLATRLNMRPSM  492



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++L++ R+T+EIRS WISY +QAD+SLGQK+AS LN+RPTM
Sbjct  449  RWVEALTDTRITYEIRSIWISYWSQADKSLGQKLASHLNMRPTM  492



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            R V +LS+PR+THEIRS WISY TQAD+SLG KVASRLN++ TM
Sbjct  449  RVVDALSDPRITHEIRSIWISYWTQADKSLGMKVASRLNVKATM  492



>gb|AAB07026.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  315
            R+V++L EPRVTHEIRS WISY +QAD+SLGQK+A+RLN+RP
Sbjct  449  RFVEALWEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRP  490



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  440  RWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  309
            RWV++LS+PRVTHEI S WISY TQ D+ LGQK+A+RLN+RP++
Sbjct  449  RWVEALSDPRVTHEICSIWISYWTQCDKFLGQKLATRLNVRPSI  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562388334840