BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF045A22

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              224   4e-69   
gb|AHZ58481.1|  alpha-tubulin                                           220   1e-68   Syntrichia caninervis
gb|AAD50629.1|AF106571_1  alpha-tubulin                                 218   1e-68   Gossypium hirsutum [American cotton]
dbj|BAD94893.1|  tubulin alpha-5 chain-like protein                     219   3e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420792.1|  PREDICTED: tubulin alpha-3 chain-like              218   3e-68   Camelina sativa [gold-of-pleasure]
gb|AAD50627.1|AF106569_1  alpha-tubulin                                 216   4e-68   Gossypium hirsutum [American cotton]
gb|AAD50628.1|AF106570_1  alpha-tubulin                                 216   4e-68   Gossypium hirsutum [American cotton]
emb|CAD20820.1|  alpha tubulin                                          219   4e-68   Zea mays [maize]
emb|CDY35856.1|  BnaC09g37880D                                          217   4e-68   Brassica napus [oilseed rape]
emb|CAD20821.1|  alpha tubulin                                          221   5e-68   Zea mays [maize]
gb|AAD50625.1|AF106567_1  alpha-tubulin                                 216   5e-68   Gossypium hirsutum [American cotton]
gb|ABR25510.1|  tubulin alpha-1 chain                                   220   5e-68   Oryza sativa Indica Group [Indian rice]
emb|CAL35827.1|  alpha-2 tubulin                                        220   7e-68   Plantago major [cart-track plant]
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            218   8e-68   
gb|AFR42026.1|  alpha-tubulin                                           218   9e-68   Populus trichocarpa [western balsam poplar]
ref|XP_001777110.1|  predicted protein                                  223   9e-68   
gb|AFR42049.1|  alpha-tubulin                                           218   1e-67   Populus fremontii
gb|AFR42054.1|  alpha-tubulin                                           218   1e-67   Populus fremontii
gb|AFR42035.1|  alpha-tubulin                                           218   1e-67   Populus alba [abele]
gb|AFR42020.1|  alpha-tubulin                                           218   1e-67   Populus trichocarpa [western balsam poplar]
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               218   1e-67   Erythranthe guttata [common monkey flower]
dbj|BAH20267.1|  AT5G19780                                              220   1e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AFR42036.1|  alpha-tubulin                                           217   1e-67   Populus alba [abele]
gb|AFR42042.1|  alpha-tubulin                                           217   1e-67   Populus fremontii
gb|AAD50626.1|AF106568_1  alpha-tubulin                                 215   1e-67   Gossypium hirsutum [American cotton]
gb|AAN32997.1|  alpha-tubulin 1                                         215   2e-67   Gossypium hirsutum [American cotton]
gb|AFR42047.1|  alpha-tubulin                                           217   2e-67   Populus fremontii
dbj|BAA99561.1|  alpha-tubulin                                          215   2e-67   Chlorella vulgaris
gb|ACN40714.1|  unknown                                                 214   2e-67   Picea sitchensis
emb|CAJ38386.1|  alpha tubulin                                          219   2e-67   Plantago major [cart-track plant]
ref|XP_003886491.1|  unnamed protein product                            215   3e-67   Leishmania mexicana MHOM/GT/2001/U1103
gb|KJB33191.1|  hypothetical protein B456_006G002500                    216   3e-67   Gossypium raimondii
ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              217   3e-67   Solanum lycopersicum
gb|AFR42125.1|  alpha-tubulin                                           214   3e-67   Populus fremontii
gb|KJB58759.1|  hypothetical protein B456_009G224800                    221   3e-67   Gossypium raimondii
gb|KJB83378.1|  hypothetical protein B456_013G244600                    223   4e-67   Gossypium raimondii
gb|AFR42118.1|  alpha-tubulin                                           214   4e-67   Populus trichocarpa [western balsam poplar]
gb|KIY91712.1|  Tubulin alpha chain                                     218   4e-67   Monoraphidium neglectum
gb|AFR42117.1|  alpha-tubulin                                           214   4e-67   Populus trichocarpa [western balsam poplar]
gb|AAG28536.1|AF199019_1  alpha tubulin                                 216   4e-67   Leishmania major
gb|AFR42124.1|  alpha-tubulin                                           213   5e-67   Populus alba [abele]
gb|KDO25258.1|  hypothetical protein SPRG_09506                         215   6e-67   Saprolegnia parasitica CBS 223.65
ref|XP_008621874.1|  tubulin alpha                                      218   6e-67   Saprolegnia diclina VS20
dbj|BAF01952.1|  putative tubulin alpha-2/alpha-4 chain                 216   6e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              223   6e-67   Pyrus x bretschneideri [bai li]
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   223   7e-67   Pyrus x bretschneideri [bai li]
tpg|DAA41189.1|  TPA: alpha tubulin5                                    219   7e-67   
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              223   7e-67   Malus domestica [apple tree]
dbj|BAH19954.1|  AT1G50010                                              217   7e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AGG37284.1|  alpha-tubulin 2                                         223   8e-67   Salix arbutifolia
emb|CAB76917.1|  alpha-tubulin 4                                        218   8e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   223   8e-67   Malus domestica [apple tree]
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   223   8e-67   Malus domestica [apple tree]
emb|CDP17586.1|  unnamed protein product                                223   8e-67   Coffea canephora [robusta coffee]
gb|ADD84794.1|  tubulin-like protein                                    215   8e-67   Cenchrus ciliaris [African foxtail grass]
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        223   8e-67   Fragaria vesca subsp. vesca
gb|AAO63773.2|  alpha-tubulin 2                                         223   8e-67   Populus tremuloides
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   223   8e-67   Populus euphratica
gb|AHM93474.1|  alpha-tubulin                                           219   9e-67   Camellia chekiangoleosa
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     223   9e-67   Populus trichocarpa [western balsam poplar]
gb|ABR26014.1|  tubulin alpha-3 chain                                   213   9e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             223   9e-67   Prunus persica
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                223   9e-67   Erythranthe guttata [common monkey flower]
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          223   1e-66   Amborella trichopoda
tpg|DAA63280.1|  TPA: alpha tubulin6                                    219   1e-66   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              223   1e-66   Prunus mume [ume]
gb|AAW57309.1|  alpha-tubulin                                           217   1e-66   Ceratopteris richardii
gb|KJB32211.1|  hypothetical protein B456_005G229600                    220   1e-66   Gossypium raimondii
gb|AAW57310.1|  alpha-tubulin                                           217   1e-66   Ceratopteris richardii
ref|XP_002677064.1|  alpha-tubulin                                      214   1e-66   Naegleria gruberi strain NEG-M
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     221   1e-66   Eucalyptus grandis [rose gum]
gb|AHJ80820.1|  Tua3                                                    221   1e-66   Eragrostis tef [tef]
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   222   2e-66   
gb|AHJ80821.1|  Tua3                                                    221   2e-66   Eragrostis tef [tef]
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   219   2e-66   Citrus sinensis [apfelsine]
emb|CDY46272.1|  BnaC05g50610D                                          217   2e-66   Brassica napus [oilseed rape]
ref|XP_002525416.1|  tubulin alpha chain, putative                      222   2e-66   Ricinus communis
ref|XP_007030078.1|  Tubulin alpha-5                                    223   2e-66   
gb|AEG74028.1|  alpha-tubulin                                           222   2e-66   Apopellia endiviifolia (species B)
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              222   2e-66   Populus euphratica
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              222   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGG37286.1|  alpha-tubulin 4                                         222   2e-66   Salix arbutifolia
gb|KJB83375.1|  hypothetical protein B456_013G244600                    222   2e-66   Gossypium raimondii
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             222   2e-66   Gossypium arboreum [tree cotton]
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     222   2e-66   Populus trichocarpa [western balsam poplar]
gb|AAU10519.1|  alpha tubulin                                           216   2e-66   Leishmania donovani
gb|ABR67425.1|  alpha-tubulin 4                                         222   2e-66   Populus tremuloides
gb|ABO47741.1|  alpha-tubulin                                           222   2e-66   Gossypium hirsutum [American cotton]
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              222   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN40824.1|  unknown                                                 222   3e-66   Picea sitchensis
gb|ABO47735.1|  alpha-tubulin                                           222   3e-66   Gossypium hirsutum [American cotton]
gb|AFR42123.1|  alpha-tubulin                                           212   3e-66   Populus trichocarpa [western balsam poplar]
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         222   3e-66   Jatropha curcas
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             222   3e-66   Citrus clementina [clementine]
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   222   3e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   222   3e-66   Sesamum indicum [beniseed]
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   222   3e-66   Vitis vinifera
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              222   3e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   222   3e-66   Beta vulgaris subsp. vulgaris [field beet]
gb|AAO46127.1|  alpha-tubulin                                           216   3e-66   Streblomastix strix
ref|XP_001777081.1|  predicted protein                                  221   3e-66   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              221   3e-66   Morus notabilis
emb|CDY44941.1|  BnaA02g04460D                                          221   3e-66   Brassica napus [oilseed rape]
ref|XP_001782790.1|  predicted protein                                  221   3e-66   
gb|KHN06388.1|  Tubulin alpha-3 chain                                   221   3e-66   Glycine soja [wild soybean]
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   221   3e-66   Nicotiana tomentosiformis
emb|CBH08953.1|  alpha tubulin, (fragment)                              213   4e-66   Trypanosoma brucei gambiense DAL972
gb|AHJ80819.1|  Tua1                                                    215   4e-66   Eragrostis tef [tef]
gb|EKG00833.1|  epsilon tubulin, putative                               212   4e-66   Trypanosoma cruzi
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              221   4e-66   Phoenix dactylifera
gb|ETL99841.1|  tubulin alpha-2 chain                                   211   4e-66   Phytophthora parasitica
gb|AAO46130.1|  alpha-tubulin                                           215   4e-66   Streblomastix strix
gb|ABL61201.1|  alpha-tubulin                                           217   4e-66   Oxymonadida environmental sample
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   221   4e-66   Populus euphratica
gb|AGG37288.1|  alpha-tubulin 6                                         221   4e-66   Salix arbutifolia
gb|KHG06861.1|  Tubulin alpha-6 chain                                   221   4e-66   Gossypium arboreum [tree cotton]
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               221   4e-66   Populus trichocarpa [western balsam poplar]
ref|XP_002779346.1|  alpha-tubulin, putative                            213   5e-66   Perkinsus marinus ATCC 50983
gb|ABB16994.1|  unknown                                                 221   5e-66   Solanum tuberosum [potatoes]
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              221   5e-66   Populus euphratica
gb|AGG37290.1|  alpha-tubulin 8                                         221   5e-66   Salix arbutifolia
emb|CAC84108.1|  alpha-tubulin                                          211   5e-66   Gossypium hirsutum [American cotton]
gb|AAW57306.1|  alpha-tubulin                                           215   5e-66   Ceratopteris richardii
gb|EPY32266.1|  alpha tubulin                                           211   5e-66   Strigomonas culicis
ref|XP_006482574.1|  PREDICTED: tubulin alpha chain-like                211   5e-66   
gb|ABL61216.1|  alpha-tubulin                                           217   5e-66   Oxymonadida environmental sample
gb|EKF29047.1|  epsilon tubulin, putative                               214   6e-66   Trypanosoma cruzi marinkellei
gb|EKF28172.1|  epsilon tubulin, putative                               215   6e-66   Trypanosoma cruzi marinkellei
ref|XP_001566612.1|  alpha tubulin                                      215   6e-66   Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              221   6e-66   Nelumbo nucifera [Indian lotus]
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   221   6e-66   Phoenix dactylifera
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   221   7e-66   Nelumbo nucifera [Indian lotus]
dbj|BAJ06363.1|  alpha-tubulin                                          221   7e-66   Alopecurus aequalis
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             218   7e-66   Anemia phyllitidis
gb|AGD80034.1|  alpha-tubulin 1                                         221   7e-66   Hevea brasiliensis [jebe]
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   221   7e-66   Elaeis guineensis
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             221   7e-66   Hordeum vulgare [barley]
emb|CAD26887.1|  alpha-tubulin                                          221   7e-66   Miscanthus sinensis
ref|XP_007014666.1|  Tubulin alpha-5                                    221   7e-66   Theobroma cacao [chocolate]
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              221   7e-66   Oryza brachyantha
emb|CAD26891.1|  alpha-tubulin                                          221   7e-66   Miscanthus floridulus
emb|CCD11782.1|  unnamed protein product                                215   7e-66   Trypanosoma congolense IL3000
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              221   7e-66   Setaria italica
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              221   8e-66   Tarenaya hassleriana [spider flower]
emb|CAD24765.1|  alpha-tubulin                                          221   8e-66   Miscanthus sinensis
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   221   8e-66   Brachypodium distachyon [annual false brome]
ref|NP_001060075.1|  Os07g0574800                                       221   8e-66   
gb|ABD92942.1|  alpha tubulin-1D                                        221   8e-66   Triticum aestivum [Canadian hard winter wheat]
emb|CAD26886.1|  alpha-tubulin                                          221   8e-66   Miscanthus sinensis
ref|NP_001105324.1|  tubulin alpha-5 chain                              221   8e-66   Zea mays [maize]
ref|XP_002532068.1|  tubulin alpha chain, putative                      221   8e-66   Ricinus communis
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              221   8e-66   Elaeis guineensis
ref|NP_001242878.1|  uncharacterized protein LOC100806907               221   8e-66   Glycine max [soybeans]
gb|AAD11425.1|  alpha tubulin                                           218   8e-66   Mesembryanthemum crystallinum
ref|NP_001105588.1|  tubulin alpha-6 chain                              221   8e-66   Zea mays [maize]
emb|CAD24767.1|  alpha-tubulin                                          221   8e-66   Miscanthus floridulus
gb|ABL61224.1|  alpha-tubulin                                           216   8e-66   Oxymonadida environmental sample
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              220   8e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGY80453.1|  tubulin                                                 220   8e-66   Dendrocalamus latiflorus [sweet bamboo]
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    220   8e-66   Eleusine indica [crabgrass]
ref|XP_010693818.1|  PREDICTED: tubulin alpha-3 chain-like              220   8e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001237301.1|  tubulin A                                          220   8e-66   
emb|CAD26890.1|  alpha-tubulin                                          220   8e-66   Miscanthus sinensis subsp. condensatus
emb|CAD24768.1|  alpha-tubulin                                          220   9e-66   Miscanthus floridulus
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    220   9e-66   
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                220   9e-66   Erythranthe guttata [common monkey flower]
gb|ABL61215.1|  alpha-tubulin                                           216   9e-66   Oxymonadida environmental sample
gb|KHN47983.1|  Tubulin alpha-3 chain                                   219   9e-66   Glycine soja [wild soybean]
gb|EPS62716.1|  alpha-tubulin                                           219   9e-66   Genlisea aurea
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   220   9e-66   Eucalyptus grandis [rose gum]
gb|ABL61212.1|  alpha-tubulin                                           216   9e-66   Oxymonadida environmental sample
emb|CAD26892.1|  alpha-tubulin                                          220   1e-65   Miscanthus floridulus
emb|CBH08958.1|  alpha tubulin, (fragment)                              216   1e-65   Trypanosoma brucei gambiense DAL972
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    220   1e-65   Tarenaya hassleriana [spider flower]
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             220   1e-65   Phaseolus vulgaris [French bean]
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             220   1e-65   Capsella rubella
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              220   1e-65   Brassica rapa
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   220   1e-65   Tarenaya hassleriana [spider flower]
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              220   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              220   1e-65   Brassica rapa
emb|CDY42294.1|  BnaC02g09000D                                          220   1e-65   Brassica napus [oilseed rape]
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   220   1e-65   Brassica rapa
emb|CDX88875.1|  BnaA03g07740D                                          220   1e-65   
ref|NP_197478.1|  tubulin alpha-3                                       220   1e-65   Arabidopsis thaliana [mouse-ear cress]
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     220   1e-65   Eucalyptus grandis [rose gum]
ref|XP_010414865.1|  PREDICTED: tubulin alpha-1 chain                   220   1e-65   Camelina sativa [gold-of-pleasure]
gb|EPY40479.1|  tubulin alpha                                           214   1e-65   Angomonas deanei
ref|XP_002772835.1|  alpha-tubulin, putative                            211   1e-65   Perkinsus marinus ATCC 50983
gb|ABR26150.1|  tubulin alpha-3 chain                                   212   1e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_002959708.1|  alpha tubulin                                      214   1e-65   Volvox carteri f. nagariensis
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       219   1e-65   Cucumis sativus [cucumbers]
gb|ABL61086.1|  alpha-tubulin                                           216   1e-65   Oxymonadida environmental sample
gb|KJB58756.1|  hypothetical protein B456_009G224800                    219   1e-65   Gossypium raimondii
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              220   2e-65   Sesamum indicum [beniseed]
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             220   2e-65   Capsella rubella
gb|ABO47738.1|  alpha-tubulin                                           220   2e-65   Gossypium hirsutum [American cotton]
gb|ABV55994.1|  alpha-tubulin 6                                         219   2e-65   Populus tremuloides
gb|EPY39349.1|  tubulin alpha                                           215   2e-65   Angomonas deanei
ref|XP_002319688.1|  Tubulin alpha-1 chain family protein               219   2e-65   Populus trichocarpa [western balsam poplar]
emb|CAD20819.1|  alpha tubulin                                          210   2e-65   Zea mays [maize]
gb|KHG26159.1|  Tubulin alpha-6 chain                                   219   2e-65   Gossypium arboreum [tree cotton]
gb|EPY33355.1|  tubulin alpha                                           216   2e-65   Strigomonas culicis
gb|ADJ00012.1|  tubulin alpha chain                                     213   2e-65   Chromera velia
gb|KJB44614.1|  hypothetical protein B456_007G261000                    219   2e-65   Gossypium raimondii
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   219   2e-65   Populus euphratica
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 219   2e-65   Populus trichocarpa [western balsam poplar]
gb|ABQ59633.1|  alpha-tubulin 3                                         219   2e-65   Populus tremuloides
gb|AGG37285.1|  alpha-tubulin 3                                         219   2e-65   Salix arbutifolia
emb|CAA52158.1|  alpha tubulin                                          214   2e-65   Zea mays [maize]
gb|ABK92520.1|  unknown                                                 219   2e-65   Populus trichocarpa [western balsam poplar]
gb|AAB36609.1|  alpha-tubulin                                           218   2e-65   Eucalyptus globulus subsp. bicostata
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              219   2e-65   Populus euphratica
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        219   2e-65   Prunus mume [ume]
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             219   2e-65   Prunus persica
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              219   2e-65   Cucumis sativus [cucumbers]
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              219   2e-65   Cicer arietinum [garbanzo]
ref|XP_003629736.1|  Alpha-tubulin                                      219   2e-65   Medicago truncatula
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         219   2e-65   Jatropha curcas
gb|ETM52928.1|  tubulin alpha chain                                     218   3e-65   Phytophthora parasitica
gb|ETI53409.1|  tubulin alpha chain                                     210   3e-65   Phytophthora parasitica P1569
gb|ABL61202.1|  alpha-tubulin                                           215   3e-65   Oxymonadida environmental sample
gb|AIX10773.1|  alpha tubulin                                           219   3e-65   Panax notoginseng [san-qi]
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        219   3e-65   Cucumis melo [Oriental melon]
gb|ABL61204.1|  alpha-tubulin                                           214   3e-65   Oxymonadida environmental sample
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   218   3e-65   Citrus sinensis [apfelsine]
gb|ABR25378.1|  tubulin alpha 3 chain                                   211   3e-65   Oryza sativa Indica Group [Indian rice]
gb|KJB34154.1|  hypothetical protein B456_006G050600                    212   3e-65   Gossypium raimondii
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                218   3e-65   Erythranthe guttata [common monkey flower]
gb|ABL61219.1|  alpha-tubulin                                           215   3e-65   Oxymonadida environmental sample
gb|AAO46128.1|  alpha-tubulin                                           213   4e-65   Streblomastix strix
ref|XP_011398411.1|  Tubulin alpha chain                                217   4e-65   Auxenochlorella protothecoides
gb|KJB58757.1|  hypothetical protein B456_009G224800                    218   4e-65   Gossypium raimondii
ref|XP_004170946.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    219   4e-65   
emb|CAD24766.1|  alpha-tubulin                                          219   4e-65   Miscanthus sinensis
gb|ABU93324.1|  tubulin alpha subunit                                   219   4e-65   Monocercomonoides sp. PA
emb|CAB76918.1|  alpha-tubulin 5                                        211   4e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP14299.1|  unnamed protein product                                219   4e-65   Coffea canephora [robusta coffee]
gb|ABL61213.1|  alpha-tubulin                                           214   4e-65   Oxymonadida environmental sample
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              219   4e-65   Cucumis melo [Oriental melon]
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             219   4e-65   Citrus clementina [clementine]
gb|AAW57305.1|  alpha-tubulin                                           214   4e-65   Ceratopteris richardii
gb|ABU93323.1|  tubulin alpha subunit                                   219   4e-65   Monocercomonoides sp. PA
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              218   5e-65   Cucumis sativus [cucumbers]
gb|AEQ75493.1|  alpha-tubulin                                           218   5e-65   Rosa multiflora [Japanese rose]
gb|ABL61217.1|  alpha-tubulin                                           214   5e-65   Oxymonadida environmental sample
gb|KJB80786.1|  hypothetical protein B456_013G115100                    218   5e-65   Gossypium raimondii
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             218   5e-65   Gossypium arboreum [tree cotton]
gb|ABU93321.1|  tubulin alpha subunit                                   218   5e-65   Monocercomonoides sp. PA
gb|AGV54500.1|  tubulin A                                               218   5e-65   Phaseolus vulgaris [French bean]
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    218   5e-65   Gossypium hirsutum [American cotton]
ref|XP_010093625.1|  Tubulin alpha chain                                218   5e-65   Morus notabilis
gb|KHN08201.1|  Tubulin alpha chain                                     219   5e-65   Glycine soja [wild soybean]
gb|ADW83724.1|  alpha-tubulin                                           218   5e-65   Musa acuminata AAA Group [Cavendish banana]
emb|CAN62392.1|  hypothetical protein VITISV_016172                     218   5e-65   Vitis vinifera
ref|XP_007515802.1|  alpha-tubulin                                      217   5e-65   Bathycoccus prasinos
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             218   6e-65   Citrus clementina [clementine]
gb|ABE01246.1|  alpha tubulin                                           218   6e-65   Camellia sinensis [black tea]
ref|XP_007032501.1|  Tubulin alpha-2 chain                              218   6e-65   
emb|CAM58978.1|  alpha tubulin 5                                        212   6e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABL61226.1|  alpha-tubulin                                           214   6e-65   Oxymonadida environmental sample
gb|KHG20487.1|  Tubulin alpha chain                                     218   6e-65   Gossypium arboreum [tree cotton]
ref|XP_002522104.1|  tubulin alpha chain, putative                      218   6e-65   Ricinus communis
gb|AAO23139.1|  alpha tubulin                                           218   6e-65   Populus tremuloides
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   218   6e-65   Citrus sinensis [apfelsine]
gb|ACN40181.1|  unknown                                                 218   6e-65   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     218   6e-65   Vitis vinifera
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        218   6e-65   Cucumis melo [Oriental melon]
ref|XP_002510010.1|  tubulin alpha chain, putative                      218   6e-65   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                           218   6e-65   Picea wilsonii
gb|ABV55999.1|  alpha-tubulin 7                                         218   6e-65   Populus tremuloides
gb|AAV92352.1|  alpha tubulin 1                                         218   6e-65   Pseudotsuga menziesii var. menziesii
gb|ABO47739.1|  alpha-tubulin                                           218   6e-65   Gossypium hirsutum [American cotton]
gb|AIX10966.1|  tubulin                                                 218   6e-65   Ornithogalum longebracteatum [sea-onion]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    218   6e-65   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             218   6e-65   Citrus clementina [clementine]
ref|XP_007018369.1|  Tubulin alpha-2 chain                              218   6e-65   Theobroma cacao [chocolate]
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                218   6e-65   Fragaria vesca subsp. vesca
ref|XP_001427643.1|  hypothetical protein                               212   6e-65   Paramecium tetraurelia strain d4-2
gb|ABL61227.1|  alpha-tubulin                                           214   6e-65   Oxymonadida environmental sample
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         218   6e-65   
gb|ABO47740.1|  alpha-tubulin                                           218   6e-65   
ref|NP_001289660.1|  tubulin alpha chain-like                           218   6e-65   
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                218   6e-65   
ref|XP_010104543.1|  Tubulin alpha chain                                218   6e-65   
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                218   6e-65   
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        218   6e-65   
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                218   6e-65   
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                218   6e-65   
gb|AID52921.1|  tubulin alpha chain                                     218   6e-65   
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                218   6e-65   
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   218   6e-65   
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             218   6e-65   
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             218   6e-65   
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             218   6e-65   
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              218   6e-65   
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             218   6e-65   
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                218   6e-65   
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     218   6e-65   
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   218   6e-65   
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          218   6e-65   
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                218   6e-65   
ref|XP_003603670.1|  Tubulin alpha-7 chain                              218   6e-65   
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             218   7e-65   
gb|ABO47736.1|  alpha-tubulin                                           218   7e-65   
ref|XP_001764722.1|  predicted protein                                  218   7e-65   
gb|ABO47742.1|  alpha-tubulin                                           218   7e-65   
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   218   7e-65   
ref|XP_003608582.1|  Tubulin alpha-5 chain                              218   7e-65   
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                218   7e-65   
ref|WP_039310890.1|  hypothetical protein                               218   7e-65   
gb|KHG18997.1|  Tubulin alpha chain                                     218   7e-65   
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         218   7e-65   
gb|ACJ60905.1|  alpha tubulin                                           218   7e-65   
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                218   7e-65   
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     218   7e-65   
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                218   7e-65   
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             218   7e-65   
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             218   7e-65   
gb|AGG37283.1|  alpha-tubulin 1                                         218   7e-65   
ref|XP_006301274.1|  hypothetical protein CARUB_v10021674mg             218   7e-65   
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         218   7e-65   
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             218   7e-65   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                218   7e-65   
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             218   7e-65   
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             218   7e-65   
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          218   7e-65   
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                218   7e-65   
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             218   7e-65   
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            215   7e-65   
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             218   7e-65   
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     218   7e-65   
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     218   7e-65   
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              218   7e-65   
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              218   7e-65   
gb|AEW46684.1|  beta-tubulin                                            218   7e-65   
ref|XP_010099392.1|  Tubulin alpha chain                                218   7e-65   
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     218   7e-65   
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              218   7e-65   
ref|XP_002886753.1|  alpha-1 tubulin                                    218   7e-65   
gb|AGG37289.1|  alpha-tubulin 7                                         218   8e-65   
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     218   8e-65   
gb|ABL61203.1|  alpha-tubulin                                           214   8e-65   
gb|AIC33057.1|  tubulin alpha-1 chain                                   218   8e-65   
ref|XP_002517492.1|  tubulin alpha chain, putative                      218   8e-65   
ref|XP_002508010.1|  alpha tubulin 2                                    218   8e-65   
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     218   8e-65   
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                218   8e-65   
emb|CDP02221.1|  unnamed protein product                                218   8e-65   
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                218   8e-65   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              218   8e-65   
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               218   8e-65   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 218   8e-65   
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              218   8e-65   
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     218   8e-65   
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                218   8e-65   
ref|XP_005643073.1|  tubulin alpha chain                                218   8e-65   
ref|NP_001275271.1|  alpha-tubulin-like protein                         218   8e-65   
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   218   8e-65   
gb|ACJ04933.1|  alpha tubulin                                           211   8e-65   
gb|ETM53002.1|  tubulin alpha chain                                     210   8e-65   
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                218   8e-65   
emb|CAD13176.1|  alpha-tubulin                                          218   8e-65   
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   218   8e-65   
gb|ACH68563.1|  alpha-tubulin                                           218   8e-65   
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     218   8e-65   
gb|ABB02631.1|  unknown                                                 218   9e-65   
ref|XP_007042689.1|  Tubulin alpha-2 chain                              218   9e-65   
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          218   9e-65   
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     218   9e-65   
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     218   9e-65   
gb|ABP65320.1|  alpha tubulin                                           218   9e-65   
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     218   9e-65   
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                218   9e-65   
ref|XP_005651460.1|  tubulin alpha chain                                218   9e-65   
gb|ACK76232.1|  alpha-tubulin                                           218   9e-65   
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                218   9e-65   
gb|ABC59068.2|  alpha tubulin 1                                         218   9e-65   
gb|AFW67749.1|  alpha tubulin4                                          214   9e-65   
ref|NP_001291325.1|  tubulin alpha chain-like                           218   9e-65   
ref|XP_003058621.1|  alpha tubulin                                      218   9e-65   
gb|ABL61214.1|  alpha-tubulin                                           214   1e-64   
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                218   1e-64   
emb|CAD26893.1|  alpha-tubulin                                          218   1e-64   
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                218   1e-64   
gb|AEE98361.1|  alpha-tubulin                                           212   1e-64   
emb|CCI45804.1|  unnamed protein product                                218   1e-64   
gb|ABL61228.1|  alpha-tubulin                                           213   1e-64   
gb|KIZ03400.1|  Tubulin alpha chain                                     218   1e-64   
emb|CCA20146.1|  alpha tubulin 1 putative                               217   1e-64   
gb|AAZ23863.1|  alpha-tubulin                                           217   1e-64   
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    217   1e-64   
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     217   1e-64   
gb|ETM30643.1|  tubulin alpha chain                                     217   1e-64   
ref|NP_001275086.1|  uncharacterized LOC102577521                       217   1e-64   
ref|XP_007512064.1|  alpha-tubulin                                      217   2e-64   
gb|ABP65323.1|  alpha tubulin                                           217   2e-64   
ref|XP_007015700.1|  Tubulin alpha-5, putative                          220   2e-64   
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     217   2e-64   
gb|AGI78243.1|  alpha tubulin 5                                         211   2e-64   
ref|XP_010054663.1|  PREDICTED: tubulin alpha-3 chain-like              217   2e-64   
gb|AAO46126.1|  alpha-tubulin                                           211   2e-64   
emb|CDY66630.1|  BnaCnng51680D                                          217   2e-64   
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   217   2e-64   
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   217   2e-64   
ref|XP_005839726.1|  hypothetical protein GUITHDRAFT_150645             217   2e-64   
gb|EWC76931.1|  tubulin alpha chain                                     213   2e-64   
ref|XP_007047652.1|  Tubulin alpha-2 chain                              218   2e-64   
ref|XP_008877307.1|  tubulin alpha chain                                214   2e-64   
ref|XP_005851144.1|  alpha-tubulin                                      217   2e-64   
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     217   2e-64   
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                217   2e-64   
gb|ETO82054.1|  tubulin alpha chain                                     217   2e-64   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        217   2e-64   
ref|XP_001563163.2|  alpha tubulin                                      217   2e-64   
ref|XP_008872990.1|  tubulin alpha chain                                217   2e-64   
emb|CDY29334.1|  BnaA05g16010D                                          216   2e-64   
gb|AEW44192.1|  alpha-tubulin                                           206   2e-64   
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          217   2e-64   
emb|CCI41153.1|  unnamed protein product                                217   2e-64   
ref|XP_008900864.1|  tubulin alpha chain                                217   2e-64   
ref|NP_171974.1|  tubulin alpha-4 chain                                 217   2e-64   
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                217   2e-64   
emb|CCW60849.1|  unnamed protein product                                215   2e-64   
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             217   2e-64   
ref|XP_002904195.1|  alpha-tubulin, putative                            217   2e-64   
ref|XP_002904194.1|  alpha-tubulin                                      217   2e-64   
gb|ETM52951.1|  tubulin alpha chain                                     217   2e-64   
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        217   2e-64   
ref|NP_193232.1|  tubulin alpha-6 chain                                 217   2e-64   
dbj|BAJ06364.1|  alpha-tubulin                                          217   2e-64   
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              217   2e-64   
ref|XP_002782100.1|  Tubulin alpha chain, putative                      213   2e-64   
gb|ABL61218.1|  alpha-tubulin                                           213   2e-64   
gb|KJB29387.1|  hypothetical protein B456_005G097800                    217   2e-64   
gb|ABC40566.1|  alpha-tubulin                                           217   2e-64   
gb|ABD92937.1|  alpha tubulin-4A                                        217   3e-64   
gb|ABD92936.1|  alpha tubulin-4D                                        217   3e-64   
gb|AFK92919.1|  alpha-tubulin                                           217   3e-64   
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   216   3e-64   
gb|AAM69359.1|U65380_1  alpha tubulin                                   213   3e-64   
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   216   3e-64   
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    216   3e-64   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           216   3e-64   
ref|XP_001681772.1|  alpha tubulin                                      216   3e-64   
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              216   3e-64   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           216   3e-64   
gb|AFW67748.1|  alpha tubulin4                                          214   3e-64   
gb|AAZ42551.1|  alpha-tubulin                                           216   3e-64   
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             216   3e-64   
ref|XP_010096739.1|  Tubulin alpha chain                                216   3e-64   
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             216   3e-64   
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    216   3e-64   
ref|XP_003392359.1|  alpha tubulin                                      218   3e-64   
ref|XP_003624633.1|  Alpha-tubulin                                      216   3e-64   
emb|CDW82295.1|  alpha tubulin                                          216   3e-64   
ref|XP_009842456.1|  tubulin alpha chain                                216   3e-64   
gb|ETM53018.1|  tubulin alpha chain                                     210   3e-64   
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    216   3e-64   
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    216   3e-64   
gb|EJY81124.1|  Alpha tubulin,putative                                  216   3e-64   
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                216   3e-64   
gb|ABL61209.1|  alpha-tubulin                                           216   3e-64   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  216   3e-64   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             216   3e-64   
gb|KHN42598.1|  Tubulin alpha-2 chain                                   216   3e-64   
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              216   3e-64   
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    216   3e-64   
gb|KHG14074.1|  Tubulin alpha-2 chain                                   215   3e-64   
gb|ABL61205.1|  alpha-tubulin                                           216   3e-64   
gb|ABL61208.1|  alpha-tubulin                                           216   3e-64   
gb|ABL61230.1|  alpha-tubulin                                           216   4e-64   
ref|XP_004493170.1|  PREDICTED: tubulin alpha-3 chain-like              216   4e-64   
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             213   4e-64   
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     216   4e-64   
gb|ABL61206.1|  alpha-tubulin                                           216   4e-64   
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             216   4e-64   
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    216   4e-64   
gb|ABL61210.1|  alpha-tubulin                                           216   4e-64   
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                217   4e-64   
ref|NP_176654.1|  tubulin alpha-1 chain                                 216   4e-64   
gb|KEH43997.1|  tubulin beta-1 chain                                    216   4e-64   
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                216   4e-64   
dbj|BAB19779.1|  alpha tubulin                                          216   5e-64   
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              215   5e-64   
ref|XP_001419217.1|  predicted protein                                  216   5e-64   
ref|XP_001770881.1|  predicted protein                                  216   5e-64   
emb|CAD26888.1|  alpha-tubulin                                          216   5e-64   
dbj|BAG99724.1|  unnamed protein product                                215   5e-64   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             216   5e-64   
gb|EPR58771.1|  alpha tubulin TUBA1                                     215   5e-64   
emb|CDJ60085.1|  tubulin alpha chain, putative                          215   6e-64   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             216   6e-64   
gb|ETW27380.1|  tubulin alpha chain                                     212   6e-64   
gb|ABD92943.1|  alpha tubulin-1B                                        216   6e-64   
ref|XP_002904167.1|  cleavage induced tubulin alpha chain               212   6e-64   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           216   7e-64   
ref|XP_002675196.1|  alpha-tubulin                                      216   7e-64   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             215   7e-64   
gb|AAX63396.1|  alpha-tubulin                                           215   7e-64   
gb|ACU20294.1|  unknown                                                 212   7e-64   



>ref|XP_008384431.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=282

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  162  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  221

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  222  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  265



>gb|AHZ58481.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=200

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  80   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  139

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  140  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  183



>gb|AAD50629.1|AF106571_1 alpha-tubulin [Gossypium hirsutum]
Length=126

 Score =   218 bits (554),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  6    NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPAVVPGGDLAKVQRAVCMISNNTAVAEVF  65

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  66   ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  109



>dbj|BAD94893.1| tubulin alpha-5 chain-like protein [Arabidopsis thaliana]
Length=183

 Score =   219 bits (557),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  62   NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  121

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  122  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_010420792.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=183

 Score =   218 bits (556),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  62   NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  121

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  122  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>gb|AAD50627.1|AF106569_1 alpha-tubulin [Gossypium hirsutum]
Length=132

 Score =   216 bits (551),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  11   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  70

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  71   SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|AAD50628.1|AF106570_1 alpha-tubulin [Gossypium hirsutum]
Length=127

 Score =   216 bits (550),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  6    NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  65

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  66   SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  109



>emb|CAD20820.1| alpha tubulin [Zea mays]
Length=200

 Score =   219 bits (557),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  79   NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  138

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  139  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  182



>emb|CDY35856.1| BnaC09g37880D [Brassica napus]
Length=149

 Score =   217 bits (552),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  28   NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  87

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  88   SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  131



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   221 bits (563),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  153  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  212

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  213  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  256



>gb|AAD50625.1|AF106567_1 alpha-tubulin [Gossypium hirsutum]
Length=132

 Score =   216 bits (550),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  11   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  70

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  71   SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   220 bits (561),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  134  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  193

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  194  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  237



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   220 bits (560),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  128  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  187

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  188  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   218 bits (556),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  96   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  155

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  156  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   218 bits (554),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  90   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  149

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  150  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  224  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  283

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  284  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  327



>gb|AFR42049.1| alpha-tubulin, partial [Populus fremontii]
Length=197

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  90   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  149

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  150  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>gb|AFR42054.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  89   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  148

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  149  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>gb|AFR42035.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42040.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42044.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42052.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  89   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  148

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  149  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  90   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  149

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  150  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  96   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  155

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  156  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>dbj|BAH20267.1| AT5G19780 [Arabidopsis thaliana]
Length=284

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  163  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  222

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  223  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  266



>gb|AFR42036.1| alpha-tubulin, partial [Populus alba]
Length=195

 Score =   217 bits (553),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  88   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  147

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  148  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  191



>gb|AFR42042.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42043.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42050.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42051.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42053.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42055.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   217 bits (553),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  87   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  146

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  147  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>gb|AAD50626.1|AF106568_1 alpha-tubulin [Gossypium hirsutum]
Length=132

 Score =   215 bits (547),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVA+IKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  11   NAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  70

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAF+HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  71   SRIDHKFDLMYAKRAFIHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|AAN32997.1| alpha-tubulin 1, partial [Gossypium hirsutum]
Length=132

 Score =   215 bits (547),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVF
Sbjct  10   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNSTSVAEVF  69

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  70   SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  113



>gb|AFR42047.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  87   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  146

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  147  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>dbj|BAA99561.1| alpha-tubulin [Chlorella vulgaris]
Length=149

 Score =   215 bits (548),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  27   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  86

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  87   SRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  130



>gb|ACN40714.1| unknown [Picea sitchensis]
Length=139

 Score =   214 bits (546),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN T+VAEVF
Sbjct  17   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNLTSVAEVF  76

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  77   SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  120



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  149  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  208

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  209  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  252



>ref|XP_003886491.1| unnamed protein product [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ41034.1| unnamed protein product [Leishmania mexicana MHOM/GT/2001/U1103]
Length=151

 Score =   215 bits (547),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAA+ATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  29   NAAIATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  88

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  89   ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>gb|KJB33191.1| hypothetical protein B456_006G002500 [Gossypium raimondii]
Length=183

 Score =   216 bits (550),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  62   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  121

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYV EGMEEGEFSEAREDLAALEKDY
Sbjct  122  SRIDHKFDLMYAKRAFVHWYVSEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   217 bits (553),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQ+AVCMISN+T+VAEVF
Sbjct  105  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQKAVCMISNSTSVAEVF  164

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  165  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  208



>gb|AFR42125.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42126.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42127.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42128.1| alpha-tubulin, partial [Populus fremontii]
Length=131

 Score =   214 bits (545),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  9    NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  68

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  69   SRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  112



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  219  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  278

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  279  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  322



>gb|KJB83378.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=404

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  284  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  343

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  344  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  387



>gb|AFR42118.1| alpha-tubulin, partial [Populus trichocarpa]
Length=133

 Score =   214 bits (544),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  11   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  70

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  71   SRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   218 bits (555),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NA+VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TAVAEVF
Sbjct  127  NASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAVAEVF  186

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  187  SRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>gb|AFR42117.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42119.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42120.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42121.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42122.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42129.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42130.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42131.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42132.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42133.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42134.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42135.1| alpha-tubulin, partial [Populus nigra]
Length=133

 Score =   214 bits (544),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  11   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  70

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  71   SRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|AAG28536.1|AF199019_1 alpha tubulin [Leishmania major]
Length=200

 Score =   216 bits (550),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAA+ATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  78   NAAIATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  137

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  138  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  181



>gb|AFR42124.1| alpha-tubulin, partial [Populus alba]
Length=133

 Score =   213 bits (543),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  11   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  70

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  71   SRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|KDO25258.1| hypothetical protein SPRG_09506 [Saprolegnia parasitica CBS 223.65]
Length=186

 Score =   215 bits (548),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN +A+AEVF
Sbjct  62   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVF  121

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAF HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  122  SRIDHKFDLMYAKRAFAHWYVGEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   218 bits (555),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN +A+AEVF
Sbjct  149  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVF  208

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  209  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  252



>dbj|BAF01952.1| putative tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=202

 Score =   216 bits (549),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  81   NAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  140

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  141  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  184



>ref|XP_009353129.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   223 bits (569),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009375870.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   223 bits (569),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>tpg|DAA41189.1| TPA: alpha tubulin5 [Zea mays]
Length=320

 Score =   219 bits (559),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  199  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  258

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  259  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>ref|XP_008386829.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=449

 Score =   223 bits (569),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   217 bits (553),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  127  NAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  186

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  187  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>gb|AGG37284.1| alpha-tubulin 2 [Salix arbutifolia]
Length=450

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   218 bits (556),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V EVF
Sbjct  167  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVF  226

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  227  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270



>ref|XP_008349406.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_008366135.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_009339175.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008351479.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
Length=449

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDP17586.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ADD84794.1| tubulin-like protein [Cenchrus ciliaris]
Length=184

 Score =   215 bits (547),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V EVF
Sbjct  62   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVF  121

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  122  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_004295008.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAO63773.2| alpha-tubulin 2 [Populus tremuloides]
Length=450

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011025144.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=450

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  206  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  265

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  266  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  309



>ref|XP_002303998.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|EEE78977.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   223 bits (568),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABR26014.1| tubulin alpha-3 chain [Oryza sativa Indica Group]
Length=133

 Score =   213 bits (542),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVP GDLAKVQRAVCMISN+T+V EVF
Sbjct  11   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPSGDLAKVQRAVCMISNSTSVVEVF  70

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  71   SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>ref|XP_007205189.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
 gb|EMJ06388.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
Length=450

 Score =   223 bits (568),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU23006.1| hypothetical protein MIMGU_mgv1a006283mg [Erythranthe guttata]
Length=449

 Score =   223 bits (568),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006858944.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
 gb|ERN20411.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
Length=449

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>tpg|DAA63280.1| TPA: alpha tubulin6 [Zea mays]
Length=320

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  199  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  258

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  259  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>ref|XP_008223650.1| PREDICTED: tubulin alpha-3 chain-like [Prunus mume]
Length=450

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  144  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  203

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  204  SRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  247



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  240  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  299

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  300  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  343



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  145  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  204

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  205  SRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  248



>ref|XP_002677064.1| alpha-tubulin [Naegleria gruberi]
 gb|EFC44320.1| alpha-tubulin [Naegleria gruberi]
Length=195

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  71   NAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  130

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  131  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  174



>gb|KCW87067.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=381

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINY+PPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  261  NAAVATIKTKRTVQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  320

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  321  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  364



>gb|AHJ80820.1| Tua3, partial [Eragrostis tef]
Length=400

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  279  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  338

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  339  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  382



>ref|XP_009366459.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKT+RTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTRRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80821.1| Tua3, partial [Eragrostis tef]
Length=401

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  280  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  339

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  340  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  383



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  233  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  292

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  293  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  336



>emb|CDY46272.1| BnaC05g50610D [Brassica napus]
Length=289

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  168  NAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  227

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAF HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  228  SRIDHKFDLMYAKRAFFHWYVGEGMEEGEFSEAREDLAALEKDY  271



>ref|XP_002525416.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF36906.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007030078.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY10580.1| Tubulin alpha-5 [Theobroma cacao]
Length=482

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  362  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  421

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  422  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  465



>gb|AEG74028.1| alpha-tubulin [Pellia endiviifolia (species B)]
 gb|AEG74032.1| alpha-tubulin [Pellia endiviifolia (species B)]
Length=448

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011048194.1| PREDICTED: tubulin alpha-6 chain-like [Populus euphratica]
Length=450

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009413318.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37286.1| alpha-tubulin 4 [Salix arbutifolia]
Length=450

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB83375.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=449

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG06160.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002297631.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|ABK92439.1| unknown [Populus trichocarpa]
 gb|EEE82436.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAU10519.1| alpha tubulin, partial [Leishmania donovani]
Length=249

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAA+ATI+TKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  127  NAAIATIETKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  186

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  187  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>gb|ABR67425.1| alpha-tubulin 4 [Populus tremuloides]
Length=450

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47741.1| alpha-tubulin [Gossypium hirsutum]
Length=449

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009406530.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACN40824.1| unknown [Picea sitchensis]
Length=449

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47735.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG06862.1| Tubulin alpha-6 chain [Gossypium arboreum]
 gb|KJB66054.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
 gb|KJB66055.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
Length=449

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFR42123.1| alpha-tubulin, partial [Populus trichocarpa]
Length=133

 Score =   212 bits (539),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAA ATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  11   NAAXATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  70

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  71   SRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  114



>gb|KDP39691.1| hypothetical protein JCGZ_02711 [Jatropha curcas]
Length=449

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006445597.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 ref|XP_006488930.1| PREDICTED: tubulin alpha-1 chain-like isoform X1 [Citrus sinensis]
 gb|ESR58837.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 gb|KDO54446.1| hypothetical protein CISIN_1g013113mg [Citrus sinensis]
Length=449

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009400845.1| PREDICTED: tubulin alpha-3 chain [Musa acuminata subsp. malaccensis]
Length=450

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011089722.1| PREDICTED: tubulin alpha-3 chain [Sesamum indicum]
Length=449

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002285721.1| PREDICTED: tubulin alpha-3 chain [Vitis vinifera]
Length=449

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009408459.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010673470.1| PREDICTED: tubulin alpha-3 chain [Beta vulgaris subsp. vulgaris]
Length=449

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  128  NAAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  187

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  188  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>ref|XP_001777081.1| predicted protein [Physcomitrella patens]
 gb|EDQ58074.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010112637.1| Tubulin alpha-3 chain [Morus notabilis]
 gb|EXC34492.1| Tubulin alpha-3 chain [Morus notabilis]
Length=449

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY44941.1| BnaA02g04460D [Brassica napus]
 emb|CDY44942.1| BnaA02g04470D [Brassica napus]
Length=450

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001782790.1| predicted protein [Physcomitrella patens]
 ref|XP_001782813.1| predicted protein [Physcomitrella patens]
 dbj|BAC24799.1| alpha tubulin [Physcomitrella patens]
 gb|EDQ52367.1| predicted protein [Physcomitrella patens]
 gb|EDQ52390.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN06388.1| Tubulin alpha-3 chain [Glycine soja]
Length=421

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  301  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  360

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  361  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  404



>ref|XP_009622332.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009766182.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
Length=449

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CBH08953.1| alpha tubulin, (fragment), partial [Trypanosoma brucei gambiense 
DAL972]
Length=190

 Score =   213 bits (543),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  68   NAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  127

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  128  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  171



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V EVF
Sbjct  121  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVF  180

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  181  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  224



>gb|EKG00833.1| epsilon tubulin, putative [Trypanosoma cruzi]
 gb|ESL09113.1| hypothetical protein TRSC58_03174 [Trypanosoma rangeli SC58]
 gb|ESL09781.1| hypothetical protein TRSC58_02494 [Trypanosoma rangeli SC58]
Length=151

 Score =   212 bits (539),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  29   NAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  88

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  89   ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>ref|XP_008804327.1| PREDICTED: tubulin alpha-1 chain-like [Phoenix dactylifera]
Length=450

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ETL99841.1| tubulin alpha-2 chain, partial [Phytophthora parasitica]
Length=127

 Score =   211 bits (537),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAV MISN +A+AEVF
Sbjct  3    NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVAMISNTSAIAEVF  62

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHW+VGEGMEEGEFSEAREDLAALEKDY
Sbjct  63   SRIDHKFDLMYAKRAFVHWFVGEGMEEGEFSEAREDLAALEKDY  106



>gb|AAO46130.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  128  NAAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  187

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  188  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   217 bits (552),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  177  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  236

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  237  SRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  280



>ref|XP_011034391.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=449

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            N+AV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NSAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37288.1| alpha-tubulin 6 [Salix arbutifolia]
Length=449

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            N++VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NSSVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG06861.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=460

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  340  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  399

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  400  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  443



>ref|XP_002325422.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE99803.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            N+AV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NSAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002779346.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
 gb|EER11141.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
Length=186

 Score =   213 bits (542),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKV RAVCMISN+TAVAEVF
Sbjct  62   NAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTAVAEVF  121

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  122  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>gb|ABB16994.1| unknown [Solanum tuberosum]
Length=467

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/104 (99%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  347  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  406

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  407  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  450



>ref|XP_011021469.1| PREDICTED: tubulin alpha-3 chain-like [Populus euphratica]
Length=449

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            N+AV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NSAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37290.1| alpha-tubulin 8 [Salix arbutifolia]
Length=449

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            N+AV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NSAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAC84108.1| alpha-tubulin, partial [Gossypium hirsutum]
Length=132

 Score =   211 bits (537),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 102/102 (100%), Gaps = 0/102 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  29   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  88

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  304
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  89   SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  130



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   215 bits (548),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NA+VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T++AEVF
Sbjct  135  NASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSIAEVF  194

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKD+
Sbjct  195  SRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDF  238



>gb|EPY32266.1| alpha tubulin [Strigomonas culicis]
 gb|EPY32660.1| alpha tubulin [Strigomonas culicis]
Length=150

 Score =   211 bits (538),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAA+ATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  29   NAAIATIKTKRTIQFVDWAPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  88

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  89   ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>ref|XP_006482574.1| PREDICTED: tubulin alpha chain-like [Citrus sinensis]
Length=150

 Score =   211 bits (538),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVA IKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  29   NAAVAAIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVF  88

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  89   SRIDQKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>gb|ABL61216.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   217 bits (553),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  192  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  251

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  252  SRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>gb|EKF29047.1| epsilon tubulin, putative, partial [Trypanosoma cruzi marinkellei]
Length=240

 Score =   214 bits (546),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  118  NAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  177

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  178  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  221



>gb|EKF28172.1| epsilon tubulin, putative [Trypanosoma cruzi marinkellei]
Length=249

 Score =   215 bits (547),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  127  NAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  186

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  187  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>ref|XP_001566612.1| alpha tubulin [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM40126.1| alpha tubulin [Leishmania braziliensis MHOM/BR/75/M2904]
Length=259

 Score =   215 bits (548),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAA+ATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  137  NAAIATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  196

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  197  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  240



>ref|XP_010276368.1| PREDICTED: tubulin alpha-3 chain-like [Nelumbo nucifera]
Length=450

 Score =   221 bits (562),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008813089.1| PREDICTED: tubulin alpha-3 chain [Phoenix dactylifera]
Length=450

 Score =   221 bits (562),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010257632.1| PREDICTED: tubulin alpha-3 chain [Nelumbo nucifera]
Length=449

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAJ06363.1| alpha-tubulin [Alopecurus aequalis]
Length=450

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|P33624.1|TBA2_ANEPH RecName: Full=Tubulin alpha-2 chain, partial [Anemia phyllitidis]
 emb|CAA48928.1| alpha tubulin 2, partial [Anemia phyllitidis]
Length=364

 Score =   218 bits (556),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  245  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  304

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+K AFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  305  SRIDHKFDLMYAKLAFVHWYVGEGMEEGEFSEAREDLAALEKDY  348



>gb|AGD80034.1| alpha-tubulin 1 [Hevea brasiliensis]
Length=449

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010923361.1| PREDICTED: tubulin alpha-3 chain [Elaeis guineensis]
Length=450

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q43473.1|TBA1_HORVU RecName: Full=Tubulin alpha-1 chain [Hordeum vulgare]
 emb|CAA67942.1| alpha-tubulin 1 [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26887.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007014666.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY32285.1| Tubulin alpha-5 [Theobroma cacao]
Length=449

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006657877.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=450

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26891.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CCD11782.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=257

 Score =   215 bits (547),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  135  NAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  194

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  195  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  238



>ref|XP_004958110.1| PREDICTED: tubulin alpha-3 chain-like [Setaria italica]
Length=450

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010528739.1| PREDICTED: tubulin alpha-6 chain-like [Tarenaya hassleriana]
Length=450

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVA+IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVASIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD24765.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003562846.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=450

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001060075.1| Os07g0574800 [Oryza sativa Japonica Group]
 sp|P28752.1|TBA1_ORYSJ RecName: Full=Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 emb|CAA77988.1| alpha 1 tubulin [Oryza sativa Japonica Group]
 emb|CAA62918.1| alfa-tubulin [Oryza sativa Japonica Group]
 dbj|BAC83168.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 dbj|BAD30236.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 gb|ABG78594.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF21989.1| Os07g0574800 [Oryza sativa Japonica Group]
 gb|EAZ04436.1| hypothetical protein OsI_26583 [Oryza sativa Indica Group]
 gb|EAZ40391.1| hypothetical protein OsJ_24840 [Oryza sativa Japonica Group]
 dbj|BAG90561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91280.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97017.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGH17548.1| alpha tubulin [Oryza sativa]
Length=450

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92942.1| alpha tubulin-1D [Triticum aestivum]
 gb|ABD92944.1| alpha tubulin-1A [Triticum aestivum]
 gb|EMS54563.1| Tubulin alpha-1 chain [Triticum urartu]
 gb|EMT26472.1| Tubulin alpha-1 chain [Aegilops tauschii]
Length=450

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26886.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001105324.1| tubulin alpha-5 chain [Zea mays]
 sp|Q02245.1|TBA5_MAIZE RecName: Full=Tubulin alpha-5 chain; AltName: Full=Alpha-5-tubulin 
[Zea mays]
 emb|CAA44862.1| alpha-tubulin #5 [Zea mays]
 gb|AAA33437.1| alpha-tubulin [Zea mays]
 gb|AAA16225.1| alpha-tubulin [Zea mays]
 emb|CAD20822.1| alpha tubulin [Zea mays]
 tpg|DAA41190.1| TPA: alpha tubulin5 [Zea mays]
Length=450

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002532068.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF30323.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010934670.1| PREDICTED: tubulin alpha-3 chain-like [Elaeis guineensis]
Length=450

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001242878.1| uncharacterized protein LOC100806907 [Glycine max]
 gb|ACU18050.1| unknown [Glycine max]
Length=450

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAD11425.1| alpha tubulin [Mesembryanthemum crystallinum]
Length=366

 Score =   218 bits (555),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  244  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVF  303

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  304  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  347



>ref|NP_001105588.1| tubulin alpha-6 chain [Zea mays]
 sp|P33627.1|TBA6_MAIZE RecName: Full=Tubulin alpha-6 chain; AltName: Full=Alpha-6-tubulin 
[Zea mays]
 emb|CAA44863.1| alpha-tubulin #6 [Zea mays]
 gb|ACN35801.1| unknown [Zea mays]
 gb|AFE82989.1| tubulin alpha-5 [Saccharum hybrid cultivar]
 tpg|DAA63282.1| TPA: alpha tubulin6 [Zea mays]
Length=450

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD24767.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61224.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   216 bits (551),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  192  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  251

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  252  SRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_009389058.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGY80453.1| tubulin [Dendrocalamus latiflorus]
Length=450

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|O22349.1|TBA3_ELEIN RecName: Full=Tubulin alpha-3 chain; AltName: Full=Alpha-3-tubulin 
[Eleusine indica]
 gb|AAC05719.1| alpha-tubulin 3 [Eleusine indica]
Length=450

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010693818.1| PREDICTED: tubulin alpha-3 chain-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001237301.1| tubulin A [Glycine max]
 gb|AAX86047.1| tubulin A [Glycine max]
Length=450

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD26890.1| alpha-tubulin [Miscanthus sinensis subsp. condensatus]
Length=450

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD24768.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   220 bits (561),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006579487.1| PREDICTED: tubulin A isoform X1 [Glycine max]
Length=449

 Score =   220 bits (561),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU31677.1| hypothetical protein MIMGU_mgv1a006281mg [Erythranthe guttata]
Length=449

 Score =   220 bits (561),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61215.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   216 bits (551),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  192  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  251

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  252  SRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>gb|KHN47983.1| Tubulin alpha-3 chain [Glycine soja]
Length=423

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  302  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  361

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  362  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  405



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  283  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  342

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  343  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  386



>ref|XP_010044940.1| PREDICTED: tubulin alpha-3 chain [Eucalyptus grandis]
 gb|KCW87066.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=449

 Score =   220 bits (561),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINY+PPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61212.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61220.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61221.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61222.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61223.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61225.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61229.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   216 bits (551),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  192  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  251

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  252  SRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>emb|CAD26892.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CBH08958.1| alpha tubulin, (fragment) [Trypanosoma brucei gambiense DAL972]
Length=303

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  181  NAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  240

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  241  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  284



>ref|XP_010535933.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Tarenaya hassleriana]
Length=449

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007159433.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
 gb|ESW31427.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
Length=449

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006286664.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
 ref|XP_010493056.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010493058.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 gb|EOA19562.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
Length=450

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009126389.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010531152.1| PREDICTED: tubulin alpha-3 chain [Tarenaya hassleriana]
Length=449

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010454260.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010454262.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=450

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009126391.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY42294.1| BnaC02g09000D [Brassica napus]
 emb|CDY42295.1| BnaC02g09010D [Brassica napus]
Length=450

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009120857.1| PREDICTED: tubulin alpha-3 chain [Brassica rapa]
 emb|CDX92501.1| BnaA10g15400D [Brassica napus]
 emb|CDX92502.1| BnaA10g15410D [Brassica napus]
Length=450

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDX88875.1| BnaA03g07740D [Brassica napus]
 emb|CDX70890.1| BnaC03g09740D [Brassica napus]
Length=450

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_197478.1| tubulin alpha-3 [Arabidopsis thaliana]
 ref|NP_197479.1| tubulin alpha-5 [Arabidopsis thaliana]
 ref|XP_002871906.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002873963.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006400538.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 ref|XP_006400540.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 ref|XP_010420793.1| PREDICTED: tubulin alpha-3 chain [Camelina sativa]
 sp|Q56WH1.2|TBA3_ARATH RecName: Full=Tubulin alpha-3 chain [Arabidopsis thaliana]
 sp|B9DHQ0.2|TBA5_ARATH RecName: Full=Tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAK32888.1|AF367301_1 AT5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAA32888.1| alpha-tubulin [Arabidopsis thaliana]
 gb|AAA32891.1| alpha-5 tubulin [Arabidopsis thaliana]
 gb|AAK64169.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAL38340.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85097.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31860.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31861.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN28834.1| At5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAN65084.1| unknown protein [Arabidopsis thaliana]
 gb|EFH48165.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50222.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|AED92747.1| tubulin alpha-3 [Arabidopsis thaliana]
 gb|AED92748.1| tubulin alpha-5 [Arabidopsis thaliana]
 gb|ESQ41991.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 gb|ESQ41993.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 gb|KFK26213.1| tubulin alpha-3 alpha-5 chain [Arabis alpina]
 gb|KFK26214.1| hypothetical protein AALP_AA8G217400 [Arabis alpina]
Length=450

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KCW87065.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=458

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINY+PPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  338  NAAVATIKTKRTVQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  397

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  398  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  441



>ref|XP_010414865.1| PREDICTED: tubulin alpha-1 chain [Camelina sativa]
Length=450

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            N AVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NTAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EPY40479.1| tubulin alpha [Angomonas deanei]
 gb|EPY41044.1| tubulin alpha [Angomonas deanei]
 gb|EPY41215.1| tubulin alpha [Angomonas deanei]
Length=248

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAA+ATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  127  NAAIATIKTKRTIQFVDWAPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  186

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  187  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>ref|XP_002772835.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
 gb|EER04651.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
Length=153

 Score =   211 bits (536),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKV RAVCMISN+TAVAEVF
Sbjct  29   NAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTAVAEVF  88

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  89   SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  132



>gb|ABR26150.1| tubulin alpha-3 chain [Oryza sativa Indica Group]
Length=186

 Score =   212 bits (539),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V EVF
Sbjct  64   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVF  123

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  124  SRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  167



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+ E+F
Sbjct  133  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIGEIF  192

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKD+
Sbjct  193  SRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDF  236



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  294  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  353

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  354  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>gb|ABL61086.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  192  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  251

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  252  SRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  294  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  353

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  354  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>ref|XP_011075054.1| PREDICTED: tubulin alpha-3 chain-like [Sesamum indicum]
Length=449

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVA+IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF
Sbjct  329  NAAVASIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006286795.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
 gb|EOA19693.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
Length=450

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47738.1| alpha-tubulin [Gossypium hirsutum]
 gb|KJB40985.1| hypothetical protein B456_007G086400 [Gossypium raimondii]
Length=449

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPAVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABV55994.1| alpha-tubulin 6 [Populus tremuloides]
Length=449

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            N+AVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NSAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID+KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDYKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EPY39349.1| tubulin alpha, partial [Angomonas deanei]
Length=306

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAA+ATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  194  NAAIATIKTKRTIQFVDWAPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  253

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  254  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  297



>ref|XP_002319688.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE95611.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            N+AVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NSAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID+KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDYKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD20819.1| alpha tubulin [Zea mays]
Length=146

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V EVF
Sbjct  24   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVF  83

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDL ALEKDY
Sbjct  84   SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLRALEKDY  127



>gb|KHG26159.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=449

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNT+VAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTSVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EPY33355.1| tubulin alpha [Strigomonas culicis]
 gb|EPY33584.1| tubulin alpha [Strigomonas culicis]
Length=315

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAA+ATIKTKRT+QFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMI+N+TA+AEVF
Sbjct  194  NAAIATIKTKRTIQFVDWAPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVF  253

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  254  ARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  297



>gb|ADJ00012.1| tubulin alpha chain [Chromera velia]
Length=234

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAA+ATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKV RA CMISN+TA+AEVF
Sbjct  131  NAAIATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRACCMISNSTAIAEVF  190

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  191  SRMDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  234



>gb|KJB44614.1| hypothetical protein B456_007G261000 [Gossypium raimondii]
Length=449

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNT+VAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTSVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  329  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  329  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  329  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  329  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V EVF
Sbjct  134  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVF  193

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDL ALEKDY
Sbjct  194  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLRALEKDY  237



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  329  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAB36609.1| alpha-tubulin, partial [Eucalyptus globulus subsp. bicostata]
Length=380

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T +AEVF
Sbjct  259  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTRLAEVF  318

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  319  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  362



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  329  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008240533.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Prunus mume]
Length=449

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NA+VATIKTKRTVQFVDWCPTGFKCGINY+PP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NASVATIKTKRTVQFVDWCPTGFKCGINYEPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007204346.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
 gb|EMJ05545.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
Length=449

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NA+VATIKTKRTVQFVDWCPTGFKCGINY+PP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NASVATIKTKRTVQFVDWCPTGFKCGINYEPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004149645.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 ref|XP_004164931.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN54025.1| hypothetical protein Csa_4G268090 [Cucumis sativus]
Length=449

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLALVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004504311.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=449

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003629736.1| Alpha-tubulin [Medicago truncatula]
 gb|AET04212.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAV TIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP42087.1| hypothetical protein JCGZ_01875 [Jatropha curcas]
Length=450

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLARVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ETM52928.1| tubulin alpha chain, partial [Phytophthora parasitica]
 gb|ETM52931.1| tubulin alpha chain, partial [Phytophthora parasitica]
Length=398

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN +A+AEVF
Sbjct  274  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVF  333

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  334  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  377



>gb|ETI53409.1| tubulin alpha chain [Phytophthora parasitica P1569]
Length=152

 Score =   210 bits (534),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAV MISN +A+AEVF
Sbjct  28   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVAMISNTSAIAEVF  87

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHW+VGEGMEEGEFSEAREDLAALEKDY
Sbjct  88   SRIDHKFDLMYAKRAFVHWFVGEGMEEGEFSEAREDLAALEKDY  131



>gb|ABL61202.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   215 bits (547),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  177  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  236

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KF+LMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  237  SRIDRKFELMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  280



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  329  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008449885.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Cucumis melo]
Length=449

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLALVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61204.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QF DWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  177  NAAVATIKTKRTIQFADWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  236

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  237  SRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  280



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  310  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  369

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  370  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  413



>gb|ABR25378.1| tubulin alpha 3 chain [Oryza sativa Indica Group]
Length=207

 Score =   211 bits (538),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V EVF
Sbjct  85   NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVF  144

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  145  SRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  188



>gb|KJB34154.1| hypothetical protein B456_006G050600 [Gossypium raimondii]
Length=229

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQR V MISN+T VAEVF
Sbjct  108  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRVVFMISNSTGVAEVF  167

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  168  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  211



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  295  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  354

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  355  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  398



>gb|ABL61219.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   215 bits (547),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TAVAEVF
Sbjct  192  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAVAEVF  251

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAF HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  252  SRIDRKFDLMYAKRAFAHWYVGEGMEEGEFSEAREDLAALEKDY  295



>gb|AAO46128.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  128  NAAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  187

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFD MY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  188  SRIDHKFDSMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>ref|XP_011398411.1| Tubulin alpha chain [Auxenochlorella protothecoides]
 gb|KFM25515.1| Tubulin alpha chain [Auxenochlorella protothecoides]
Length=394

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVAT+KTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  273  NAAVATVKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  332

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  333  SRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  376



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  282  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  341

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  342  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  385



>ref|XP_004170946.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-3 chain-like [Cucumis 
sativus]
Length=447

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+TAVAEVF
Sbjct  327  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTAVAEVF  386

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  387  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  430



>emb|CAD24766.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIK KRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKAKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABU93324.1| tubulin alpha subunit [Monocercomonoides sp. PA]
Length=452

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  329  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAB76918.1| alpha-tubulin 5 [Hordeum vulgare subsp. vulgare]
Length=192

 Score =   211 bits (536),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            N+AV +IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKV+RAVCMISNNTAVAEVF
Sbjct  72   NSAVHSIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVRRAVCMISNNTAVAEVF  131

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  132  SRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175



>emb|CDP14299.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVA+IKTKRTVQFVDWCPTGFKCGINYQPPTVVP GDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVASIKTKRTVQFVDWCPTGFKCGINYQPPTVVPCGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61213.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIK KRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  192  NAAVATIKAKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  251

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  252  SRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_008464962.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis melo]
Length=449

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+TAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006443441.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
 ref|XP_006479124.1| PREDICTED: tubulin alpha-3 chain-like [Citrus sinensis]
 gb|ESR56681.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
Length=449

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            N AVATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVF
Sbjct  329  NTAVATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRA+CMISN+T+VAEVF
Sbjct  185  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAICMISNSTSVAEVF  244

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  245  SRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  288



>gb|ABU93323.1| tubulin alpha subunit [Monocercomonoides sp. PA]
Length=452

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  329  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004141134.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN59749.1| Tubulin alpha-3 chain [Cucumis sativus]
Length=449

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+TAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AEQ75493.1| alpha-tubulin [Rosa multiflora]
Length=440

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  318  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  377

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  378  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  421



>gb|ABL61217.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+Q VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  192  NAAVATIKTKRTIQLVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  251

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  252  SRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>gb|KJB80786.1| hypothetical protein B456_013G115100 [Gossypium raimondii]
Length=449

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  ARIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG19627.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            +RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  ARIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABU93321.1| tubulin alpha subunit [Monocercomonoides sp. PA]
 gb|ABU93322.1| tubulin alpha subunit [Monocercomonoides sp. PA]
Length=452

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVF
Sbjct  329  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGV54500.1| tubulin A [Phaseolus vulgaris]
Length=449

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/104 (98%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF
Sbjct  329  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/104 (96%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = -3

Query  609  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF  430
            NAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVF
Sbjct  329  NAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF  388

Query  429  SRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  298
            SRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  SRIDHKFDLMYTKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230