BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF045A08

Length=660
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP14047.1|  unnamed protein product                                160   9e-44   Coffea canephora [robusta coffee]
ref|XP_009791710.1|  PREDICTED: 60S acidic ribosomal protein P0         160   1e-43   Nicotiana sylvestris
ref|XP_004239781.1|  PREDICTED: 60S acidic ribosomal protein P0         157   1e-42   Solanum lycopersicum
ref|XP_009608105.1|  PREDICTED: 60S acidic ribosomal protein P0         157   1e-42   Nicotiana tomentosiformis
gb|AID52928.1|  60S acidic ribosomal protein P0                         154   1e-41   Carthamus tinctorius
ref|NP_001239676.1|  uncharacterized protein LOC100777482               154   1e-41   Glycine max [soybeans]
ref|NP_001238374.1|  60S acidic ribosomal protein P0                    154   2e-41   Glycine max [soybeans]
ref|NP_001275012.1|  60S acidic ribosomal protein P0-like               154   3e-41   Solanum tuberosum [potatoes]
emb|CAN76468.1|  hypothetical protein VITISV_030042                     152   5e-41   Vitis vinifera
ref|XP_011076719.1|  PREDICTED: 60S acidic ribosomal protein P0         153   6e-41   Sesamum indicum [beniseed]
emb|CBI31491.3|  unnamed protein product                                152   6e-41   Vitis vinifera
emb|CBI25508.3|  unnamed protein product                                152   6e-41   Vitis vinifera
gb|KJB74261.1|  hypothetical protein B456_011G283700                    153   6e-41   Gossypium raimondii
ref|XP_004149240.1|  PREDICTED: 60S acidic ribosomal protein P0-like    152   7e-41   Cucumis sativus [cucumbers]
gb|KHG25462.1|  60S acidic ribosomal P0                                 152   7e-41   Gossypium arboreum [tree cotton]
gb|KJB78787.1|  hypothetical protein B456_013G019000                    152   7e-41   Gossypium raimondii
gb|KHG08087.1|  60S acidic ribosomal P0                                 152   8e-41   Gossypium arboreum [tree cotton]
ref|XP_002276842.1|  PREDICTED: 60S acidic ribosomal protein P0         152   8e-41   Vitis vinifera
ref|XP_002268645.1|  PREDICTED: 60S acidic ribosomal protein P0         152   1e-40   Vitis vinifera
ref|XP_004490967.1|  PREDICTED: 60S acidic ribosomal protein P0-like    152   1e-40   Cicer arietinum [garbanzo]
ref|XP_004490966.1|  PREDICTED: 60S acidic ribosomal protein P0-like    152   1e-40   Cicer arietinum [garbanzo]
ref|XP_004165071.1|  PREDICTED: 60S acidic ribosomal protein P0-like    152   1e-40   
ref|XP_007157498.1|  hypothetical protein PHAVU_002G074600g             151   2e-40   Phaseolus vulgaris [French bean]
gb|EYU18304.1|  hypothetical protein MIMGU_mgv1a010092mg                151   2e-40   Erythranthe guttata [common monkey flower]
gb|KJB76158.1|  hypothetical protein B456_012G076000                    151   3e-40   Gossypium raimondii
gb|KJB76159.1|  hypothetical protein B456_012G076000                    151   3e-40   Gossypium raimondii
ref|XP_008463223.1|  PREDICTED: 60S acidic ribosomal protein P0         151   3e-40   Cucumis melo [Oriental melon]
ref|XP_010067511.1|  PREDICTED: 60S acidic ribosomal protein P0         150   4e-40   Eucalyptus grandis [rose gum]
emb|CAN80537.1|  hypothetical protein VITISV_003812                     150   4e-40   Vitis vinifera
ref|XP_007153264.1|  hypothetical protein PHAVU_003G020600g             150   4e-40   Phaseolus vulgaris [French bean]
gb|AGV54296.1|  60S acidic ribosomal protein P0                         150   4e-40   Phaseolus vulgaris [French bean]
ref|XP_010689885.1|  PREDICTED: 60S acidic ribosomal protein P0         150   4e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU43502.1|  hypothetical protein MIMGU_mgv1a010103mg                149   4e-40   Erythranthe guttata [common monkey flower]
gb|EYU19990.1|  hypothetical protein MIMGU_mgv1a0100892mg               147   4e-40   Erythranthe guttata [common monkey flower]
gb|AFK39880.1|  unknown                                                 150   6e-40   Medicago truncatula
ref|XP_003603496.1|  60S acidic ribosomal protein p0                    150   7e-40   Medicago truncatula
ref|XP_004501267.1|  PREDICTED: 60S acidic ribosomal protein P0-like    150   9e-40   Cicer arietinum [garbanzo]
gb|EYU43500.1|  hypothetical protein MIMGU_mgv1a010103mg                150   1e-39   Erythranthe guttata [common monkey flower]
gb|EYU43501.1|  hypothetical protein MIMGU_mgv1a010103mg                149   1e-39   Erythranthe guttata [common monkey flower]
ref|XP_010534571.1|  PREDICTED: 60S acidic ribosomal protein P0-like    149   1e-39   Tarenaya hassleriana [spider flower]
dbj|BAE71263.1|  putative 60S acidic ribosomal protein P0               149   2e-39   Trifolium pratense [peavine clover]
ref|XP_003616595.1|  60S acidic ribosomal protein p0                    148   3e-39   Medicago truncatula
gb|AFK46889.1|  unknown                                                 148   4e-39   Medicago truncatula
ref|XP_011072152.1|  PREDICTED: 60S acidic ribosomal protein P0-like    148   4e-39   
ref|XP_009399833.1|  PREDICTED: 60S acidic ribosomal protein P0-like    148   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004247949.1|  PREDICTED: 60S acidic ribosomal protein P0-like    147   7e-39   Solanum lycopersicum
gb|ACJ84880.1|  unknown                                                 147   8e-39   Medicago truncatula
ref|XP_007009052.1|  Ribosomal protein L10 family protein isoform 2     147   1e-38   
ref|XP_007009051.1|  Ribosomal protein L10 family protein isoform 1     147   1e-38   
ref|XP_004972933.1|  PREDICTED: 60S acidic ribosomal protein P0-like    147   1e-38   Setaria italica
ref|XP_011042597.1|  PREDICTED: 60S acidic ribosomal protein P0-like    146   1e-38   Populus euphratica
gb|EMS52841.1|  60S acidic ribosomal protein P0                         145   2e-38   Triticum urartu
ref|XP_002526873.1|  60S acidic ribosomal protein P0, putative          146   2e-38   Ricinus communis
gb|KDP44812.1|  hypothetical protein JCGZ_01312                         146   2e-38   Jatropha curcas
ref|XP_010534676.1|  PREDICTED: 60S acidic ribosomal protein P0-like    146   2e-38   Tarenaya hassleriana [spider flower]
ref|XP_009389889.1|  PREDICTED: 60S acidic ribosomal protein P0         146   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACL52455.1|  unknown                                                 146   2e-38   Zea mays [maize]
ref|NP_001141489.1|  hypothetical protein                               146   2e-38   Zea mays [maize]
gb|ABK95701.1|  unknown                                                 146   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_010486703.1|  PREDICTED: 60S acidic ribosomal protein P0-3       146   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010486773.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    146   2e-38   Camelina sativa [gold-of-pleasure]
gb|AFK38760.1|  unknown                                                 146   3e-38   Lotus japonicus
ref|XP_004958562.1|  PREDICTED: 60S acidic ribosomal protein P0-like    145   3e-38   Setaria italica
gb|AAD56335.1|AC009326_22  putative 60S acidic ribosomal protein,...    143   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009764939.1|  PREDICTED: 60S acidic ribosomal protein P0-like    145   6e-38   Nicotiana sylvestris
gb|EPS69246.1|  p0 ribosomal protein-like protein                       145   6e-38   Genlisea aurea
ref|XP_010554654.1|  PREDICTED: 60S acidic ribosomal protein P0         145   6e-38   Tarenaya hassleriana [spider flower]
gb|ACF83717.1|  unknown                                                 145   6e-38   Zea mays [maize]
ref|NP_001105482.1|  60S acidic ribosomal protein P0                    145   6e-38   Zea mays [maize]
gb|KHG25720.1|  60S acidic ribosomal P0                                 145   7e-38   Gossypium arboreum [tree cotton]
ref|XP_006360336.1|  PREDICTED: 60S acidic ribosomal protein P0-like    145   7e-38   Solanum tuberosum [potatoes]
ref|NP_001078125.1|  60S acidic ribosomal protein P0-2                  144   8e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009619762.1|  PREDICTED: 60S acidic ribosomal protein P0-like    144   8e-38   Nicotiana tomentosiformis
gb|EMT02739.1|  60S acidic ribosomal protein P0                         144   9e-38   
ref|XP_006298124.1|  hypothetical protein CARUB_v10014186mg             144   9e-38   Capsella rubella
gb|ADE76171.1|  unknown                                                 143   1e-37   Picea sitchensis
ref|XP_009409427.1|  PREDICTED: 60S acidic ribosomal protein P0-like    144   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010464828.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    144   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002312149.1|  60S acidic ribosomal protein P0-A                  144   1e-37   Populus trichocarpa [western balsam poplar]
ref|NP_187734.1|  60S acidic ribosomal protein P0-3                     144   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882720.1|  60S acidic ribosomal protein P0                    144   1e-37   
gb|EEC82854.1|  hypothetical protein OsI_27702                          141   1e-37   Oryza sativa Indica Group [Indian rice]
ref|NP_187531.1|  60S acidic ribosomal protein P0-2                     144   1e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63644.1|  putative 60S acidic ribosomal protein P0                144   1e-37   Arabidopsis thaliana [mouse-ear cress]
gb|ADR71236.1|  60S acidic ribosomal protein P0B                        144   1e-37   Hevea brasiliensis [jebe]
gb|ADR71235.1|  60S acidic ribosomal protein P0A                        144   1e-37   Hevea brasiliensis [jebe]
ref|XP_002445000.1|  hypothetical protein SORBIDRAFT_07g002560          144   2e-37   Sorghum bicolor [broomcorn]
ref|XP_006848156.1|  hypothetical protein AMTR_s00029p00231170          144   2e-37   Amborella trichopoda
ref|XP_010234277.1|  PREDICTED: 60S acidic ribosomal protein P0         144   2e-37   Brachypodium distachyon [annual false brome]
gb|ABR26209.1|  60S acidic ribosomal protein p0                         141   2e-37   Oryza sativa Indica Group [Indian rice]
gb|AAF34767.1|AF227622_1  60S acidic ribosomal protein PO               143   2e-37   Euphorbia esula [wolf's milk]
ref|XP_002884720.1|  60S acidic ribosomal protein P0                    143   2e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_006659092.1|  PREDICTED: 60S acidic ribosomal protein P0-like    143   3e-37   Oryza brachyantha
gb|EAZ41410.1|  hypothetical protein OsJ_25932                          141   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010486480.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    143   4e-37   Camelina sativa [gold-of-pleasure]
gb|ABA95724.1|  60S acidic ribosomal protein P0, putative, expressed    142   4e-37   Oryza sativa Japonica Group [Japonica rice]
gb|ABA91328.1|  60S acidic ribosomal protein P0, putative, expressed    142   4e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EAY82182.1|  hypothetical protein OsI_37384                          142   4e-37   Oryza sativa Indica Group [Indian rice]
emb|CBX25428.1|  hypothetical_protein                                   142   4e-37   Oryza glaberrima
ref|XP_010469822.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    142   4e-37   Camelina sativa [gold-of-pleasure]
ref|NP_001060923.1|  Os08g0130500                                       142   5e-37   
ref|XP_006298147.1|  hypothetical protein CARUB_v10014197mg             142   5e-37   Capsella rubella
gb|AAM65265.1|  60S acidic ribosomal protein P0-C                       142   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002440235.1|  hypothetical protein SORBIDRAFT_09g028230          142   5e-37   Sorghum bicolor [broomcorn]
emb|CDY67524.1|  BnaAnng24540D                                          140   6e-37   Brassica napus [oilseed rape]
ref|XP_003573632.1|  PREDICTED: 60S acidic ribosomal protein P0-like    142   6e-37   Brachypodium distachyon [annual false brome]
emb|CDY07906.1|  BnaC03g36170D                                          142   6e-37   Brassica napus [oilseed rape]
ref|XP_008779152.1|  PREDICTED: 60S acidic ribosomal protein P0-like    139   6e-37   Phoenix dactylifera
ref|XP_010256605.1|  PREDICTED: 60S acidic ribosomal protein P0         142   7e-37   Nelumbo nucifera [Indian lotus]
gb|KFK36893.1|  hypothetical protein AALP_AA4G185700                    142   8e-37   Arabis alpina [alpine rockcress]
ref|XP_010464557.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    142   8e-37   Camelina sativa [gold-of-pleasure]
ref|XP_007016138.1|  Ribosomal protein L10 family protein               142   9e-37   
ref|XP_006411245.1|  hypothetical protein EUTSA_v10016954mg             142   9e-37   Eutrema salsugineum [saltwater cress]
gb|KHN36391.1|  60S acidic ribosomal protein P0                         142   9e-37   Glycine soja [wild soybean]
gb|KFK38515.1|  hypothetical protein AALP_AA3G123100                    142   1e-36   Arabis alpina [alpine rockcress]
gb|KHN34735.1|  60S acidic ribosomal protein P0                         142   1e-36   Glycine soja [wild soybean]
ref|XP_003538454.1|  PREDICTED: 60S acidic ribosomal protein P0-like    142   1e-36   Glycine max [soybeans]
emb|CDX73962.1|  BnaA03g30850D                                          142   1e-36   
ref|XP_007222847.1|  hypothetical protein PRUPE_ppa008800mg             141   1e-36   Prunus persica
emb|CDP16385.1|  unnamed protein product                                141   1e-36   Coffea canephora [robusta coffee]
emb|CDY53103.1|  BnaCnng24330D                                          141   2e-36   Brassica napus [oilseed rape]
ref|XP_009146942.1|  PREDICTED: 60S acidic ribosomal protein P0-2       141   2e-36   Brassica rapa
ref|XP_009123454.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    141   2e-36   Brassica rapa
dbj|BAJ92405.1|  predicted protein                                      141   2e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK94988.1|  unknown                                                 140   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_009135066.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    140   2e-36   Brassica rapa
ref|XP_006407706.1|  hypothetical protein EUTSA_v10021147mg             140   2e-36   Eutrema salsugineum [saltwater cress]
ref|XP_002315165.1|  60S acidic ribosomal protein P0-A                  140   2e-36   
gb|EMT17099.1|  60S acidic ribosomal protein P0                         140   3e-36   
ref|XP_010941551.1|  PREDICTED: 60S acidic ribosomal protein P0         140   4e-36   Elaeis guineensis
dbj|BAJ94456.1|  predicted protein                                      140   5e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK38306.1|  hypothetical protein AALP_AA3G096900                    140   5e-36   Arabis alpina [alpine rockcress]
ref|XP_010247657.1|  PREDICTED: 60S acidic ribosomal protein P0-like    139   6e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010095082.1|  60S acidic ribosomal protein P0                    139   8e-36   Morus notabilis
ref|XP_009350848.1|  PREDICTED: 60S acidic ribosomal protein P0-like    139   9e-36   Pyrus x bretschneideri [bai li]
ref|XP_008360784.1|  PREDICTED: 60S acidic ribosomal protein P0         139   9e-36   Malus domestica [apple tree]
ref|XP_008799093.1|  PREDICTED: 60S acidic ribosomal protein P0         139   9e-36   Phoenix dactylifera
ref|XP_011035984.1|  PREDICTED: 60S acidic ribosomal protein P0         139   1e-35   Populus euphratica
ref|XP_009344598.1|  PREDICTED: 60S acidic ribosomal protein P0         139   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_004145258.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    138   2e-35   Cucumis sativus [cucumbers]
ref|XP_002525622.1|  60S acidic ribosomal protein P0, putative          138   2e-35   Ricinus communis
ref|XP_004307622.1|  PREDICTED: 60S acidic ribosomal protein P0         138   2e-35   Fragaria vesca subsp. vesca
emb|CDP06275.1|  unnamed protein product                                136   2e-35   Coffea canephora [robusta coffee]
ref|XP_010926952.1|  PREDICTED: 60S acidic ribosomal protein P0         138   2e-35   Elaeis guineensis
gb|EYU22330.1|  hypothetical protein MIMGU_mgv1a019166mg                136   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_008392940.1|  PREDICTED: 60S acidic ribosomal protein P0         138   2e-35   Malus domestica [apple tree]
ref|XP_004307662.1|  PREDICTED: 60S acidic ribosomal protein P0         138   2e-35   Fragaria vesca subsp. vesca
ref|XP_011084927.1|  PREDICTED: 60S acidic ribosomal protein P0-like    137   3e-35   Sesamum indicum [beniseed]
emb|CDY24932.1|  BnaC03g22400D                                          137   3e-35   Brassica napus [oilseed rape]
ref|NP_181530.1|  60S acidic ribosomal protein P0-1                     137   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006435697.1|  hypothetical protein CICLE_v10032141mg             137   5e-35   Citrus clementina [clementine]
gb|KDO69054.1|  hypothetical protein CISIN_1g020952mg                   137   6e-35   Citrus sinensis [apfelsine]
ref|XP_004287422.1|  PREDICTED: 60S acidic ribosomal protein P0-like    137   7e-35   Fragaria vesca subsp. vesca
ref|XP_002881693.1|  60S acidic ribosomal protein P0                    136   1e-34   
emb|CDY60988.1|  BnaA03g56530D                                          136   1e-34   Brassica napus [oilseed rape]
ref|XP_009133397.1|  PREDICTED: 60S acidic ribosomal protein P0-1       136   1e-34   Brassica rapa
gb|AGL34823.1|  ribosomal protein 10                                    129   3e-34   Cyrtandra paludosa var. paludosa
ref|XP_008351783.1|  PREDICTED: uncharacterized protein LOC103415220    138   7e-34   
gb|KDP46515.1|  hypothetical protein JCGZ_08487                         134   7e-34   Jatropha curcas
ref|XP_010508934.1|  PREDICTED: 60S acidic ribosomal protein P0-1       134   9e-34   Camelina sativa [gold-of-pleasure]
ref|XP_001759592.1|  predicted protein                                  133   2e-33   
ref|XP_010517390.1|  PREDICTED: 60S acidic ribosomal protein P0-1...    133   2e-33   Camelina sativa [gold-of-pleasure]
gb|AGL34820.1|  ribosomal protein 10                                    127   2e-33   Cyrtandra schizocalyx
ref|XP_008457380.1|  PREDICTED: 60S acidic ribosomal protein P0-like    132   3e-33   Cucumis melo [Oriental melon]
ref|XP_001759851.1|  predicted protein                                  132   4e-33   
gb|KHG21849.1|  60S acidic ribosomal P0-2 -like protein                 130   4e-33   Gossypium arboreum [tree cotton]
ref|XP_007163525.1|  hypothetical protein PHAVU_001G241400g             132   5e-33   Phaseolus vulgaris [French bean]
gb|KHG01938.1|  60S acidic ribosomal P0-2 -like protein                 130   6e-33   Gossypium arboreum [tree cotton]
gb|KJB19895.1|  hypothetical protein B456_003G123400                    130   1e-32   Gossypium raimondii
ref|XP_009592351.1|  PREDICTED: 60S acidic ribosomal protein P0-like    129   7e-32   Nicotiana tomentosiformis
ref|XP_009799989.1|  PREDICTED: 60S acidic ribosomal protein P0-like    128   9e-32   Nicotiana sylvestris
gb|KDO69056.1|  hypothetical protein CISIN_1g036252mg                   128   1e-31   Citrus sinensis [apfelsine]
ref|XP_006435696.1|  hypothetical protein CICLE_v10033862mg             128   1e-31   Citrus clementina [clementine]
gb|AGL34822.1|  ribosomal protein 10                                    122   1e-31   Cyrtandra kauaiensis
ref|XP_004296403.1|  PREDICTED: 60S acidic ribosomal protein P0-like    127   2e-31   Fragaria vesca subsp. vesca
gb|AGL34821.1|  ribosomal protein 10                                    120   6e-31   Cyrtandra longifolia
gb|KDO69055.1|  hypothetical protein CISIN_1g020952mg                   126   6e-31   Citrus sinensis [apfelsine]
ref|XP_006296009.1|  hypothetical protein CARUB_v10025153mg             125   8e-31   Capsella rubella
ref|XP_010685586.1|  PREDICTED: 60S acidic ribosomal protein P0         125   1e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004241171.1|  PREDICTED: 60S acidic ribosomal protein P0-like    124   5e-30   Solanum lycopersicum
ref|XP_002983859.1|  hypothetical protein SELMODRAFT_268802             123   8e-30   Selaginella moellendorffii
ref|XP_002974292.1|  hypothetical protein SELMODRAFT_149765             123   9e-30   Selaginella moellendorffii
ref|XP_010104660.1|  60S acidic ribosomal protein P0-1                  120   1e-29   
ref|XP_002960810.1|  hypothetical protein SELMODRAFT_437282             122   2e-29   Selaginella moellendorffii
emb|CBI15980.3|  unnamed protein product                                119   5e-29   Vitis vinifera
ref|XP_002279500.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    120   6e-29   Vitis vinifera
emb|CAN65663.1|  hypothetical protein VITISV_014917                     120   2e-28   Vitis vinifera
ref|XP_002960261.1|  hypothetical protein SELMODRAFT_229877             119   3e-28   Selaginella moellendorffii
ref|XP_002967451.1|  hypothetical protein SELMODRAFT_87354              119   4e-28   Selaginella moellendorffii
ref|NP_001187030.1|  60S acidic ribosomal protein P0                    118   4e-28   Ictalurus punctatus
gb|AAT44430.1|  ribosomal protein large P0-like protein                 118   4e-28   Sparus aurata [gilthead bream]
ref|XP_006350830.1|  PREDICTED: 60S acidic ribosomal protein P0-like    118   6e-28   Solanum tuberosum [potatoes]
ref|XP_006640161.1|  PREDICTED: 60S acidic ribosomal protein P0-like    117   1e-27   Lepisosteus oculatus
ref|XP_005987234.1|  PREDICTED: 60S acidic ribosomal protein P0         117   1e-27   Latimeria chalumnae
ref|XP_006407705.1|  hypothetical protein EUTSA_v10021147mg             117   1e-27   
ref|XP_010740439.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    116   1e-27   
ref|XP_006784596.1|  PREDICTED: 60S acidic ribosomal protein P0-like    117   2e-27   Neolamprologus brichardi [lyretail cichlid]
ref|NP_001080134.1|  ribosomal protein, large, P0                       116   2e-27   Xenopus laevis [clawed frog]
ref|XP_010740438.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    116   3e-27   
ref|NP_989067.1|  ribosomal protein, large, P0                          116   3e-27   Xenopus tropicalis [western clawed frog]
gb|ACH73063.1|  ribosomal protein LP0-like protein                      113   4e-27   Epinephelus coioides [estuary cod]
ref|XP_005850392.1|  hypothetical protein CHLNCDRAFT_59607              115   4e-27   Chlorella variabilis
gb|EOA96285.1|  60S acidic ribosomal protein P0                         111   4e-27   Anas platyrhynchos [duck]
ref|XP_001697060.1|  acidic ribosomal protein P0                        115   5e-27   Chlamydomonas reinhardtii
dbj|BAF98695.1|  ribosomal protein LP0                                  115   6e-27   Solea senegalensis
gb|AHB33743.1|  60S acidic ribosomal protein P0                         115   8e-27   Cyprinus carpio [carp]
ref|XP_008292997.1|  PREDICTED: 60S acidic ribosomal protein P0         115   8e-27   Stegastes partitus
ref|XP_008318611.1|  PREDICTED: 60S acidic ribosomal protein P0         115   9e-27   Cynoglossus semilaevis [half-smooth tongue sole]
gb|ACH70801.1|  acidic ribosomal protein P0                             115   9e-27   Salmo salar
sp|Q9DG68.1|RLA0_RANSY  RecName: Full=60S acidic ribosomal protei...    115   1e-26   Rana sylvatica
gb|ABU63975.1|  ribosomal protein large P0-like protein                 114   1e-26   Perca flavescens
ref|XP_011415179.1|  PREDICTED: 60S acidic ribosomal protein P0-like    114   2e-26   Crassostrea gigas
emb|CDQ67134.1|  unnamed protein product                                114   2e-26   Oncorhynchus mykiss
gb|ACI68961.1|  60S acidic ribosomal protein P0                         114   2e-26   Salmo salar
ref|XP_010879645.1|  PREDICTED: 60S acidic ribosomal protein P0         114   2e-26   Esox lucius
gb|KJB74260.1|  hypothetical protein B456_011G283700                    113   2e-26   Gossypium raimondii
gb|ACO09070.1|  60S acidic ribosomal protein P0                         114   2e-26   Osmerus mordax
emb|CDQ63253.1|  unnamed protein product                                114   2e-26   Oncorhynchus mykiss
gb|ADF97607.1|  large ribosomal protein P0                              113   3e-26   Hypophthalmichthys molitrix
sp|Q9PV90.1|RLA0_DANRE  RecName: Full=60S acidic ribosomal protei...    113   4e-26   Danio rerio [leopard danio]
ref|NP_571655.2|  60S acidic ribosomal protein P0                       113   4e-26   Danio rerio [leopard danio]
gb|KDD72928.1|  hypothetical protein H632_c2720p0                       112   5e-26   Helicosporidium sp. ATCC 50920
gb|KFQ02732.1|  60S acidic ribosomal protein P0                         112   5e-26   Haliaeetus albicilla
gb|ADU04571.1|  60S acidic ribosomal protein PO                         112   6e-26   Phaseolus vulgaris [French bean]
ref|XP_007434308.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    112   6e-26   
gb|KFO65132.1|  60S acidic ribosomal protein P0                         112   7e-26   Corvus brachyrhynchos
ref|XP_008639852.1|  PREDICTED: 60S acidic ribosomal protein P0         112   7e-26   
ref|XP_009915794.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    111   7e-26   Haliaeetus albicilla
sp|P50345.1|RLA0_LUPLU  RecName: Full=60S acidic ribosomal protei...    112   8e-26   Lupinus luteus
gb|AEA51182.1|  acidic ribosomal protein P0                             110   8e-26   Oryzias melastigma [Java medaka]
gb|AAI04646.1|  RPLP0 protein                                           108   8e-26   Homo sapiens [man]
ref|XP_010396743.1|  PREDICTED: 60S acidic ribosomal protein P0         112   8e-26   
gb|KFQ10333.1|  60S acidic ribosomal protein P0                         111   9e-26   Leptosomus discolor
ref|XP_004545259.1|  PREDICTED: 60S acidic ribosomal protein P0-like    112   9e-26   Maylandia zebra
ref|XP_003973625.1|  PREDICTED: 60S acidic ribosomal protein P0-like    112   9e-26   Takifugu rubripes [tiger puffer]
ref|XP_005918671.1|  PREDICTED: 60S acidic ribosomal protein P0-like    112   9e-26   Haplochromis burtoni
ref|XP_005421617.1|  PREDICTED: 60S acidic ribosomal protein P0         112   9e-26   
ref|XP_009582133.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    111   9e-26   Fulmarus glacialis
ref|XP_003441603.1|  PREDICTED: 60S acidic ribosomal protein P0         112   1e-25   Oreochromis niloticus
gb|AEA51110.1|  60S acidic ribosomal protein P0                         112   1e-25   Oryzias melastigma [Java medaka]
gb|KFZ54738.1|  60S acidic ribosomal protein P0                         111   1e-25   Podiceps cristatus
ref|XP_009487343.1|  PREDICTED: 60S acidic ribosomal protein P0         111   1e-25   Pelecanus crispus
gb|KFQ53080.1|  60S acidic ribosomal protein P0                         110   1e-25   Nestor notabilis
gb|AAH49058.1|  Rplp0 protein                                           111   1e-25   Danio rerio [leopard danio]
ref|XP_005054917.1|  PREDICTED: 60S acidic ribosomal protein P0         111   1e-25   
ref|XP_002199561.1|  PREDICTED: 60S acidic ribosomal protein P0         111   1e-25   Taeniopygia guttata
ref|XP_005524479.1|  PREDICTED: 60S acidic ribosomal protein P0         111   1e-25   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005493516.1|  PREDICTED: 60S acidic ribosomal protein P0         111   1e-25   Zonotrichia albicollis
ref|XP_008924020.1|  PREDICTED: 60S acidic ribosomal protein P0         111   1e-25   
ref|XP_010133581.1|  PREDICTED: 60S acidic ribosomal protein P0         111   2e-25   Buceros rhinoceros silvestris
gb|AFM88893.1|  ribosomal protein, large, P0                            111   2e-25   Callorhinchus milii [Australian ghost shark]
gb|AFM87695.1|  ribosomal protein, large, P0                            110   2e-25   Callorhinchus milii [Australian ghost shark]
emb|CAA33199.1|  unnamed protein product                                111   2e-25   Rattus rattus [house rat]
ref|XP_009869989.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    110   2e-25   Apaloderma vittatum
ref|XP_005503982.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    111   2e-25   Columba livia [carrier pigeon]
ref|XP_005798004.1|  PREDICTED: 60S acidic ribosomal protein P0-like    111   2e-25   Xiphophorus maculatus
emb|CAG01875.1|  unnamed protein product                                111   2e-25   Tetraodon nigroviridis
ref|XP_010226991.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    111   2e-25   Tinamus guttatus
ref|XP_007255906.1|  PREDICTED: 60S acidic ribosomal protein P0-like    108   2e-25   
ref|XP_010572856.1|  PREDICTED: 60S acidic ribosomal protein P0         111   2e-25   Haliaeetus leucocephalus
ref|XP_004591942.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    111   2e-25   Ochotona princeps [southern American pika]
ref|XP_010306195.1|  PREDICTED: 60S acidic ribosomal protein P0         110   2e-25   Balearica regulorum gibbericeps
ref|XP_009948467.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    111   2e-25   Leptosomus discolor
ref|XP_010016668.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    110   2e-25   Nestor notabilis
ref|XP_003211127.2|  PREDICTED: 60S acidic ribosomal protein P0         111   2e-25   
ref|XP_009708350.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    110   3e-25   Cariama cristata
ref|XP_008501040.1|  PREDICTED: 60S acidic ribosomal protein P0         110   3e-25   Calypte anna
gb|AFM87342.1|  ribosomal protein, large, P0                            110   3e-25   Callorhinchus milii [Australian ghost shark]
gb|AFM89484.1|  ribosomal protein, large, P0                            110   3e-25   Callorhinchus milii [Australian ghost shark]
gb|AFM86819.1|  ribosomal protein, large, P0                            110   3e-25   Callorhinchus milii [Australian ghost shark]
gb|AFM86580.1|  ribosomal protein, large, P0                            110   3e-25   Callorhinchus milii [Australian ghost shark]
gb|KFP07838.1|  60S acidic ribosomal protein P0                         110   3e-25   Calypte anna
ref|XP_010003135.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    110   3e-25   Chaetura pelagica
gb|AFM85484.1|  ribosomal protein, large, P0                            110   3e-25   Callorhinchus milii [Australian ghost shark]
gb|AFM89472.1|  ribosomal protein, large, P0                            110   3e-25   Callorhinchus milii [Australian ghost shark]
gb|AFM89459.1|  ribosomal protein, large, P0                            110   3e-25   Callorhinchus milii [Australian ghost shark]
gb|AFM89518.1|  ribosomal protein, large, P0                            110   3e-25   Callorhinchus milii [Australian ghost shark]
gb|AFM85775.1|  ribosomal protein, large, P0                            110   3e-25   Callorhinchus milii [Australian ghost shark]
ref|XP_006890483.1|  PREDICTED: 60S acidic ribosomal protein P0         110   3e-25   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|AFM85706.1|  ribosomal protein, large, P0                            110   3e-25   
gb|EHH21238.1|  hypothetical protein EGK_04254                          110   3e-25   
gb|AFM86948.1|  ribosomal protein, large, P0                            110   3e-25   
gb|AFM87161.1|  ribosomal protein, large, P0                            110   3e-25   
gb|AFM86446.1|  ribosomal protein, large, P0                            110   3e-25   
ref|XP_005445335.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    110   3e-25   
ref|XP_003226041.1|  PREDICTED: 60S acidic ribosomal protein P0         110   3e-25   
ref|NP_001279963.1|  ribosomal protein, large, P0                       110   3e-25   
gb|AFM87759.1|  ribosomal protein, large, P0                            110   3e-25   
gb|AFM85937.1|  ribosomal protein, large, P0                            110   3e-25   
ref|XP_010080334.1|  PREDICTED: 60S acidic ribosomal protein P0         109   3e-25   
ref|XP_008407632.1|  PREDICTED: 60S acidic ribosomal protein P0         110   3e-25   
gb|AFM90832.1|  ribosomal protein, large, P0                            110   4e-25   
ref|XP_007554302.1|  PREDICTED: 60S acidic ribosomal protein P0         110   4e-25   
gb|ABB29594.1|  ribosomal protein P0 large subunit                      109   4e-25   
ref|XP_008151673.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    110   4e-25   
ref|XP_010177042.1|  PREDICTED: 60S acidic ribosomal protein P0         110   4e-25   
ref|XP_006129131.1|  PREDICTED: 60S acidic ribosomal protein P0         110   4e-25   
ref|XP_005107960.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    110   5e-25   
ref|XP_006895246.1|  PREDICTED: 60S acidic ribosomal protein P0-like    109   5e-25   
gb|ACQ57902.1|  60S acidic ribosomal protein P0                         110   5e-25   
gb|ADD21620.1|  ribosomal protein P0                                    109   5e-25   
dbj|BAG65447.1|  unnamed protein product                                109   5e-25   
gb|AFM87081.1|  ribosomal protein, large, P0                            110   5e-25   
ref|XP_004888210.1|  PREDICTED: 60S acidic ribosomal protein P0         110   5e-25   
ref|XP_010967878.1|  PREDICTED: 60S acidic ribosomal protein P0         110   5e-25   
emb|CBV76074.1|  60S acidic ribosomal protein P0                        110   6e-25   
ref|NP_001239066.1|  ribosomal protein, large, P0                       110   6e-25   
ref|XP_010602365.1|  PREDICTED: 60S acidic ribosomal protein P0         110   6e-25   
ref|XP_004636304.1|  PREDICTED: 60S acidic ribosomal protein P0         110   6e-25   
ref|XP_010996948.1|  PREDICTED: 60S acidic ribosomal protein P0         110   6e-25   
ref|XP_008838692.1|  PREDICTED: 60S acidic ribosomal protein P0         110   6e-25   
ref|XP_010171168.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    109   6e-25   
ref|XP_006192755.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    110   6e-25   
ref|XP_004429976.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    110   6e-25   
gb|AHK09711.1|  60S acidic ribosomal protein P0                         109   6e-25   
ref|XP_003478429.1|  PREDICTED: 60S acidic ribosomal protein P0         110   6e-25   
gb|AJQ18907.1|  acidic ribosomal protein P0                             109   7e-25   
ref|NP_001092068.1|  60S acidic ribosomal protein P0                    109   7e-25   
ref|XP_009246581.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    109   7e-25   
ref|XP_005863834.1|  PREDICTED: 60S acidic ribosomal protein P0         109   7e-25   
ref|XP_009685789.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    109   8e-25   
gb|AAI51696.1|  RPLP0 protein                                           109   8e-25   
ref|XP_002958097.1|  hypothetical protein VOLCADRAFT_84328              109   8e-25   
ref|XP_001363537.1|  PREDICTED: 60S acidic ribosomal protein P0         109   8e-25   
ref|XP_006019892.1|  PREDICTED: 60S acidic ribosomal protein P0         109   8e-25   
ref|XP_005876332.1|  PREDICTED: 60S acidic ribosomal protein P0-like    109   8e-25   
ref|XP_003789970.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    109   8e-25   
gb|AFM85590.1|  ribosomal protein, large, P0                            109   8e-25   
gb|AFM86828.1|  ribosomal protein, large, P0                            109   8e-25   
ref|XP_006053033.1|  PREDICTED: 60S acidic ribosomal protein P0         109   9e-25   
gb|AAB65436.1|  acidic ribosomal phosphoprotein PO                      109   9e-25   
ref|XP_004017462.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    109   9e-25   
dbj|BAD96188.1|  ribosomal protein P0 variant                           109   9e-25   
gb|AFM86570.1|  ribosomal protein, large, P0                            109   9e-25   
ref|NP_000993.1|  60S acidic ribosomal protein P0                       109   1e-24   
ref|XP_010127000.1|  PREDICTED: 60S acidic ribosomal protein P0         108   1e-24   
ref|XP_005709583.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    109   1e-24   
gb|KFP45896.1|  60S acidic ribosomal protein P0                         108   1e-24   
dbj|BAD96291.1|  ribosomal protein P0 variant                           109   1e-24   
gb|AHK09710.1|  60S acidic ribosomal protein P0                         108   1e-24   
gb|AFM86675.1|  ribosomal protein, large, P0                            109   1e-24   
ref|XP_006204865.1|  PREDICTED: 60S acidic ribosomal protein P0         109   1e-24   
gb|AFM86528.1|  ribosomal protein, large, P0                            109   1e-24   
ref|XP_010366585.1|  PREDICTED: 60S acidic ribosomal protein P0         109   1e-24   
gb|AIS76467.1|  large ribosomal protein P0                              109   1e-24   
gb|AAI02075.1|  Ribosomal protein, large, P0                            109   1e-24   
ref|XP_005962035.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    109   1e-24   
ref|NP_001182357.1|  acidic ribosomal phosphoprotein PO                 109   1e-24   
ref|NP_001012700.1|  60S acidic ribosomal protein P0                    109   1e-24   
ref|NP_990318.1|  60S acidic ribosomal protein P0                       108   1e-24   
ref|XP_009886897.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    108   1e-24   
gb|ABZ04250.1|  ribosomal protein rplp0                                 108   1e-24   
gb|AAS49563.1|  ribosomal protein Large P0                              107   1e-24   
gb|AHW68491.1|  60S acidic ribosomal protein P0                         108   1e-24   
ref|XP_008141153.1|  PREDICTED: 60S acidic ribosomal protein P0         107   2e-24   
gb|AHW68488.1|  60S acidic ribosomal protein P0                         108   2e-24   
ref|XP_009989862.1|  PREDICTED: 60S acidic ribosomal protein P0         108   2e-24   
ref|XP_005288756.1|  PREDICTED: 60S acidic ribosomal protein P0         108   2e-24   
ref|XP_006893187.1|  PREDICTED: 60S acidic ribosomal protein P0-like    107   2e-24   
gb|EHB17679.1|  60S acidic ribosomal protein P0                         108   2e-24   
gb|ABF69531.1|  acidic ribosomal protein P0                             108   2e-24   
gb|AHW68489.1|  60S acidic ribosomal protein P0                         108   2e-24   
gb|KFV06138.1|  60S acidic ribosomal protein P0                         108   2e-24   
gb|AAH03833.1|  Ribosomal protein, large, P0                            108   2e-24   
ref|XP_007643381.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    108   2e-24   
ref|XP_005336874.1|  PREDICTED: 60S acidic ribosomal protein P0         108   2e-24   
ref|XP_005344377.1|  PREDICTED: 60S acidic ribosomal protein P0         108   2e-24   
ref|XP_010290716.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    107   2e-24   
ref|XP_008582193.1|  PREDICTED: 60S acidic ribosomal protein P0         108   2e-24   
ref|XP_005396575.1|  PREDICTED: 60S acidic ribosomal protein P0         108   3e-24   
ref|XP_011473581.1|  PREDICTED: 60S acidic ribosomal protein P0         107   3e-24   
ref|XP_003495963.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    108   3e-24   
ref|XP_004664195.1|  PREDICTED: 60S acidic ribosomal protein P0         108   3e-24   
gb|AFK10546.1|  ribosomal protein, large, P0                            108   3e-24   
gb|AAH01127.1|  Ribosomal protein, large, P0                            108   3e-24   
ref|XP_003763170.1|  PREDICTED: 60S acidic ribosomal protein P0-like    108   3e-24   
ref|XP_005869587.1|  PREDICTED: 60S acidic ribosomal protein P0-like    108   3e-24   
gb|AFM86966.1|  ribosomal protein, large, P0                            107   3e-24   
gb|AFM86008.1|  ribosomal protein, large, P0                            107   3e-24   
gb|AFM88521.1|  ribosomal protein, large, P0                            107   3e-24   
ref|XP_001115939.2|  PREDICTED: 60S acidic ribosomal protein P0-like    107   4e-24   
gb|EFB17077.1|  hypothetical protein PANDA_020357                       107   5e-24   
gb|EHH66765.1|  hypothetical protein EGM_03817                          107   5e-24   
ref|XP_006902463.1|  PREDICTED: 60S acidic ribosomal protein P0-like    107   5e-24   
ref|XP_003907291.1|  PREDICTED: 60S acidic ribosomal protein P0         107   5e-24   
ref|XP_004611130.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    107   5e-24   
ref|XP_009178294.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    107   6e-24   
gb|ELT92567.1|  hypothetical protein CAPTEDRAFT_167366                  107   7e-24   
ref|XP_009440587.1|  PREDICTED: 60S acidic ribosomal protein P0-like    107   7e-24   
ref|XP_002930016.1|  PREDICTED: 60S acidic ribosomal protein P0         107   7e-24   
dbj|BAF83798.1|  unnamed protein product                                107   7e-24   
gb|AHK09709.1|  60S acidic ribosomal protein P0                         106   7e-24   
ref|NP_031501.1|  60S acidic ribosomal protein P0                       107   7e-24   
ref|XP_002425010.1|  ribosomal P0 protein, putative                     107   7e-24   
gb|ADX97164.1|  ribosomal protein large p0-like protein                 102   8e-24   
gb|EHH54874.1|  hypothetical protein EGM_03973                          106   8e-24   
gb|AFX73002.1|  deoxyribonuclease                                       106   9e-24   
ref|XP_006745368.1|  PREDICTED: 60S acidic ribosomal protein P0         106   9e-24   
ref|XP_004691044.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    106   1e-23   
ref|XP_005026768.1|  PREDICTED: translational activator GCN1            110   1e-23   
ref|XP_008157424.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    106   1e-23   
gb|AAU84931.1|  putative acidic p0 ribosomal protein                    106   1e-23   
gb|AAY66850.1|  60S acidic ribosomal protein P0                         106   1e-23   
ref|XP_002399611.1|  60S acidic ribosomal protein P0, putative          106   1e-23   
ref|XP_008067488.1|  PREDICTED: 60S acidic ribosomal protein P0         106   1e-23   
ref|XP_004658356.1|  PREDICTED: 60S acidic ribosomal protein P0-like    106   1e-23   
gb|ADD21619.1|  ribosomal protein P0                                    105   1e-23   
gb|ABF69504.1|  acidic ribosomal protein 0                              103   1e-23   
gb|ADV40160.1|  60S acidic ribosomal protein P0                         105   1e-23   
ref|XP_004709621.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    106   1e-23   
gb|ABM55512.1|  putative ribosomal protein P0                           105   2e-23   
ref|XP_002719840.1|  PREDICTED: 60S acidic ribosomal protein P0         105   2e-23   
gb|AEL28833.1|  ribosomal protein P0                                    105   2e-23   
gb|AGQ49465.1|  acidic ribosomal protein P0                             105   2e-23   
dbj|BAH70537.1|  ACYPI000079                                            105   3e-23   
ref|XP_007130059.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    105   3e-23   
ref|NP_001119687.1|  ribosomal protein LP0                              105   3e-23   
emb|CAQ63458.1|  ribosomal protein                                      105   3e-23   
ref|XP_005352132.1|  PREDICTED: 60S acidic ribosomal protein P0-like    105   3e-23   
ref|XP_006865510.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    105   3e-23   
dbj|BAH70543.1|  ACYPI000079                                            105   3e-23   
gb|ABW16870.1|  ribosomal protein P0                                    105   3e-23   
gb|KDR14762.1|  60S acidic ribosomal protein P0                         105   4e-23   
ref|XP_007936405.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    104   4e-23   
ref|XP_003743791.1|  PREDICTED: 60S acidic ribosomal protein P0-like    104   4e-23   
ref|XP_009285795.1|  PREDICTED: 60S acidic ribosomal protein P0         104   5e-23   
gb|ABW04139.1|  ribosomal protein LP0                                   103   6e-23   
ref|XP_003419310.1|  PREDICTED: 60S acidic ribosomal protein P0         104   7e-23   
ref|XP_009966547.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    103   7e-23   
ref|XP_011146226.1|  PREDICTED: 60S acidic ribosomal protein P0-like    104   7e-23   
ref|XP_004379079.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    103   7e-23   
gb|AJQ18906.1|  acidic ribosomal protein P0                             103   8e-23   
gb|AJQ18908.1|  acidic ribosomal protein P0                             103   9e-23   
ref|XP_007170980.1|  PREDICTED: 60S acidic ribosomal protein P0         103   1e-22   
sp|Q8NHW5.1|RLA0L_HUMAN  RecName: Full=60S acidic ribosomal prote...    103   1e-22   
ref|XP_006612127.1|  PREDICTED: 60S acidic ribosomal protein P0-like    103   1e-22   
ref|XP_623106.1|  PREDICTED: 60S acidic ribosomal protein P0 isof...    103   1e-22   
gb|AIW62441.1|  60S acidic ribosomal protein                            103   1e-22   
gb|AAL62465.1|  60S acidic ribosomal protein P0                         103   1e-22   
ref|XP_004396730.1|  PREDICTED: 60S acidic ribosomal protein P0         103   1e-22   
ref|XP_007513516.1|  60S acidic ribosomal protein P0                    103   1e-22   
gb|AER27808.1|  ribosomal protein P0                                    100   1e-22   
ref|XP_004996745.1|  arbp-prov protein                                  103   1e-22   
gb|AGX29497.1|  60S acidic ribosomal protein P0                         102   1e-22   
ref|XP_004464729.1|  PREDICTED: 60S acidic ribosomal protein P0         102   1e-22   
ref|NP_071797.1|  60S acidic ribosomal protein P0                       103   1e-22   
gb|EGV93157.1|  60S acidic ribosomal protein P0                         102   2e-22   
ref|XP_011157010.1|  PREDICTED: 60S acidic ribosomal protein P0         103   2e-22   
ref|XP_003398378.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    103   2e-22   
ref|XP_004315986.1|  PREDICTED: 60S acidic ribosomal protein P0         103   2e-22   
gb|KHN76000.1|  60S acidic ribosomal protein P0                         102   2e-22   
gb|KFP19329.1|  60S acidic ribosomal protein P0                         102   2e-22   
ref|XP_004281477.1|  PREDICTED: 60S acidic ribosomal protein P0         102   2e-22   
ref|XP_010635244.1|  PREDICTED: 60S acidic ribosomal protein P0-like    102   2e-22   
gb|EDL10286.1|  mCG121637                                               102   2e-22   
ref|XP_003488353.1|  PREDICTED: 60S acidic ribosomal protein P0-like    102   2e-22   
ref|XP_009641177.1|  PREDICTED: 60S acidic ribosomal protein P0         102   3e-22   
gb|EHJ75936.1|  ribosomal protein P0                                    102   3e-22   
dbj|BAD09642.1|  60S acidic ribosomal protein P0-like                 97.8    3e-22   
ref|XP_009083235.1|  PREDICTED: 60S acidic ribosomal protein P0         102   3e-22   
gb|EFX74249.1|  hypothetical protein DAPPUDRAFT_307348                  102   3e-22   
ref|XP_011266937.1|  PREDICTED: 60S acidic ribosomal protein P0         102   3e-22   
ref|XP_001958489.1|  GF10946                                            102   3e-22   
ref|XP_001985147.1|  GH14667                                            102   4e-22   
emb|CAD29995.1|  ribosomal P0 protein                                   102   4e-22   
ref|NP_001037123.1|  ribosomal protein P0                               102   4e-22   
ref|XP_009807426.1|  PREDICTED: 60S acidic ribosomal protein P0         101   4e-22   
ref|XP_006143355.1|  PREDICTED: 60S acidic ribosomal protein P0-like    102   4e-22   
ref|XP_007620795.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   4e-22   
ref|XP_006151600.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    102   4e-22   
ref|XP_005650079.1|  hypothetical protein COCSUDRAFT_52908              102   5e-22   
gb|AAF31449.1|AF220939_1  60S acidic ribosomal protein P0               101   5e-22   
gb|KFP74395.1|  60S acidic ribosomal protein P0                         101   5e-22   
gb|ELW63848.1|  60S acidic ribosomal protein P0                         101   6e-22   
ref|XP_004699568.1|  PREDICTED: 60S acidic ribosomal protein P0-like    100   6e-22   
ref|XP_002505583.1|  predicted protein                                  101   7e-22   
dbj|BAM18929.1|  ribosomal protein LP0                                  101   7e-22   
ref|XP_011402179.1|  60S acidic ribosomal protein P0-2                  100   8e-22   
ref|XP_002753119.1|  PREDICTED: 60S acidic ribosomal protein P0         101   8e-22   
ref|XP_002154455.2|  PREDICTED: 60S acidic ribosomal protein P0-like    101   8e-22   
gb|AHW80376.1|  ribosomol protein P0L10e                                101   8e-22   
gb|AAS49564.1|  ribosomal protein Large P0                              100   9e-22   
ref|XP_002114931.1|  expressed hypothetical protein                     100   9e-22   
ref|XP_003380825.1|  60S acidic ribosomal protein P0                    101   9e-22   
ref|XP_006151601.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    100   1e-21   
emb|CAX71185.1|  deoxyribonuclease                                      100   1e-21   
ref|XP_011278413.1|  PREDICTED: 60S acidic ribosomal protein P0-like  98.2    1e-21   
emb|CAX76652.1|  deoxyribonuclease                                      100   1e-21   
gb|ABG74704.1|  putative acidic p0 ribosomal protein                  99.4    1e-21   
ref|XP_007528636.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    100   1e-21   
gb|KFD51108.1|  hypothetical protein M513_08008                         100   1e-21   
ref|XP_001352888.1|  GA20389                                            100   1e-21   
ref|XP_001973718.1|  GG16244                                            100   1e-21   
ref|XP_002068394.1|  GK20443                                            100   1e-21   
gb|ABW90371.1|  putative ribosomal protein P0                         99.0    1e-21   
gb|AHW68492.1|  60S acidic ribosomal protein P0                         100   1e-21   
gb|KHJ98883.1|  ribosomal protein L10                                   102   1e-21   
emb|CAX76656.1|  deoxyribonuclease                                      100   1e-21   
ref|NP_524211.1|  ribosomal protein LP0, isoform A                      100   1e-21   
ref|XP_002040897.1|  GM22429                                            100   1e-21   



>emb|CDP14047.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   160 bits (405),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+EKFALGVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFALGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM INGYKNVL+IAVETDYSFP ADKVKEYL+DPSKF
Sbjct  241  PHMFINGYKNVLAIAVETDYSFPQADKVKEYLEDPSKF  278



>ref|XP_009791710.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana sylvestris]
Length=321

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+EKFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM  N YKNVL+IAVETDYSFPLADKVKEYL+DPSKF   AA   AAA   A  AAA  
Sbjct  241  PHMFTNAYKNVLAIAVETDYSFPLADKVKEYLEDPSKFTAVAAAPVAAAGSGAAPAAAKE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKK+EP EES+D+MGFSLFD
Sbjct  301  EEKKDEPAEESDDDMGFSLFD  321



>ref|XP_004239781.1| PREDICTED: 60S acidic ribosomal protein P0 [Solanum lycopersicum]
Length=321

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+EKFA+GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM  N YKNVL+IA+ETDYSFPLADKVKEYL DPSKFA  AA  AAAA   A  AAA  
Sbjct  241  PHMFTNAYKNVLAIAIETDYSFPLADKVKEYLADPSKFAAVAAAPAAAAGSGAAPAAAKE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP EES+D+MGFSLFD
Sbjct  301  EEKKEEPAEESDDDMGFSLFD  321



>ref|XP_009608105.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana tomentosiformis]
Length=320

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+EKFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM  N YKNVL+IAVETDYSFPLADKVKEYL+DPSKF
Sbjct  241  PHMFTNAYKNVLAIAVETDYSFPLADKVKEYLEDPSKF  278



>gb|AID52928.1| 60S acidic ribosomal protein P0 [Carthamus tinctorius]
Length=321

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VL+VYDNGSV SPEVLDLTEDDL+EKFALGVSMVTSL+LAI YPT+AAA
Sbjct  180  LGIRPFSYGLVVLTVYDNGSVFSPEVLDLTEDDLIEKFALGVSMVTSLALAIHYPTIAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHMLIN YKN L+IAVETDYSFPLADKVKEYL+DPSKF
Sbjct  240  PHMLINAYKNALAIAVETDYSFPLADKVKEYLEDPSKF  277



>ref|NP_001239676.1| uncharacterized protein LOC100777482 [Glycine max]
 gb|ACU20858.1| unknown [Glycine max]
 gb|KHN20859.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=319

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++AVETDYSFP ADKVKEYLKDPSKF
Sbjct  241  PHMFVNAYKNVLAVAVETDYSFPEADKVKEYLKDPSKF  278



>ref|NP_001238374.1| 60S acidic ribosomal protein P0 [Glycine max]
 sp|P50346.1|RLA0_SOYBN RecName: Full=60S acidic ribosomal protein P0 [Glycine max]
 gb|AAB63814.1| acidic ribosomal protein P0 [Glycine max]
Length=320

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+ KFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIGKFAAGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++AVETDYSFP ADKVKEYLKDPSKF
Sbjct  241  PHMFVNAYKNVLAVAVETDYSFPEADKVKEYLKDPSKF  278



>ref|NP_001275012.1| 60S acidic ribosomal protein P0-like [Solanum tuberosum]
 gb|ABB29933.1| P0 ribosomal protein-like [Solanum tuberosum]
 gb|ABB87111.1| P0 ribosomal protein-like [Solanum tuberosum]
Length=320

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V+SVYDNGSV SPEVLDLTEDDL+EKFA+GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVVSVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM  N YKNVL+IAVETDYSFPLADKVKEYL DPSKF
Sbjct  241  PHMFTNAYKNVLAIAVETDYSFPLADKVKEYLADPSKF  278



>emb|CAN76468.1| hypothetical protein VITISV_030042 [Vitis vinifera]
Length=303

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTE+DL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  164  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFAAGVSMVTSLSLAISYPTLAAA  223

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKNVL++AV T+YSFP ADKVKEYLKDPSKF   A     A+   A  AA+  
Sbjct  224  PHMFINAYKNVLAVAVATEYSFPQADKVKEYLKDPSKF-AVATAPVTASDAGAAPAASKE  282

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP+EES+D+MGFSLFD
Sbjct  283  EEKKEEPQEESDDDMGFSLFD  303



>ref|XP_011076719.1| PREDICTED: 60S acidic ribosomal protein P0 [Sesamum indicum]
Length=321

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V+SVYDNGSV SPEVLDLTEDDL+EKFA+GVSMVTSLSLAI+YPTLAAA
Sbjct  181  LGIRPFSYGLVVISVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLSLAIAYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKNVL++AV TDYSFP ADKVKEYL DPSKFAVAAA  AAA +G+APAAAA  
Sbjct  241  PHMFINAYKNVLAVAVATDYSFPQADKVKEYLADPSKFAVAAAAAAAADSGAAPAAAAKE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKK+EP EES+D+MGFSLFD
Sbjct  301  EEKKDEPAEESDDDMGFSLFD  321



>emb|CBI31491.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTE+DL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  153  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLMEKFAAGVSMVTSLSLAISYPTLAAA  212

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVLS+AV TDYSFP ADKVKE+LKDPSKF
Sbjct  213  PHMFVNAYKNVLSVAVATDYSFPQADKVKEFLKDPSKF  250



>emb|CBI25508.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTE+DL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  153  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFAAGVSMVTSLSLAISYPTLAAA  212

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKNVL++AV T+YSFP ADKVKEYLKDPSKF   A     A+   A  AA+  
Sbjct  213  PHMFINAYKNVLAVAVATEYSFPQADKVKEYLKDPSKF-AVATAPVTASDAGAAPAASKE  271

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP+EES+D+MGFSLFD
Sbjct  272  EEKKEEPQEESDDDMGFSLFD  292



>gb|KJB74261.1| hypothetical protein B456_011G283700 [Gossypium raimondii]
Length=321

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFATGVSMVTALSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM INGYKN+L++AV T+YSFP ADKVKEYL DPSKFAVAAAPVAAA  G+APAAA A 
Sbjct  241  PHMFINGYKNILAVAVATEYSFPQADKVKEYLADPSKFAVAAAPVAAAGGGAAPAAAPAE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKK EPEEES+D+MGFSLFD
Sbjct  301  EEKKPEPEEESDDDMGFSLFD  321



>ref|XP_004149240.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
 gb|KGN50643.1| 60S acidic ribosomal protein PO [Cucumis sativus]
Length=320

 Score =   152 bits (385),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 127/141 (90%), Gaps = 1/141 (1%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SP+VLDLTEDDLLEKFALGVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPQVLDLTEDDLLEKFALGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHMLIN YKN+L++AV TDYSFP A+KVKEYL DPSKF   A  V++A +GSAP AAAA 
Sbjct  241  PHMLINAYKNLLAVAVATDYSFPQAEKVKEYLADPSKF-AVAVAVSSADSGSAPEAAAAV  299

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP EES+D+MGFSLFD
Sbjct  300  EEKKEEPAEESDDDMGFSLFD  320



>gb|KHG25462.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   152 bits (385),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFASGVSMVTALSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM INGYKNVL++AV T+YSFP ADKVKEYL DPSKFAVAAAPVA    G+APAAA A 
Sbjct  241  PHMFINGYKNVLAVAVATEYSFPQADKVKEYLADPSKFAVAAAPVAGGGGGAAPAAAPAE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKK EPEEES+D+MGFSLFD
Sbjct  301  EEKKPEPEEESDDDMGFSLFD  321



>gb|KJB78787.1| hypothetical protein B456_013G019000 [Gossypium raimondii]
Length=321

 Score =   152 bits (385),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTE+DL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFATGVSMVTALSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKNVLS+AV T+YSFP ADKVKEYL DPSKFAVA A VA  A  +  AAAAAA
Sbjct  241  PHMFINAYKNVLSVAVATEYSFPQADKVKEYLADPSKFAVAVAAVATDAGAAPAAAAAAA  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKK EPEEES+D+MGFSLFD
Sbjct  301  EEKKPEPEEESDDDMGFSLFD  321



>gb|KHG08087.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   152 bits (385),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTE+DL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFATGVSMVTALSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKNVLS+AV T+YSFP ADKVKEYL DPSKFAVA A VA  A  +   A AAA
Sbjct  241  PHMFINAYKNVLSVAVATEYSFPQADKVKEYLADPSKFAVAVAAVATDAGAAQATATAAA  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKK EPEEES+D+MGFSLFD
Sbjct  301  EEKKPEPEEESDDDMGFSLFD  321



>ref|XP_002276842.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   152 bits (385),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTE+DL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLMEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVLS+AV TDYSFP ADKVKE+LKDPSKF
Sbjct  241  PHMFVNAYKNVLSVAVATDYSFPQADKVKEFLKDPSKF  278



>ref|XP_002268645.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTE+DL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKNVL++AV T+YSFP ADKVKEYLKDPSKF   A     A+   A  AA+  
Sbjct  241  PHMFINAYKNVLAVAVATEYSFPQADKVKEYLKDPSKF-AVATAPVTASDAGAAPAASKE  299

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP+EES+D+MGFSLFD
Sbjct  300  EEKKEEPQEESDDDMGFSLFD  320



>ref|XP_004490967.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV +PEVLDLTED L+EKFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFTPEVLDLTEDALIEKFAIGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM +N YKNVL++AV T+YSFP ADKVKE+LKDPSKFAVAA    AA +G+APAAAA  
Sbjct  241  PHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPSKFAVAAVATPAADSGAAPAAAAKE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKK+EP EES+D+MGFSLFD
Sbjct  301  EEKKDEPAEESDDDMGFSLFD  321



>ref|XP_004490966.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV +PEVLDLTED L+EKFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFTPEVLDLTEDALIEKFAIGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM +N YKNVL++AV T+YSFP ADKVKE+LKDPSKFAVAA    AA +G+APAAAA  
Sbjct  241  PHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPSKFAVAAVAAPAADSGAAPAAAAKE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKK+EP EES+D+MGFSLFD
Sbjct  301  EEKKDEPAEESDDDMGFSLFD  321



>ref|XP_004165071.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
Length=320

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 126/141 (89%), Gaps = 1/141 (1%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SP+VLDLTEDDLLEKFALGVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPQVLDLTEDDLLEKFALGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHMLIN YKN+L++AV TDYSFP A+KVKEYL DPSKF   A  V+AA +GSAP AAA  
Sbjct  241  PHMLINAYKNLLAVAVATDYSFPQAEKVKEYLADPSKF-AVAVAVSAADSGSAPEAAADV  299

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP EES+D+MGFSLFD
Sbjct  300  EEKKEEPAEESDDDMGFSLFD  320



>ref|XP_007157498.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
 gb|ESW29492.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
Length=321

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+EKF  GVS+VTSLSLAIS+PTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFVSGVSIVTSLSLAISFPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM +N YKNVLS+AVETDYS+P ADKVKEYLKDPSKFAVAA    AAA+G+  AAAA  
Sbjct  241  PHMFVNAYKNVLSVAVETDYSYPEADKVKEYLKDPSKFAVAATVAPAAASGAPAAAAAKE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP EES+D+MGFSLFD
Sbjct  301  EEKKEEPAEESDDDMGFSLFD  321



>gb|EYU18304.1| hypothetical protein MIMGU_mgv1a010092mg [Erythranthe guttata]
Length=322

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VL VYDNGSV SPEVLDLTEDDL+ KFA+GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLKVYDNGSVFSPEVLDLTEDDLVGKFAMGVSMVTSLALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++AV TDYSFPLADKVKEYL DPSKF
Sbjct  241  PHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  278



>gb|KJB76158.1| hypothetical protein B456_012G076000 [Gossypium raimondii]
Length=315

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIVLSVYDNGSV SPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  176  LGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDDLIEKFATGVSMVTALSLAISYPTLAAA  235

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM INGYKNVL++AV T+YSFP ADKVKEYL DPSKF
Sbjct  236  PHMFINGYKNVLAVAVATEYSFPQADKVKEYLADPSKF  273



>gb|KJB76159.1| hypothetical protein B456_012G076000 [Gossypium raimondii]
Length=320

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIVLSVYDNGSV SPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDDLIEKFATGVSMVTALSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM INGYKNVL++AV T+YSFP ADKVKEYL DPSKF
Sbjct  241  PHMFINGYKNVLAVAVATEYSFPQADKVKEYLADPSKF  278



>ref|XP_008463223.1| PREDICTED: 60S acidic ribosomal protein P0 [Cucumis melo]
Length=320

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SP+VLDLTEDDLLEKFALGVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPQVLDLTEDDLLEKFALGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHMLIN YKN+L++AV TDYSFP A+KVKEYL DPSKF
Sbjct  241  PHMLINAYKNLLAVAVATDYSFPEAEKVKEYLADPSKF  278



>ref|XP_010067511.1| PREDICTED: 60S acidic ribosomal protein P0 [Eucalyptus grandis]
 gb|KCW65656.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=320

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTEDDL+EKFALGVSMVT+LSLAISYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLMEKFALGVSMVTALSLAISYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKNVL++AVET+YS+P AD+VKE+LKDPSKFAVA AP  AA +G+APAAAA  
Sbjct  240  PHMFINAYKNVLAVAVETEYSYPHADEVKEFLKDPSKFAVAVAPAGAADSGAAPAAAAKE  299

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKK+EP EES+D+MGFSLFD
Sbjct  300  EEKKDEPAEESDDDMGFSLFD  320



>emb|CAN80537.1| hypothetical protein VITISV_003812 [Vitis vinifera]
Length=320

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTE+DL+EKFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLMEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVLS+AV T+YSFP ADKVKE+LKDPSKF
Sbjct  241  PHMFVNAYKNVLSVAVATEYSFPQADKVKEFLKDPSKF  278



>ref|XP_007153264.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
 gb|ESW25258.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
Length=320

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDLLEKFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLLEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKN+LS+A+ TDYSFP ADKVKEYLKDPSKF
Sbjct  241  PHMFVNAYKNLLSVAIATDYSFPEADKVKEYLKDPSKF  278



>gb|AGV54296.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDLLEKFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLLEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKN+LS+A+ TDYSFP ADKVKEYLKDPSKF
Sbjct  241  PHMFVNAYKNLLSVAIATDYSFPEADKVKEYLKDPSKF  278



>ref|XP_010689885.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=321

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL + SVYDNGSV SPEVLDLTE+DLL KFA GVSMVTSL LAISYPTLAAA
Sbjct  181  LGIRPFSYGLAIESVYDNGSVFSPEVLDLTEEDLLAKFASGVSMVTSLCLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM INGYKNVL+IA+ETDY FP A+KVKEYLKDPSKFAVAA    AAAA    AAAA  
Sbjct  241  PHMFINGYKNVLAIALETDYDFPEAEKVKEYLKDPSKFAVAAPAAGAAAASGGGAAAAKE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP EES+D+MGFSLFD
Sbjct  301  EEKKEEPAEESDDDMGFSLFD  321



>gb|EYU43502.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=242

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYDNGSV SPEVLDLTEDDL+ KFA+GVSMVTSL+LAISYPTLAAA
Sbjct  101  LGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDDLIVKFAMGVSMVTSLALAISYPTLAAA  160

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++AV TDYSFPLADKVKEYL DPSKF
Sbjct  161  PHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  198



>gb|EYU19990.1| hypothetical protein MIMGU_mgv1a0100892mg, partial [Erythranthe 
guttata]
Length=213

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYDNGSV SPEVLDLTEDDL+ KFA+GVSMVTSL+LAISYPTLAAA
Sbjct  72   LGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDDLIGKFAMGVSMVTSLALAISYPTLAAA  131

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++AV TDYSFPLADKVKEYL DPSKF
Sbjct  132  PHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  169



>gb|AFK39880.1| unknown [Medicago truncatula]
Length=323

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL+ AV T+YSFP ADKVKEYLKDPSKF
Sbjct  241  PHMFVNAYKNVLAFAVATEYSFPEADKVKEYLKDPSKF  278



>ref|XP_003603496.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES73747.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL+ AV T+YSFP ADKVKEYLKDPSKF
Sbjct  241  PHMFVNAYKNVLAFAVATEYSFPEADKVKEYLKDPSKF  278



>ref|XP_004501267.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=322

 Score =   150 bits (378),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTED L+EKFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDALIEKFAIGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHML+N YKNVL++AV T+YS P ADKVKEYLKDPSKF
Sbjct  241  PHMLVNAYKNVLAVAVATEYSSPEADKVKEYLKDPSKF  278



>gb|EYU43500.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=322

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYDNGSV SPEVLDLTEDDL+ KFA+GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDDLIVKFAMGVSMVTSLALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++AV TDYSFPLADKVKEYL DPSKF
Sbjct  241  PHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  278



>gb|EYU43501.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=321

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYDNGSV SPEVLDLTEDDL+ KFA+GVSMVTSL+LAISYPTLAAA
Sbjct  180  LGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDDLIVKFAMGVSMVTSLALAISYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++AV TDYSFPLADKVKEYL DPSKF
Sbjct  240  PHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  277



>ref|XP_010534571.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=321

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIV SVYDNGSV SPEVLDLTEDDL+EKFA GVSMVT+LSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLIVQSVYDNGSVFSPEVLDLTEDDLMEKFAAGVSMVTALSLAVSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKNVL++AV T+Y+FP A+KVKEYLKDPSKFAVAAA       G+APAAAA  
Sbjct  241  PHMFINAYKNVLAVAVATEYTFPQAEKVKEYLKDPSKFAVAAASAGGETGGAAPAAAAKE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP EES+D+MGFSLFD
Sbjct  301  EEKKEEPAEESDDDMGFSLFD  321



>dbj|BAE71263.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
 dbj|BAE71276.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
Length=321

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L IRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LAIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVLSIAV T+YSFP ADKVKE+LKDPSKF
Sbjct  241  PHMFVNAYKNVLSIAVVTEYSFPEADKVKEFLKDPSKF  278



>ref|XP_003616595.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES99553.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV +PEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFNPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++AV T+YSFP ADKVKE+LKDPSKF
Sbjct  241  PHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPSKF  278



>gb|AFK46889.1| unknown [Medicago truncatula]
Length=323

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV +PEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFNPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++AV T+YSFP ADKVKE+LKDPSKF
Sbjct  241  PHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPSKF  278



>ref|XP_011072152.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=330

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIVLSVY++GSV SPEVLDLTEDDL+EKFA+GVSMV SLSLAI+YPTLAAA
Sbjct  181  LGIRPFSYGLIVLSVYESGSVFSPEVLDLTEDDLVEKFAMGVSMVASLSLAITYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN+LS+AVETDYSFP ADKVKEYL DPSKF
Sbjct  241  PHMFINAYKNLLSVAVETDYSFPQADKVKEYLADPSKF  278



>ref|XP_009399833.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLI+LSVYDNGSV SPEVLDLTEDDL+EKFA GVSMVTSLSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLIILSVYDNGSVFSPEVLDLTEDDLIEKFAAGVSMVTSLSLAVSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKNVL++A+ T+Y+FP A+K+KEYLKDPSKF  A A        +A  AAA A
Sbjct  241  PHMFINAYKNVLAVAIATEYTFPQAEKIKEYLKDPSKF--AVAATPVTEEAAAAPAAAPA  298

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP EES+D+MGFSLFD
Sbjct  299  EEKKEEPAEESDDDMGFSLFD  319



>ref|XP_004247949.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=320

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V+SVYDNGSV SP+VLDLT++DL+EKFA GV+M+T+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVISVYDNGSVFSPQVLDLTDEDLVEKFAAGVTMITTLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM++NGYKNVL +AVET+Y++P A +VKEYLKDPSKF
Sbjct  241  PHMIVNGYKNVLGVAVETEYTYPQAQQVKEYLKDPSKF  278



>gb|ACJ84880.1| unknown [Medicago truncatula]
Length=323

 Score =   147 bits (371),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGI PFSYGL+VLSVYDNGSV SPEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGITPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL+ AV T+YSFP ADKVKEYLKDPSKF
Sbjct  241  PHMFVNAYKNVLAFAVATEYSFPEADKVKEYLKDPSKF  278



>ref|XP_007009052.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
 gb|EOY17862.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
Length=321

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  182  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVEKFAAGVSMVTALSLAISYPTLAAA  241

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++A+ T+YSFP ADKVKEYL DPSKF
Sbjct  242  PHMFINAYKNVLALAIATEYSFPQADKVKEYLADPSKF  279



>ref|XP_007009051.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
 gb|EOY17861.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
Length=320

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVEKFAAGVSMVTALSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++A+ T+YSFP ADKVKEYL DPSKF
Sbjct  241  PHMFINAYKNVLALAIATEYSFPQADKVKEYLADPSKF  278



>ref|XP_004972933.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 119/142 (84%), Gaps = 3/142 (2%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL +++VY++GSV SPEVLDLTEDDL+EKFA GVSMV SLSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLQIVNVYEDGSVFSPEVLDLTEDDLVEKFATGVSMVASLSLALSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF   A     AA GS  AAA   
Sbjct  241  PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF---AVAAPVAAVGSGAAAAPKE  297

Query  299  eekkeepeeesEDEMGFSLFDD  234
            EEK  EP EES++EMGFSLFDD
Sbjct  298  EEKAPEPAEESDEEMGFSLFDD  319



>ref|XP_011042597.1| PREDICTED: 60S acidic ribosomal protein P0-like [Populus euphratica]
Length=321

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIVLSVYDNGSV SP VLDLTEDDL+EKFA G++M+TSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLIVLSVYDNGSVFSPTVLDLTEDDLVEKFATGIAMITSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKN+L++AV T+YS+P A++VKE+LKDPSKFAVAA P AAAAA     AAA  
Sbjct  241  PHMFINAYKNILAVAVATEYSYPQAEEVKEFLKDPSKFAVAAVPAAAAAAPGGAPAAAKE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP EES+D+MGFSLFD
Sbjct  301  EEKKEEPAEESDDDMGFSLFD  321



>gb|EMS52841.1| 60S acidic ribosomal protein P0 [Triticum urartu]
Length=263

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTE+DL+EKFA GVSMV SLSLA+SYPTLAAA
Sbjct  123  LGIRPFSYGLVITNVYDDGSVFSPEVLDLTEEDLMEKFACGVSMVASLSLAVSYPTLAAA  182

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +NGYKNVL++AVET+YSFP AD++KEYLKDPSKF
Sbjct  183  PHMFLNGYKNVLALAVETEYSFPHADQIKEYLKDPSKF  220



>ref|XP_002526873.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF35504.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=320

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIVLSVYDNGSV SPEVLDLTEDDL+ KFA+GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDDLIGKFAIGVSMVTSLALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV T+Y+FP A+KVKEYL+DPSKF
Sbjct  241  PHMFINAYKNALAIAVATEYTFPQAEKVKEYLEDPSKF  278



>gb|KDP44812.1| hypothetical protein JCGZ_01312 [Jatropha curcas]
Length=321

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+EKFA GVSMVTSL+LA+SYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVEKFATGVSMVTSLALAVSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            P+M IN YKNVL+++V TDY+FP A+KVKEYL+DPSKFAVAAAPVAAA AG+APAAAA  
Sbjct  241  PYMFINAYKNVLAVSVATDYTFPQAEKVKEYLEDPSKFAVAAAPVAAATAGAAPAAAAKE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP EES+D+MGFSLFD
Sbjct  301  EEKKEEPAEESDDDMGFSLFD  321



>ref|XP_010534676.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=320

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIV SVYDNGSV SPEVLDLTEDDL+EKFA GVSMVT+L+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLIVESVYDNGSVFSPEVLDLTEDDLMEKFAAGVSMVTALALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKNVLS+A+ T+YSFP A+KVKE+LKDPSKFAVAAAPVA  A G+APAAAA  
Sbjct  240  PHMFINAYKNVLSVALATEYSFPQAEKVKEFLKDPSKFAVAAAPVAGNAGGAAPAAAAKE  299

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP EES+D+MGFSLFD
Sbjct  300  EEKKEEPAEESDDDMGFSLFD  320



>ref|XP_009389889.1| PREDICTED: 60S acidic ribosomal protein P0 [Musa acuminata subsp. 
malaccensis]
Length=319

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++LSVYDNGSV SPEVLDL+EDDL+EKFA G+SMVTSLSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLVILSVYDNGSVFSPEVLDLSEDDLIEKFAAGISMVTSLSLAVSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++A+ T+Y+FP A+KVKEYLKDPSKF
Sbjct  241  PHMFINAYKNVLAVAIATEYTFPQAEKVKEYLKDPSKF  278



>gb|ACL52455.1| unknown [Zea mays]
Length=319

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 119/142 (84%), Gaps = 3/142 (2%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL V SVY++GSV SPEVLDL+E+DL+EKFA GVSMV SLSLA+SYPTLAA 
Sbjct  181  LGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLALSYPTLAAV  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF   A    AAAA S+ AAA   
Sbjct  241  PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF---AVAAPAAAADSSAAAAPKE  297

Query  299  eekkeepeeesEDEMGFSLFDD  234
            EEK  EP EES++EMGFSLFDD
Sbjct  298  EEKAPEPAEESDEEMGFSLFDD  319



>ref|NP_001141489.1| hypothetical protein [Zea mays]
 gb|ACF86473.1| unknown [Zea mays]
 gb|AFW61287.1| hypothetical protein ZEAMMB73_391125 [Zea mays]
Length=319

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 118/142 (83%), Gaps = 3/142 (2%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL V SVY++GSV SPEVLDL+E+DL+EKFA GVSMV SLSLA+SYPTLAA 
Sbjct  181  LGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLALSYPTLAAV  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF   A     AAA S+ AAA   
Sbjct  241  PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF---AVAAPVAAADSSAAAAPKE  297

Query  299  eekkeepeeesEDEMGFSLFDD  234
            EEK  EP EES++EMGFSLFDD
Sbjct  298  EEKAPEPAEESDEEMGFSLFDD  319



>gb|ABK95701.1| unknown [Populus trichocarpa]
Length=322

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SP VLDLTEDDL+EKFA G++M+TSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPTVLDLTEDDLVEKFATGITMITSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHMLIN YKN+LS+AV T+YS+P A++VKE+LKDPSKF
Sbjct  241  PHMLINAYKNILSVAVATEYSYPQAEEVKEFLKDPSKF  278



>ref|XP_010486703.1| PREDICTED: 60S acidic ribosomal protein P0-3 [Camelina sativa]
Length=323

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL+IAV TDY+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNVLAIAVATDYTFPQAEKVKEFLKDPSKF  277



>ref|XP_010486773.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL+IAV TDY+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNVLAIAVATDYTFPQAEKVKEFLKDPSKF  277



>gb|AFK38760.1| unknown [Lotus japonicus]
Length=322

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+ KFA+GVSMVT+LSLAIS+PTLAAA
Sbjct  180  LGIRPFSYGLVVLSVYDNGSVLSPEVLDLTEDDLVGKFAIGVSMVTALSLAISFPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKN+L++A+ T+YSFP AD+VKEYLKDPSKF
Sbjct  240  PHMFVNAYKNILAVALATEYSFPQADEVKEYLKDPSKF  277



>ref|XP_004958562.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL V++VY++GSV SPEVLDLTE+DL+EKFA GVSMV SLSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLQVINVYEDGSVFSPEVLDLTEEDLIEKFATGVSMVASLSLALSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF
Sbjct  241  PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>gb|AAD56335.1|AC009326_22 putative 60S acidic ribosomal protein, 5' partial [Arabidopsis 
thaliana]
Length=230

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  90   LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  149

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV T+Y+FP A+KVKEYLKDPSKF
Sbjct  150  PHMFINAYKNALAIAVATEYTFPQAEKVKEYLKDPSKF  187



>ref|XP_009764939.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=323

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+++SVYDNGSV SPEVL+LTEDDL+EKFA GVSMVT+LSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLVMVSVYDNGSVFSPEVLELTEDDLMEKFATGVSMVTTLSLAVSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            P+M + GY+NVL++AVETDYS+P AD+VKEYLKDPSKF
Sbjct  241  PYMFVKGYENVLAVAVETDYSYPQADQVKEYLKDPSKF  278



>gb|EPS69246.1| p0 ribosomal protein-like protein, partial [Genlisea aurea]
Length=329

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIV  VYDNGSV SPEVL+LTEDDL+EKFA G+SMVT+LSL ISYPTLAAA
Sbjct  188  LGIRPFSYGLIVTIVYDNGSVFSPEVLNLTEDDLIEKFASGISMVTALSLGISYPTLAAA  247

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVLS+A+ETDYSFP ADKVKEYL DPSKF
Sbjct  248  PHMFINAYKNVLSLALETDYSFPQADKVKEYLADPSKF  285



>ref|XP_010554654.1| PREDICTED: 60S acidic ribosomal protein P0 [Tarenaya hassleriana]
Length=320

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIV SVYDNGSV SPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLIVQSVYDNGSVFSPEVLDLTEDDLMEKFAAGVSMVTALSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKNVL++A+ T+Y+FP A+KVKEYLKDPSK    AA ++A   G+APAAA+  
Sbjct  241  PHMFINAYKNVLAVAIATEYTFPQAEKVKEYLKDPSKL-AVAAAMSAGDGGAAPAAASKE  299

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP EES+D+MGFSLFD
Sbjct  300  EEKKEEPAEESDDDMGFSLFD  320



>gb|ACF83717.1| unknown [Zea mays]
 gb|AFW74477.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL V SVY++GSV SPEVLDL+E+DL+EKFA GVSMV SLSLAISYPTLAA 
Sbjct  181  LGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLAISYPTLAAV  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF
Sbjct  241  PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>ref|NP_001105482.1| 60S acidic ribosomal protein P0 [Zea mays]
 sp|O24573.3|RLA0_MAIZE RecName: Full=60S acidic ribosomal protein P0 [Zea mays]
 emb|CAA69256.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL V SVY++GSV SPEVLDL+E+DL+EKFA GVSMV SLSLAISYPTLAA 
Sbjct  181  LGIRPFSYGLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLAISYPTLAAV  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF
Sbjct  241  PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>gb|KHG25720.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=320

 Score =   145 bits (365),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+EKFA GVSMVT+LSLAISYPTLAA 
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFASGVSMVTALSLAISYPTLAAV  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM INGYKNVL++AV T+YSF  ADKVKEYL DPSKF
Sbjct  241  PHMFINGYKNVLAVAVATEYSFRQADKVKEYLADPSKF  278



>ref|XP_006360336.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=320

 Score =   145 bits (365),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V+SVYDNGSV SPEVLDLT++DL+EKFA GV+M+T+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVISVYDNGSVFSPEVLDLTDEDLVEKFAAGVAMMTTLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM++NGYKNVL +A+ET+Y++P A +VKEYLKDPSKF
Sbjct  241  PHMIVNGYKNVLCVALETEYTYPQAQQVKEYLKDPSKF  278



>ref|NP_001078125.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 gb|AEE74737.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=287

 Score =   144 bits (362),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  147  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  206

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV T+Y+FP A+KVKEYLKDPSKF
Sbjct  207  PHMFINAYKNALAIAVATEYTFPQAEKVKEYLKDPSKF  244



>ref|XP_009619762.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=323

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V+SVYDNGSV SPEVLDLTEDDL+EKFA GVSMVT+LSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLVVVSVYDNGSVFSPEVLDLTEDDLMEKFATGVSMVTTLSLAVSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            P+M + GYKNVL++ VET+YS+P AD+VKEYLKDPSKF
Sbjct  241  PYMFVKGYKNVLAVTVETEYSYPQADQVKEYLKDPSKF  278



>gb|EMT02739.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=322

 Score =   144 bits (364),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VY +GSV SPEVLDLTE+DL+EKFA GVSMV SLSLA+SYPTLAAA
Sbjct  182  LGIRPFSYGLVITNVYGDGSVFSPEVLDLTEEDLMEKFACGVSMVASLSLAVSYPTLAAA  241

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +NGYKNVL++AVETDYSFP AD++KEYLKDPSKF
Sbjct  242  PHMFLNGYKNVLALAVETDYSFPHADQIKEYLKDPSKF  279



>ref|XP_006298124.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
 gb|EOA31022.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
Length=323

 Score =   144 bits (364),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV TDY+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKF  277



>gb|ADE76171.1| unknown [Picea sitchensis]
Length=266

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV  PEVLDLTEDDL+EKFA G+S VT+LSLAISYPT+AA 
Sbjct  126  LGIRPFSYGLVVQSVYDNGSVFDPEVLDLTEDDLIEKFAAGISTVTALSLAISYPTIAAV  185

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PH +INGYKNVL+IA+E DYSFPLA+KVKEYLKDPSKFAVAAAPVA+A   +  AAA   
Sbjct  186  PHAIINGYKNVLAIAIELDYSFPLAEKVKEYLKDPSKFAVAAAPVASATEAAPAAAAPKE  245

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKK EPEEESE++MGFSLFD
Sbjct  246  EEKKPEPEEESEEDMGFSLFD  266



>ref|XP_009409427.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++LSVYDNGSV SPEVLDLTEDDL+EKFA GVS+VTSLSLAISYPTL AA
Sbjct  181  LGIRPFSYGLVILSVYDNGSVFSPEVLDLTEDDLIEKFAAGVSLVTSLSLAISYPTLVAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++A+ T+YSFP A+KVKEYLKDPSKF
Sbjct  241  PHMFINAYKNVLAVAIATEYSFPHAEKVKEYLKDPSKF  278



>ref|XP_010464828.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV TDY+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKF  277



>ref|XP_002312149.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEE89516.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=322

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SP VLDLTEDDL+EKFA G++M+TSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPTVLDLTEDDLVEKFATGITMITSLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN+LS+AV T+YS+P A++VKE+LKDPSKF
Sbjct  241  PHMFINAYKNILSVAVATEYSYPQAEEVKEFLKDPSKF  278



>ref|NP_187734.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
 sp|P57691.1|RLA03_ARATH RecName: Full=60S acidic ribosomal protein P0-3 [Arabidopsis 
thaliana]
 gb|AAG50973.1|AC073395_15 60S acidic ribosomal protein, putative; 58619-59992 [Arabidopsis 
thaliana]
 gb|AAL07229.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AAM14140.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AEE75020.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
Length=323

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV TDY+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKF  277



>ref|XP_002882720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=323

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV TDY+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKF  277



>gb|EEC82854.1| hypothetical protein OsI_27702 [Oryza sativa Indica Group]
Length=216

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTEDDL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  78   LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEDDLMEKFASGVSMVASVSLAISYPTIAAA  137

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  138  PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  175



>ref|NP_187531.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 sp|Q42112.2|RLA02_ARATH RecName: Full=60S acidic ribosomal protein P0-2 [Arabidopsis 
thaliana]
 gb|AAF14020.1|AC011436_4 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAK44040.1|AF370225_1 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAL15223.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEE74736.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=320

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV T+Y+FP A+KVKEYLKDPSKF
Sbjct  240  PHMFINAYKNALAIAVATEYTFPQAEKVKEYLKDPSKF  277



>gb|AAM63644.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
Length=320

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV T+Y+FP A+KVKEYLKDPSKF
Sbjct  240  PHMFINAYKNALAIAVATEYTFPQAEKVKEYLKDPSKF  277



>gb|ADR71236.1| 60S acidic ribosomal protein P0B [Hevea brasiliensis]
Length=320

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLS YDNGSV SPEVLDLTEDDL+EKFA GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLVEKFATGVSMVTSLALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL+IAV T+YSFP A+ V+EYLKDPSKF
Sbjct  241  PHMFVNAYKNVLAIAVATEYSFPRAETVREYLKDPSKF  278



>gb|ADR71235.1| 60S acidic ribosomal protein P0A [Hevea brasiliensis]
Length=320

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLS YDNGSV SPEVLDLTEDDL+EKFA GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLVEKFATGVSMVTSLALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL+IAV T+YSFP A+ V+EYLKDPSKF
Sbjct  241  PHMFVNAYKNVLAIAVATEYSFPRAETVREYLKDPSKF  278



>ref|XP_002445000.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
 gb|EES14495.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
Length=319

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL V +VY++GSV SPEVLDL+E+DL+EKFA GVSMV SLSLAISYPTLAA 
Sbjct  181  LGIRPFSYGLQVTNVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLAISYPTLAAV  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM INGYKNVL++AVETDYS+P ADK+KEYLKDPSKF
Sbjct  241  PHMFINGYKNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>ref|XP_006848156.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
 gb|ERN09737.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
Length=322

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTE+DL+EKF +GVSMVT+LSL+ISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFDIGVSMVTALSLSISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM INGYKN L+IAV TDY+F  A++VKEYLKDP+KF
Sbjct  241  PHMFINGYKNALAIAVATDYTFAQAEQVKEYLKDPTKF  278



>ref|XP_010234277.1| PREDICTED: 60S acidic ribosomal protein P0 [Brachypodium distachyon]
Length=321

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTE+DL++KFA GVSMV SLSLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVINNVYDSGSVFSPEVLDLTEEDLMDKFASGVSMVASLSLAISYPTIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKNVL+IAVETDYS+P  DK+KEYLKDPSKFAVAA   AAA+ G+A AA    
Sbjct  241  PHMFINAYKNVLAIAVETDYSYPHGDKIKEYLKDPSKFAVAAPAAAAASGGAAAAAPKEE  300

Query  299  eekkeepeeesEDEMGFSLFDD  234
            E+K E  EE    EMGFSLFDD
Sbjct  301  EKKDEPEEESDG-EMGFSLFDD  321



>gb|ABR26209.1| 60S acidic ribosomal protein p0 [Oryza sativa Indica Group]
Length=238

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTEDDL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  100  LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEDDLMEKFASGVSMVASVSLAISYPTIAAA  159

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  160  PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  197



>gb|AAF34767.1|AF227622_1 60S acidic ribosomal protein PO [Euphorbia esula]
Length=317

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V +VYD+G+V SPEVL+LTEDDL+ KFA+GVSM+TSL+L++SYPTLAAA
Sbjct  178  LGIRPFSYGLVVQTVYDSGTVFSPEVLNLTEDDLMAKFAIGVSMITSLALSVSYPTLAAA  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL+IAV TDYSFP ADKVKEYL DPSKF
Sbjct  238  PHMFINAYKNVLAIAVSTDYSFPQADKVKEYLADPSKF  275



>ref|XP_002884720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=322

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LAISYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAISYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV T+Y+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_006659092.1| PREDICTED: 60S acidic ribosomal protein P0-like [Oryza brachyantha]
Length=319

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTE+DL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  241  PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>gb|EAZ41410.1| hypothetical protein OsJ_25932 [Oryza sativa Japonica Group]
Length=235

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTEDDL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  97   LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEDDLMEKFASGVSMVASVSLAISYPTIAAA  156

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  157  PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  194



>ref|XP_010486480.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV T+Y+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKF  277



>gb|ABA95724.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ19563.1| hypothetical protein OsJ_35136 [Oryza sativa Japonica Group]
Length=320

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTE+DL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  241  PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>gb|ABA91328.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAY79838.1| hypothetical protein OsI_34997 [Oryza sativa Indica Group]
 gb|EAZ41411.1| hypothetical protein OsJ_25933 [Oryza sativa Japonica Group]
Length=320

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTE+DL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  241  PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>gb|EAY82182.1| hypothetical protein OsI_37384 [Oryza sativa Indica Group]
 emb|CBX24392.1| hypothetical_protein [Oryza glaberrima]
Length=320

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTE+DL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  241  PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>emb|CBX25428.1| hypothetical_protein [Oryza glaberrima]
Length=322

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTE+DL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  183  LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAA  242

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  243  PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  280



>ref|XP_010469822.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV T+Y+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKF  277



>ref|NP_001060923.1| Os08g0130500 [Oryza sativa Japonica Group]
 sp|P41095.3|RLA0_ORYSJ RecName: Full=60S acidic ribosomal protein P0 [Oryza sativa Japonica 
Group]
 pdb|3J61|QQ Chain q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA04668.1| acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAC66723.1| 60S acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAF22837.1| Os08g0130500 [Oryza sativa Japonica Group]
 dbj|BAG89244.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTEDDL+EKFA GVSMV S+SLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEDDLMEKFASGVSMVASVSLAISYPTIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +NGYKNVL++AVET+YS+P ADK+KEYLKDPSKF
Sbjct  241  PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>ref|XP_006298147.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
 gb|EOA31045.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
Length=322

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV T+Y+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKF  277



>gb|AAM65265.1| 60S acidic ribosomal protein P0-C [Arabidopsis thaliana]
Length=323

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV T+Y+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAIAVATNYTFPQAEKVKEFLKDPSKF  277



>ref|XP_002440235.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
 gb|EES18665.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
Length=319

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 113/142 (80%), Gaps = 3/142 (2%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL +++VY++GSV SPEVLDLTE+DL+EKF+ GVSMV SLSL +SYPTLAAA
Sbjct  181  LGIRPFSYGLQIVNVYEDGSVFSPEVLDLTEEDLVEKFSAGVSMVASLSLVVSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM INGYKNVL++AVETDYS+P AD++KEYLKDPSKFAVAA   AA +  SA       
Sbjct  241  PHMFINGYKNVLAVAVETDYSYPHADEIKEYLKDPSKFAVAAPVAAADSGASAAPKEEEK  300

Query  299  eekkeepeeesEDEMGFSLFDD  234
              + +E  +    EMGFSLFDD
Sbjct  301  APESDEESDG---EMGFSLFDD  319



>emb|CDY67524.1| BnaAnng24540D [Brassica napus]
 emb|CDY67517.1| BnaAnng24470D [Brassica napus]
Length=222

 Score =   140 bits (352),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTEDDL++KFA G+SMVTSL+LAIS+PTLAAA
Sbjct  79   LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAA  138

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  139  PHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  176



>ref|XP_003573632.1| PREDICTED: 60S acidic ribosomal protein P0-like [Brachypodium 
distachyon]
Length=323

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++  VYD+GSV SPEVLDLTE+DL+E+FA GVSMV SLSLA+SYPT+AAA
Sbjct  184  LGIRPFSYGLVITQVYDDGSVFSPEVLDLTEEDLMERFASGVSMVASLSLAVSYPTMAAA  243

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +NGYKNVL++A+ETDYS+P AD++KEYLKDPSKF
Sbjct  244  PHMFLNGYKNVLAVALETDYSYPHADQIKEYLKDPSKF  281



>emb|CDY07906.1| BnaC03g36170D [Brassica napus]
Length=323

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTEDDL++KFA G+SMVTSL+LAIS+PTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+I V T+Y+FP A+KVKEYLKDPSKF
Sbjct  240  PHMFINAYKNALAICVATEYTFPQAEKVKEYLKDPSKF  277



>ref|XP_008779152.1| PREDICTED: 60S acidic ribosomal protein P0-like [Phoenix dactylifera]
Length=221

 Score =   139 bits (351),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLI+ SVYDNGSV SPEVLDLTEDDL+E+FA GVS+VTSLSLA+SYPT+AAA
Sbjct  82   LGIRPFSYGLIIQSVYDNGSVFSPEVLDLTEDDLVERFAAGVSIVTSLSLALSYPTIAAA  141

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++A+ T+Y+FP A+KVKE+LKDPSKF
Sbjct  142  PHMFINAYKNVLAVAIATEYTFPQAEKVKEFLKDPSKF  179



>ref|XP_010256605.1| PREDICTED: 60S acidic ribosomal protein P0 [Nelumbo nucifera]
Length=319

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLI+ SVYDNGSV SPEVLDLTEDDL+EKFA GVSM T+L+LA+SYP LAAA
Sbjct  181  LGIRPFSYGLIIQSVYDNGSVFSPEVLDLTEDDLVEKFAAGVSMATALALAVSYPMLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++AV TDYSFP A+KVKEYLKDPSKF
Sbjct  241  PHMFVNAYKNVLAVAVATDYSFPQAEKVKEYLKDPSKF  278



>gb|KFK36893.1| hypothetical protein AALP_AA4G185700 [Arabis alpina]
Length=318

 Score =   142 bits (357),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SP+VL+LTED L+EKFA+GVSM+T+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFSPDVLNLTEDSLVEKFAVGVSMITALSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++A+ T+YSFP A+ VKE+LKDPSKF
Sbjct  241  PHMFINAYKNVLAVALATEYSFPQAENVKEFLKDPSKF  278



>ref|XP_010464557.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
 ref|XP_010464558.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   142 bits (357),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTED L+EKFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+IAV T+Y+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAIAVVTEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_007016138.1| Ribosomal protein L10 family protein [Theobroma cacao]
 gb|EOY33757.1| Ribosomal protein L10 family protein [Theobroma cacao]
Length=321

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYD+GSV SPEVLDLTEDDL+EKFA GVSM  SLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDSGSVFSPEVLDLTEDDLVEKFANGVSMAASLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKN L++AV +DYSFP A+KVKEYLKDPSKF
Sbjct  241  PHMFVNAYKNALAVAVASDYSFPQAEKVKEYLKDPSKF  278



>ref|XP_006411245.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
 gb|ESQ52698.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
Length=317

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIV SVYDNGSV SPEVL+LTEDDL+EKFA GVS++T+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLIVESVYDNGSVFSPEVLNLTEDDLVEKFAAGVSLITALSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL+IA+ T+YSFP AD VKE+LKDPSKF
Sbjct  241  PHMFLNAYKNVLAIALATEYSFPQADNVKEFLKDPSKF  278



>gb|KHN36391.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=321

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L IRPFSYGL V+SVY+NGSV SPEVLDLTEDDL+ KFA GV MV+SLSLAISYP++AAA
Sbjct  181  LAIRPFSYGLAVVSVYENGSVFSPEVLDLTEDDLVVKFAEGVCMVSSLSLAISYPSIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM +N YKN+L++AV T+YSFP ADKVKEYLKDPSKFAVA     A  +G+APAAA+  
Sbjct  241  PHMFVNSYKNILAVAVATEYSFPEADKVKEYLKDPSKFAVAVVAAPATKSGAAPAAASKV  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEE  +ES+D+MGFSLFD
Sbjct  301  EEKKEEAADESDDDMGFSLFD  321



>gb|KFK38515.1| hypothetical protein AALP_AA3G123100 [Arabis alpina]
Length=324

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV  P+VL+LTED L+EKFA+G+SMVTSL+LAISYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFKPDVLNLTEDALVEKFAVGISMVTSLALAISYPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>gb|KHN34735.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=320

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L IRPFSYGL V+SVYDNGSV SPEVLDLTEDDL+ KFA GV MV+SLSLAISYP++AAA
Sbjct  181  LAIRPFSYGLAVVSVYDNGSVFSPEVLDLTEDDLVVKFAEGVCMVSSLSLAISYPSIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM +N YKN+L++AV T+YSFP ADKVKEYLKDPSKF   A   A A    A  AAA+ 
Sbjct  241  PHMFVNSYKNILAVAVATEYSFPEADKVKEYLKDPSKF-AVAVVAAPATKSGAAPAAASK  299

Query  299  eekkeepeeesEDEMGFSLFD  237
             E+K+E  +ES+D+MGFSLFD
Sbjct  300  VEEKKEEADESDDDMGFSLFD  320



>ref|XP_003538454.1| PREDICTED: 60S acidic ribosomal protein P0-like [Glycine max]
Length=320

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L IRPFSYGL V+SVYDNGSV SPEVLDLTEDDL+ KFA GV MV+SLSLAISYP++AAA
Sbjct  181  LAIRPFSYGLAVVSVYDNGSVFSPEVLDLTEDDLVVKFAEGVCMVSSLSLAISYPSIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM +N YKN+L++AV T+YSFP ADKVKEYLKDPSKF   A   A A    A  AAA+ 
Sbjct  241  PHMFVNSYKNILAVAVATEYSFPEADKVKEYLKDPSKF-AVAVVAAPATKSGAAPAAASK  299

Query  299  eekkeepeeesEDEMGFSLFD  237
             E+K+E  +ES+D+MGFSLFD
Sbjct  300  VEEKKEEADESDDDMGFSLFD  320



>emb|CDX73962.1| BnaA03g30850D [Brassica napus]
Length=323

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTEDDL++KFA G+SMVTSL+LAIS+PTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+I + T+Y+FP A+KVKEYLKDPSKF
Sbjct  240  PHMFINAYKNALAICIATEYTFPQAEKVKEYLKDPSKF  277



>ref|XP_007222847.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
 ref|XP_008222707.1| PREDICTED: 60S acidic ribosomal protein P0 [Prunus mume]
 gb|EMJ24046.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
Length=319

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V +VYDNGSV SPEVLDLTEDDL+ KFALGVSMVTSL+LAI+YPTLAAA
Sbjct  181  LGIRPFSYGLVVQTVYDNGSVFSPEVLDLTEDDLMVKFALGVSMVTSLALAIAYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++++ T+Y+FP A+KVKEYLKDPSKF
Sbjct  241  PHMFLNAYKNVLAVSLATEYTFPQAEKVKEYLKDPSKF  278



>emb|CDP16385.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LG+RPFSYGLIV +VY+NGSV SPEVLDLTEDDL  KF +G+SM TSLSL ISYP L+AA
Sbjct  181  LGVRPFSYGLIVQAVYENGSVFSPEVLDLTEDDLAVKFLVGLSMATSLSLEISYPALSAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHMLINGYKN L+IAVET+YSFP AD+VKEYLKDPSKF
Sbjct  241  PHMLINGYKNALAIAVETEYSFPQADEVKEYLKDPSKF  278



>emb|CDY53103.1| BnaCnng24330D [Brassica napus]
Length=323

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTEDDL++KFA G+SMVTSL+LAIS+PTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_009146942.1| PREDICTED: 60S acidic ribosomal protein P0-2 [Brassica rapa]
 emb|CDY44688.1| BnaA05g29180D [Brassica napus]
Length=323

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTEDDL++KFA G+SMVTSL+LAIS+PTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_009123454.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTEDDL++KFA G+SMVTSL+LAIS+PTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>dbj|BAJ92405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTE+DL++KFA GVSMV SLSLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVICNVYDSGSVFSPEVLDLTEEDLMDKFASGVSMVASLSLAISYPTMAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM +N YKNVL++A+ETDYS+  ADK+KEYLKDPSKFAVAA   AA+   +A A     
Sbjct  241  PHMFLNAYKNVLAVALETDYSYDHADKIKEYLKDPSKFAVAAPAAAASGGAAAAAPKEEE  300

Query  299  eekkeepeeesEDEMGFSLFDD  234
            ++++ E E +   EMGFSLFDD
Sbjct  301  KKEEPEEESDG--EMGFSLFDD  320



>gb|ABK94988.1| unknown [Populus trichocarpa]
 gb|ABK95694.1| unknown [Populus trichocarpa]
Length=320

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLS YDNGSV SPEVLDLTEDDL++KFA GVSM+ SLSLA SYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLIDKFAAGVSMIASLSLATSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++AV T+YSFP A+KVKE+L+DPSKF
Sbjct  241  PHMFINAYKNVLAVAVATEYSFPQAEKVKEFLEDPSKF  278



>ref|XP_009135066.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVLDLTEDDL++KFA G+SMVTSL+LAIS+PT+AAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTIAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+I + T+Y+FP A+KVKEYLKDPSKF
Sbjct  240  PHMFINAYKNALAICIATEYTFPQAEKVKEYLKDPSKF  277



>ref|XP_006407706.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49159.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=322

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV SPEVL+LTEDDL+EKFA G+SMVTSL+LA+SYPT+AAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLNLTEDDLVEKFAAGISMVTSLALAVSYPTIAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_002315165.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEF01336.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=320

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLS YDNGSV SPEVLDLTEDDL++KFA GVSM+ SLSLA SYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLIDKFAAGVSMIASLSLATSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++AV T+YSFP A+KVKE+L+DPSKF
Sbjct  241  PHMFINAYKNVLAVAVATEYSFPQAEKVKEFLEDPSKF  278



>gb|EMT17099.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=320

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 115/142 (81%), Gaps = 2/142 (1%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTE+DL++KFA GVSMV SLSLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVICNVYDSGSVFSPEVLDLTEEDLMDKFASGVSMVASLSLAISYPTMAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM +N YKNVL++A+ETDYS+  ADK+KEYLKDPSKFAVAA   AA+   +A A     
Sbjct  241  PHMFLNAYKNVLAVALETDYSYDHADKIKEYLKDPSKFAVAAPAAAASGGAAAAAPKEEE  300

Query  299  eekkeepeeesEDEMGFSLFDD  234
            ++ + E E +   EMGFSLFDD
Sbjct  301  KKDEPEEESDG--EMGFSLFDD  320



>ref|XP_010941551.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=321

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYDNGSV SPEVLDLTEDDL+EKFA GVSMVTSLSLA+SYPTL AA
Sbjct  181  LGIRPFSYGLVIQAVYDNGSVFSPEVLDLTEDDLVEKFAAGVSMVTSLSLALSYPTLVAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PHM IN YKNVL++A+ T+Y+F  A+KVKEYLKDPSKFAVAA   AAAAA +APAAAA  
Sbjct  241  PHMFINAYKNVLAVAIATEYTFEQAEKVKEYLKDPSKFAVAAPVEAAAAAAAAPAAAAKE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP EES+++MGFSLFD
Sbjct  301  EEKKEEPAEESDEDMGFSLFD  321



>dbj|BAJ94456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ +VYD+GSV SPEVLDLTE+DL++KFA GVSMV SLSLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVICNVYDSGSVFSPEVLDLTEEDLMDKFASGVSMVASLSLAISYPTMAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++A+ETDYS+  ADK+KEYLKDPSKF
Sbjct  241  PHMFLNAYKNVLAVALETDYSYDHADKIKEYLKDPSKF  278



>gb|KFK38306.1| hypothetical protein AALP_AA3G096900 [Arabis alpina]
Length=323

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV +P+VL+LTED L+EKFA+G+SMVTSL+LAISYPTLA+A
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFNPDVLNLTEDALVEKFAVGISMVTSLALAISYPTLASA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN L+I+V T+Y+FP A++VKE+LKDPSKF
Sbjct  240  PHMFINAYKNALAISVATEYTFPQAEQVKEFLKDPSKF  277



>ref|XP_010247657.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nelumbo nucifera]
Length=320

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL +LSVYDNGSV SPEVLDLTEDDL+EKF  GVSMVT+LSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLNILSVYDNGSVFSPEVLDLTEDDLMEKFVSGVSMVTALSLAVSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++AV T+YS+P A++VKEYLKDPSKF
Sbjct  241  PHMFVNAYKNVLAVAVATEYSYPQAEQVKEYLKDPSKF  278



>ref|XP_010095082.1| 60S acidic ribosomal protein P0 [Morus notabilis]
 gb|EXB58188.1| 60S acidic ribosomal protein P0 [Morus notabilis]
Length=320

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVLDLTEDDL+EKFA GVS+VTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVEKFAAGVSLVTSLALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PH   N YKNVL++AV T+Y+FP A+KVKE+L+DPSKF   +A   A A  +A   AA  
Sbjct  241  PHFFTNAYKNVLAVAVATEYTFPQAEKVKEFLEDPSKF-AVSAAPVADAGAAAAPVAAKE  299

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKKEEP EES+D+MGFSLFD
Sbjct  300  EEKKEEPAEESDDDMGFSLFD  320



>ref|XP_009350848.1| PREDICTED: 60S acidic ribosomal protein P0-like [Pyrus x bretschneideri]
Length=321

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYDNGSV SPEVLDLTEDDL+EKFA GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMEKFASGVSMVTSLALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++++ T+YSFP A+KVKE+LKDPSKF
Sbjct  241  PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  278



>ref|XP_008360784.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYDNGSV SPEVLDLTEDDL+EKFA GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMEKFASGVSMVTSLALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++++ T+YSFP A+KVKE+LKDPSKF
Sbjct  241  PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  278



>ref|XP_008799093.1| PREDICTED: 60S acidic ribosomal protein P0 [Phoenix dactylifera]
Length=320

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ SVY+NGSV SPEVLDLTEDDL+EKFA G+SMVTSLSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLVIQSVYENGSVFSPEVLDLTEDDLIEKFAAGLSMVTSLSLALSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++A+ T+Y+FP A+KVKE+L+DPSKF
Sbjct  241  PHMFINAYKNVLAVAIATEYTFPQAEKVKEFLEDPSKF  278



>ref|XP_011035984.1| PREDICTED: 60S acidic ribosomal protein P0 [Populus euphratica]
Length=320

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLS YDNGSV SPEVLDLTEDDL+EKFA GVSM+ SLSLA SYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLVEKFAAGVSMIASLSLATSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKN+L++AV T+YS+P A+KVKE+L+DPSKF
Sbjct  241  PHMFINAYKNILAVAVATEYSYPQAEKVKEFLEDPSKF  278



>ref|XP_009344598.1| PREDICTED: 60S acidic ribosomal protein P0 [Pyrus x bretschneideri]
Length=321

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYDNGSV SPEVLDLTEDDL+EKFA GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVEMVYDNGSVFSPEVLDLTEDDLMEKFASGVSMVTSLALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++++ T+YSFP A+KVKE+LKDPSKF
Sbjct  241  PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  278



>ref|XP_004145258.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004152959.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004168551.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 gb|KGN65800.1| hypothetical protein Csa_1G530120 [Cucumis sativus]
Length=320

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIV+SVYDNGSV SP VLDL+E+DLLEKF  GVSMV SLSLA+S+PTLAAA
Sbjct  181  LGIRPFSYGLIVVSVYDNGSVFSPAVLDLSEEDLLEKFLAGVSMVASLSLAVSFPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHMLIN YKN L+IAV T+YSF  AD++KE+LKDPSKF
Sbjct  241  PHMLINAYKNALAIAVATEYSFSEADEIKEFLKDPSKF  278



>ref|XP_002525622.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF36740.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=323

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VL+VYD+GSV SPEVLDLT+DDL+ KFA GVSMV SLSL++S+PT+AAA
Sbjct  181  LGIRPFSYGLVVLTVYDSGSVFSPEVLDLTDDDLVAKFASGVSMVASLSLSLSFPTIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +NGYKNVLS+A+ ++YSFP A+KVKEYLKDPSKF
Sbjct  241  PHMFVNGYKNVLSVAMVSEYSFPQAEKVKEYLKDPSKF  278



>ref|XP_004307622.1| PREDICTED: 60S acidic ribosomal protein P0 [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYDNGSV SPEVLDLTEDDL+ KFA GVS VT+L+LAISYPT+AAA
Sbjct  180  LGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMIKFASGVSNVTALALAISYPTIAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL+IAV T+YSFP ADKVKEYL+DPSKF
Sbjct  240  PHMFLNAYKNVLAIAVATEYSFPQADKVKEYLEDPSKF  277



>emb|CDP06275.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIV SV+DNGSV SP+VL+LTEDD++EKF+LG+SM TSL+L ISYP+L+AA
Sbjct  126  LGIRPFSYGLIVPSVFDNGSVFSPDVLNLTEDDVVEKFSLGLSMATSLALGISYPSLSAA  185

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH+LINGYKN L IAVET+YSF  ADKV EYLKDPS+F
Sbjct  186  PHILINGYKNALVIAVETEYSFSQADKVNEYLKDPSEF  223



>ref|XP_010926952.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=320

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL++ SVYDNGSV SPEVLDLTEDDL+EKFA GVSMVTSLSLA+SYPT+AAA
Sbjct  181  LGIRPFSYGLVIQSVYDNGSVFSPEVLDLTEDDLIEKFAAGVSMVTSLSLALSYPTVAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++A+ T+Y+FP A K+KE+L+DPSKF
Sbjct  241  PHMFINAYKNVLAVAIATEYTFPQAKKLKEFLEDPSKF  278



>gb|EYU22330.1| hypothetical protein MIMGU_mgv1a019166mg, partial [Erythranthe 
guttata]
Length=230

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV SPEVL L  DDL+ KFA+GVSMV SLSLAISYPTLAAA
Sbjct  75   LGIRPFSYGLVVLSVYDNGSVYSPEVLHLPVDDLVAKFAMGVSMVNSLSLAISYPTLAAA  134

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYL  384
             HM INGYKNVL+ AVET YSFPLADKVKEYL
Sbjct  135  LHMFINGYKNVLAAAVETGYSFPLADKVKEYL  166



>ref|XP_008392940.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYDNGSV SPEVLDLTEDDL+ KFA GVSMVTSL+LA+SYPTLAAA
Sbjct  181  LGIRPFSYGLVVEMVYDNGSVFSPEVLDLTEDDLMVKFASGVSMVTSLALAVSYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++++ T+YSFP A+KVKE+LKDPSKF
Sbjct  241  PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  278



>ref|XP_004307662.1| PREDICTED: 60S acidic ribosomal protein P0 [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYDNGSV SPEVLDLTEDDL+ KFA GVS VT+L+LAISYPT+AAA
Sbjct  180  LGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMIKFASGVSNVTALALAISYPTIAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL+IAV T+YSFP ADKVKEYL+DPSKF
Sbjct  240  PHMFLNAYKNVLAIAVATEYSFPQADKVKEYLEDPSKF  277



>ref|XP_011084927.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=315

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIVLSVY++GSV SPEVLDLTEDDL+EKFA+GVSMV SLSLAI+YPTLAAA
Sbjct  181  LGIRPFSYGLIVLSVYESGSVFSPEVLDLTEDDLVEKFAMGVSMVASLSLAITYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYL  384
            PHM IN YKN+LS+AVETDYSFP ADKVKEYL
Sbjct  241  PHMFINAYKNLLSVAVETDYSFPQADKVKEYL  272



>emb|CDY24932.1| BnaC03g22400D [Brassica napus]
Length=319

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV  PEVL+LTEDDL+EKFA GVS+VT+LSLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFDPEVLNLTEDDLVEKFAAGVSLVTALSLAISYPTIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++A+ T+YSFP A+ VKE+LKDPSKF
Sbjct  241  PHMFINAYKNVLAVALATEYSFPQAENVKEFLKDPSKF  278



>ref|NP_181530.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
 sp|O04204.1|RLA01_ARATH RecName: Full=60S acidic ribosomal protein P0-1 [Arabidopsis 
thaliana]
 gb|AAB95286.1| 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAN71918.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEC09763.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
Length=317

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV +PEVL+LTEDDL+EKFA GVSM+T+LSLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDDLVEKFAAGVSMITALSLAISYPTVAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++A+ T+YSFP A+ VKE+LKDP+KF
Sbjct  241  PHMFLNAYKNVLAVALATEYSFPQAENVKEFLKDPTKF  278



>ref|XP_006435697.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
 ref|XP_006486350.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48937.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
Length=319

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVY+NGSV SPEVLDL+EDDL+EKFA  VSMVT+L+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVQSVYENGSVYSPEVLDLSEDDLVEKFASSVSMVTALALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNV+++A+ T+YSFP ADKVKEYL DPSKF
Sbjct  241  PHMFVNAYKNVVAVALATEYSFPQADKVKEYLADPSKF  278



>gb|KDO69054.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=319

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVY+NGSV SPEVLDL+EDDL+EKFA  VSMVT+L+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVQSVYENGSVYSPEVLDLSEDDLVEKFASSVSMVTALALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNV+++A+ T+YSFP ADKVKEYL DPSKF
Sbjct  241  PHMFVNAYKNVVAVALATEYSFPQADKVKEYLADPSKF  278



>ref|XP_004287422.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYDNGSV SPEVLDLTEDDL+ KFA GVS VT+L++A+SYPT+AAA
Sbjct  180  LGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMIKFASGVSNVTALAMAVSYPTIAAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL+IAV T+YSFP ADKVKEYL+DPSKF
Sbjct  240  PHMFLNAYKNVLAIAVATEYSFPQADKVKEYLEDPSKF  277



>ref|XP_002881693.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57952.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV +PEVL+LTEDDL+EKFA GVSM+T++SLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDDLVEKFAAGVSMITAISLAISYPTVAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++A+ T+YSFP A+ VKE+LKDP+KF
Sbjct  241  PHMFLNAYKNVLAVALATEYSFPQAENVKEFLKDPTKF  278



>emb|CDY60988.1| BnaA03g56530D [Brassica napus]
Length=318

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV  PEVL+LTEDDL+EKFA GVS+VT+ SLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFDPEVLNLTEDDLVEKFAAGVSLVTAFSLAISYPTIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++A+ T+YSFP A+ VKE+LKDPSKF
Sbjct  241  PHMFINAYKNVLAVALATEYSFPQAENVKEFLKDPSKF  278



>ref|XP_009133397.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Brassica rapa]
Length=319

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV  PEVL+LTEDDL+EKFA GVS+VT+ SLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFDPEVLNLTEDDLVEKFAAGVSLVTAFSLAISYPTIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL++A+ T+YSFP A+ VKE+LKDPSKF
Sbjct  241  PHMFINAYKNVLAVALATEYSFPQAENVKEFLKDPSKF  278



>gb|AGL34823.1| ribosomal protein 10, partial [Cyrtandra paludosa var. paludosa]
 gb|AGL34824.1| ribosomal protein 10, partial [Cyrtandra cordifolia]
 gb|AGL34825.1| ribosomal protein 10, partial [Cyrtandra platyphylla var. parviflora]
Length=100

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLI+L+VYDNGSV SPEVLDLTEDDL+EKFA+GVSMVTSLSL+ISYPTLAAA
Sbjct  15   LGIRPFSYGLIILTVYDNGSVFSPEVLDLTEDDLIEKFAIGVSMVTSLSLSISYPTLAAA  74

Query  479  PHMLINGYKNVLSIAVETDYSFPLAD  402
            PHM +N YKNVL+IAVETDYSFP AD
Sbjct  75   PHMFVNAYKNVLAIAVETDYSFPQAD  100



>ref|XP_008351783.1| PREDICTED: uncharacterized protein LOC103415220 [Malus domestica]
Length=762

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYDNGSV SPEVLDLTEDDL+ KFA GVSMVTSL+LA+SYPTLAAA
Sbjct  622  LGIRPFSYGLVVEMVYDNGSVFSPEVLDLTEDDLMVKFASGVSMVTSLALAVSYPTLAAA  681

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++++ T+YSFP A+KVKE+LKDPSKF
Sbjct  682  PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  719



>gb|KDP46515.1| hypothetical protein JCGZ_08487 [Jatropha curcas]
Length=319

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L IRPFSYGLIV SVYDNGSV SPEVLDLTEDDL+E+F  GVSMVTSLSL+IS+PTLAAA
Sbjct  181  LQIRPFSYGLIVFSVYDNGSVFSPEVLDLTEDDLVERFVNGVSMVTSLSLSISFPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVLS++V T+Y+FP A++VKE+L+DPSKF
Sbjct  241  PHMFLNAYKNVLSVSVATEYTFPQAEQVKEFLEDPSKF  278



>ref|XP_010508934.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Camelina sativa]
Length=318

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV +PEVL+LTEDDL+EKFA GVSM T+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDDLVEKFAAGVSMTTALSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
             HM +N YKN L++A+ T+YSFP A+ VKE+LKDPSKF
Sbjct  241  THMFLNAYKNALAVALATEYSFPQAENVKEFLKDPSKF  278



>ref|XP_001759592.1| predicted protein [Physcomitrella patens]
 gb|EDQ75504.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V+++YDNGSV +PEVLDLTEDDLL+KFA GVS V ++SLA++YPTLAA 
Sbjct  181  LGIRPFSYGLVVVNIYDNGSVFAPEVLDLTEDDLLDKFAAGVSTVAAVSLALNYPTLAAV  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH  +N YKN+L+IAVET+YSFPLA+K KEYLKDPSKF
Sbjct  241  PHSFVNSYKNLLAIAVETEYSFPLAEKTKEYLKDPSKF  278



>ref|XP_010517390.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Camelina sativa]
Length=318

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVYDNGSV +PEVL+LTEDDL+EKFA GVSM+T+LSLA SYPTLAAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDDLVEKFAAGVSMITALSLAASYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKN L +A+ T+YSFP A+ VKE++KDPSKF
Sbjct  241  PHMFLNAYKNALVVALATEYSFPQAENVKEFVKDPSKF  278



>gb|AGL34820.1| ribosomal protein 10, partial [Cyrtandra schizocalyx]
Length=100

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLI+ +VYDNGSV SPEVLDLTEDDL+EKFA+GVSMVTSLSL+ISYPTLAAA
Sbjct  15   LGIRPFSYGLIISTVYDNGSVFSPEVLDLTEDDLIEKFAIGVSMVTSLSLSISYPTLAAA  74

Query  479  PHMLINGYKNVLSIAVETDYSFPLAD  402
            PHM +N YKNVL+IAVETDYSFP AD
Sbjct  75   PHMFVNAYKNVLAIAVETDYSFPQAD  100



>ref|XP_008457380.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis melo]
Length=320

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIV+SVYDNGSV SP VLDLTE+DLLEKF  GVSMV SLSLA+S+PTLAAA
Sbjct  181  LGIRPFSYGLIVVSVYDNGSVFSPAVLDLTEEDLLEKFLAGVSMVASLSLAVSFPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  375
            PHMLIN YKN L+IAV T+YSF  AD++KE+LKDP
Sbjct  241  PHMLINAYKNALAIAVATEYSFSEADEIKEFLKDP  275



>ref|XP_001759851.1| predicted protein [Physcomitrella patens]
 gb|EDQ75355.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V+++YDNGS+ +PEVLDLTEDDLL+KFA GVS V ++SLA++YPTLAA 
Sbjct  181  LGIRPFSYGLVVVNIYDNGSLFAPEVLDLTEDDLLDKFAAGVSTVAAVSLALNYPTLAAV  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH  +N YKN+L+IAVET+YSFPLA+K KEYLKDPSKF
Sbjct  241  PHSFVNAYKNLLAIAVETEYSFPLAEKTKEYLKDPSKF  278



>gb|KHG21849.1| 60S acidic ribosomal P0-2 -like protein [Gossypium arboreum]
Length=237

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V+SVYDNG+V SPEVLDLTEDDL+EKF   +S VTSLSLA+S+PTLAAA
Sbjct  97   LGIRPFSYGLVVVSVYDNGTVFSPEVLDLTEDDLMEKFRSWLSNVTSLSLAVSFPTLAAA  156

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YK  LS+AV T+Y+FP A+K+KEYLKDP+KF
Sbjct  157  PHMFINAYKTALSLAVATEYTFPQAEKIKEYLKDPTKF  194



>ref|XP_007163525.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
 gb|ESW35519.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
Length=317

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 113/141 (80%), Gaps = 4/141 (3%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L IRPFSYGL+V+SVYDNGSV SP VL+LT+DDL+  FA GVSMV+SLSLAISYPT+AAA
Sbjct  181  LAIRPFSYGLVVVSVYDNGSVFSPAVLNLTDDDLVNMFANGVSMVSSLSLAISYPTIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
             HM  N YKNVL++AV T+YSFP AD+VKE+LKDPSKF    A    AA  +  A AAA 
Sbjct  241  LHMFANSYKNVLAVAVVTEYSFPEADEVKEFLKDPSKF----AVAVVAATATDSAPAAAK  296

Query  299  eekkeepeeesEDEMGFSLFD  237
            EE+K+E  EES+D+MGFSLFD
Sbjct  297  EEEKKEEPEESDDDMGFSLFD  317



>gb|KHG01938.1| 60S acidic ribosomal P0-2 -like protein [Gossypium arboreum]
Length=253

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V+SVYDNG+V SPEVLDLTEDDL+EKF   +S VTSLSLA+S+PTLAAA
Sbjct  113  LGIRPFSYGLVVVSVYDNGTVFSPEVLDLTEDDLMEKFRSWLSNVTSLSLAVSFPTLAAA  172

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YK  LS+AV T+Y+FP A+K+KEYLKDP+KF
Sbjct  173  PHMFINAYKTALSLAVATEYTFPQAEKIKEYLKDPTKF  210



>gb|KJB19895.1| hypothetical protein B456_003G123400 [Gossypium raimondii]
Length=321

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V+SVYDNG+V SPEVLDLTEDDL+EKF   +S VTSLSLA+S+PTLAAA
Sbjct  181  LGIRPFSYGLVVVSVYDNGTVFSPEVLDLTEDDLMEKFRSWLSNVTSLSLAVSFPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YK  LS+AV T+Y+FP A+K+KEYLKDP+KF
Sbjct  241  PHMFINAYKTALSLAVATEYTFPQAEKIKEYLKDPTKF  278



>ref|XP_009592351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=319

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGI+PFSYGLIV  VYD+GSV SPEVLDLTE+DL+ KFA G+S V  LS+ +SYPTLAA 
Sbjct  181  LGIKPFSYGLIVQFVYDSGSVFSPEVLDLTENDLIAKFAAGLSNVVGLSMLLSYPTLAAI  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM INGYKNVLS A+ T+YSFP A+KVKEYLKDPSKF
Sbjct  241  PHMFINGYKNVLSFAIATEYSFPQAEKVKEYLKDPSKF  278



>ref|XP_009799989.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=319

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGI+PFSYGLIV  VYD+GSV SPEVLDLTEDDL+ KFA G+S V  LS+ +SYPTLAA 
Sbjct  181  LGIKPFSYGLIVQFVYDSGSVFSPEVLDLTEDDLIAKFAAGLSNVVGLSMLLSYPTLAAI  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM INGYKNVLS A+ T+YSFP A+KVKEYLKDPSKF
Sbjct  241  PHMFINGYKNVLSFAIATEYSFPQAEKVKEYLKDPSKF  278



>gb|KDO69056.1| hypothetical protein CISIN_1g036252mg [Citrus sinensis]
Length=318

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I+PFSYGLIV+SVY+NGSV SPEVLDLTEDD+  KF   VS V SL+L+I YPT+AAA
Sbjct  181  LAIKPFSYGLIVMSVYENGSVYSPEVLDLTEDDIATKFLEAVSRVASLALSIRYPTIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH  INGYKNVLS AV T+YSF  ADKVKEYLKDPSKF
Sbjct  241  PHFFINGYKNVLSFAVATEYSFSQADKVKEYLKDPSKF  278



>ref|XP_006435696.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
 ref|XP_006486351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48936.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
Length=318

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I+PFSYGLIV+SVY+NGSV SPEVLDLTEDD+  KF   VS V SL+L+I YPT+AAA
Sbjct  181  LAIKPFSYGLIVMSVYENGSVYSPEVLDLTEDDIATKFLEAVSRVASLALSIRYPTIAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH  INGYKNVLS AV T+YSF  ADKVKEYLKDPSKF
Sbjct  241  PHFFINGYKNVLSFAVATEYSFSQADKVKEYLKDPSKF  278



>gb|AGL34822.1| ribosomal protein 10, partial [Cyrtandra kauaiensis]
Length=100

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLIV +VYDNGSV SPEVLDLTEDDL+EKFA+GVSMVTSLSL+ISYPTL AA
Sbjct  15   LGIRPFSYGLIVSTVYDNGSVFSPEVLDLTEDDLIEKFAIGVSMVTSLSLSISYPTLXAA  74

Query  479  PHMLINGYKNVLSIAVETDYSFPLAD  402
            PHM +N YKNVL+IAVET YSFP AD
Sbjct  75   PHMFVNAYKNVLAIAVETGYSFPQAD  100



>ref|XP_004296403.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L IRPFSYGL+V  VYDNGSV SPEVLDLTE+DL  KFA   S V +L+LAISYPT+ AA
Sbjct  180  LAIRPFSYGLVVQMVYDNGSVFSPEVLDLTEEDLAVKFASSASNVAALALAISYPTVVAA  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNVL++AV T++SFP ADKVKEYLKDPSKF
Sbjct  240  PHMFLNAYKNVLAVAVATEFSFPQADKVKEYLKDPSKF  277



>gb|AGL34821.1| ribosomal protein 10, partial [Cyrtandra longifolia]
Length=100

 Score =   120 bits (301),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGLI+ +VYDNGSV  PEVLDLTEDDL+EKFA+GVSMVTSLSL+ISYPTLAAA
Sbjct  15   LGIRPFSYGLIISTVYDNGSVFIPEVLDLTEDDLIEKFAIGVSMVTSLSLSISYPTLAAA  74

Query  479  PHMLINGYKNVLSIAVETDYSFPLAD  402
            PHM +N YKNVL+IAV TDYSFP AD
Sbjct  75   PHMFVNAYKNVLAIAVLTDYSFPQAD  100



>gb|KDO69055.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=318

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V SVY+NGSV SPEVLDL+EDDL+EKFA  VSMVT+L+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVQSVYENGSVYSPEVLDLSEDDLVEKFASSVSMVTALALAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYL  384
            PHM +N YKNV+++A+ T+YSFP ADKVKEYL
Sbjct  241  PHMFVNAYKNVVAVALATEYSFPQADKVKEYL  272



>ref|XP_006296009.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
 gb|EOA28907.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
Length=319

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL V SVYDNGSV +PEVL+LTEDDL++KFA GVSM+T+LSLA SYPTLAAA
Sbjct  181  LGIRPFSYGLAVESVYDNGSVFNPEVLNLTEDDLVDKFAAGVSMITALSLAASYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKNV+++A  T+YSFP ++ VKE LKDP+ +
Sbjct  241  PHMFLNAYKNVVAVAFATEYSFPRSENVKECLKDPTSW  278



>ref|XP_010685586.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=324

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I+PFSYGL+V  V+++GSV  PE+LDLTEDDL  KFA GV+ VT+L+LAISYPT+AAA
Sbjct  185  LAIKPFSYGLVVQKVFEDGSVYDPEILDLTEDDLALKFAAGVANVTALALAISYPTIAAA  244

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM IN YKNVL+++V TDY+FP A+++KEYLKDPSKF
Sbjct  245  PHMFINAYKNVLAVSVATDYTFPEAEEIKEYLKDPSKF  282



>ref|XP_004241171.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=318

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  653  IRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAAPH  474
            I+PFSYGLIV SVYDNGSV SPEVL+LT++DL+ +FA G++ V  LS+ ++YPTLAA PH
Sbjct  183  IKPFSYGLIVQSVYDNGSVFSPEVLELTDNDLVARFAAGLTNVVGLSMTLNYPTLAAIPH  242

Query  473  MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            + IN YKNVLS A+ T+YSFP A+KVKEYLKDPSKF
Sbjct  243  IFINSYKNVLSFAIATEYSFPQAEKVKEYLKDPSKF  278



>ref|XP_002983859.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
 gb|EFJ14871.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
Length=322

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYD+GSV  P VLDLTEDDL+ +FA GVS V +LSLAI YPTLAAA
Sbjct  181  LGIRPFSYGLVVQMVYDDGSVFDPAVLDLTEDDLVGRFAAGVSAVAALSLAIGYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
             H  +N YKNVL++A+ TDYS+P A+ VKEYLKDPSKF
Sbjct  241  THCFLNSYKNVLAVALATDYSYPHAETVKEYLKDPSKF  278



>ref|XP_002974292.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
 ref|XP_002985667.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ13245.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ24514.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
Length=318

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYD+GSV  P VLDLTEDDL+ +FA GVS V +LSLAI YPTLAAA
Sbjct  181  LGIRPFSYGLVVQMVYDDGSVFDPAVLDLTEDDLVGRFAAGVSAVAALSLAIGYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
             H  +N YKNVL++A+ TDYS+P A+ VKEYLKDPSKF
Sbjct  241  SHYFLNSYKNVLAVALATDYSYPQAETVKEYLKDPSKF  278



>ref|XP_010104660.1| 60S acidic ribosomal protein P0-1 [Morus notabilis]
 gb|EXC01466.1| 60S acidic ribosomal protein P0-1 [Morus notabilis]
Length=224

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSY L+VL  YD GSV S EVLDLT+DDL+EKFA+GV+ +TS SL +SYPT+AAA
Sbjct  82   LGIRPFSYALVVLCAYDQGSVFSSEVLDLTDDDLVEKFAVGVATLTSASLDLSYPTIAAA  141

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHMLIN YKN+  + V T+YSFP  + VKEYLKDPSKF
Sbjct  142  PHMLINAYKNIQDVGVATEYSFPQVESVKEYLKDPSKF  179



>ref|XP_002960810.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
 gb|EFJ38349.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
Length=321

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+V  VYD+GSV  P VLDLTEDDL+ +FA GVS V +LSLAI YPTLAAA
Sbjct  181  LGIRPFSYGLVVQMVYDDGSVFDPAVLDLTEDDLVGRFATGVSAVAALSLAIGYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
             H  +N YKNVL++A+ TDYS+P A+  KEYLKDPSKFAVAAAP A+     A       
Sbjct  241  THYFLNSYKNVLAVALATDYSYPHAETAKEYLKDPSKFAVAAAPAASETPADAAGGGKVE  300

Query  299  eekkeepeeesEDEMGFSLFD  237
            EEKK EPEEES+D+MG SLFD
Sbjct  301  EEKKVEPEEESDDDMGLSLFD  321



>emb|CBI15980.3| unnamed protein product [Vitis vinifera]
Length=245

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LG + FSYGL+VLSV DNGSV SP+VLDLT+DDL EKF+ GVSM  SLSLAISYPTLAAA
Sbjct  105  LGKKSFSYGLVVLSVSDNGSVFSPKVLDLTDDDLAEKFSAGVSMKASLSLAISYPTLAAA  164

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
             HM IN   NVL++AV  +YSFP A +VKEYLKDPSKF
Sbjct  165  LHMFINACNNVLTVAVVAEYSFPQAQQVKEYLKDPSKF  202



>ref|XP_002279500.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Vitis vinifera]
Length=286

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LG + FSYGL+VLSV DNGSV SP+VLDLT+DDL EKF+ GVSM  SLSLAISYPTLAAA
Sbjct  146  LGKKSFSYGLVVLSVSDNGSVFSPKVLDLTDDDLAEKFSAGVSMKASLSLAISYPTLAAA  205

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
             HM IN   NVL++AV  +YSFP A +VKEYLKDPSKF
Sbjct  206  LHMFINACNNVLTVAVVAEYSFPQAQQVKEYLKDPSKF  243



>emb|CAN65663.1| hypothetical protein VITISV_014917 [Vitis vinifera]
Length=379

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LG + FSYGL+VLSV DNGSV SP+VLDLT+DDL EKF+ GVSM  SLSLAISYPTLAAA
Sbjct  181  LGKKXFSYGLVVLSVXDNGSVFSPKVLDLTDDDLAEKFSAGVSMKASLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
             HM IN   NVL++AV  +YSFP A +VKEYLKDPSKF
Sbjct  241  LHMFINACNNVLTVAVVAEYSFPQAQQVKEYLKDPSKF  278



>ref|XP_002960261.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
 gb|EFJ37800.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
Length=323

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L IRPFSYGL+V  VYD+GSV  P VLDLT+DDL+ KFA GVS V ++SLA+ YPTLAAA
Sbjct  181  LRIRPFSYGLVVRRVYDSGSVFDPAVLDLTDDDLVAKFAEGVSAVAAISLALGYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
             H  +N YKNVL+IA+ TDYS+P A+  KEYLKDPSKF
Sbjct  241  AHFFLNSYKNVLAIALSTDYSYPQAENAKEYLKDPSKF  278



>ref|XP_002967451.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
 gb|EFJ32050.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
Length=323

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L IRPFSYGL+V  VYD+GSV  P VLDLT+DDL+ KFA GVS V ++SLA+ YPTLAAA
Sbjct  181  LRIRPFSYGLVVRRVYDSGSVFDPAVLDLTDDDLVAKFAEGVSAVAAISLALGYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
             H  +N YKNVL+IA+ TDYS+P A+  KEYLKDPSKF
Sbjct  241  AHFFLNSYKNVLAIALSTDYSYPQAENAKEYLKDPSKF  278



>ref|NP_001187030.1| 60S acidic ribosomal protein P0 [Ictalurus punctatus]
 sp|Q90YX1.1|RLA0_ICTPU RecName: Full=60S acidic ribosomal protein P0; AltName: Full=60S 
ribosomal protein L10E [Ictalurus punctatus]
 gb|AAK95123.1|AF401551_1 ribosomal protein P0 [Ictalurus punctatus]
Length=317

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TED L ++F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEDALHKRFLEGVRNIASVCLQIGYPTLASI  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL +AVETDYSFP+ADKVK +L DPS+F
Sbjct  238  PHSIINGYKRVLRVAVETDYSFPMADKVKAFLADPSRF  275



>gb|AAT44430.1| ribosomal protein large P0-like protein, partial [Sparus aurata]
Length=314

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNIASVCLEIGYPTLASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDYSFPLADKVK +L DPS F
Sbjct  238  PHSVINGYKRVLAVAVETDYSFPLADKVKAFLADPSAF  275



>ref|XP_006350830.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=318

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -2

Query  653  IRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAAPH  474
            I+PFSYGLIV SVYDNGSV SPEVL+LT++DL+ +FA G++ V  LS+ + YPTLAA PH
Sbjct  183  IKPFSYGLIVQSVYDNGSVFSPEVLELTDNDLVARFAAGLTNVVGLSMILDYPTLAAIPH  242

Query  473  MLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            M IN YKNVLS A+ T+YSFP A+KVKEYLK+PS
Sbjct  243  MFINSYKNVLSFAIATEYSFPQAEKVKEYLKNPS  276



>ref|XP_006640161.1| PREDICTED: 60S acidic ribosomal protein P0-like [Lepisosteus 
oculatus]
Length=316

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GLI+  VYDNGSV SPEVLD+TED L ++F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLIIQQVYDNGSVYSPEVLDITEDALQQRFLEGVRNVASVCLQIGYPTVASI  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++AVETDYSFPLADKVKE+L DPS
Sbjct  238  PHSIINGYKRVLAVAVETDYSFPLADKVKEFLADPS  273



>ref|XP_005987234.1| PREDICTED: 60S acidic ribosomal protein P0 [Latimeria chalumnae]
Length=314

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI++ VYDNGSV SPEVLD+TED L ++F  GV  + S+ L I YPT+A+ 
Sbjct  178  LNISPFSYGLIIMQVYDNGSVYSPEVLDITEDTLHKRFLEGVRNIASVCLQIGYPTVASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++ VETDYSFPLADKVK +L DPS F
Sbjct  238  PHSVINGYKRVLAVCVETDYSFPLADKVKAFLADPSSF  275



>ref|XP_006407705.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49158.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=298

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  620  SVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLS  441
            SVYDNGSV SPEVL+LTEDDL+EKFA G+SMVTSL+LA+SYPT+AAAPHM IN YKN L+
Sbjct  169  SVYDNGSVFSPEVLNLTEDDLVEKFAAGISMVTSLALAVSYPTIAAAPHMFINAYKNALA  228

Query  440  IAVETDYSFPLADKVKEYLKDPSKF  366
            I+V T+Y+FP A+KVKE+LKDPSKF
Sbjct  229  ISVATEYTFPQAEKVKEFLKDPSKF  253



>ref|XP_010740439.1| PREDICTED: 60S acidic ribosomal protein P0 isoform X2 [Larimichthys 
crocea]
Length=275

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  139  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNIASVCLEIGYPTLASV  198

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  199  PHSVINGYKRVLAVAVETDYSFPLADKVKAFLADPS  234



>ref|XP_006784596.1| PREDICTED: 60S acidic ribosomal protein P0-like [Neolamprologus 
brichardi]
Length=315

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNIASVCLEIGYPTLASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  238  PHTVINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>ref|NP_001080134.1| ribosomal protein, large, P0 [Xenopus laevis]
 gb|AAH42268.1| Arbp-prov protein [Xenopus laevis]
Length=315

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGS+ SPEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSIYSPEVLDITEEALHVRFLEGVRNVASVCLQIGYPTVASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL+IAVETDYSFPLADKVK +L DPS
Sbjct  238  PHSVINGYKRVLAIAVETDYSFPLADKVKAFLADPS  273



>ref|XP_010740438.1| PREDICTED: 60S acidic ribosomal protein P0 isoform X1 [Larimichthys 
crocea]
Length=314

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNIASVCLEIGYPTLASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  238  PHSVINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>ref|NP_989067.1| ribosomal protein, large, P0 [Xenopus (Silurana) tropicalis]
 gb|AAH61299.1| acidic ribosomal phosphoprotein P0 [Xenopus (Silurana) tropicalis]
Length=314

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGS+ SPEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSIYSPEVLDITEEALHVRFLEGVRNVASVCLQIGYPTVASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL+IAVETDYSFPLADKVK +L DPS
Sbjct  238  PHSVINGYKRVLAIAVETDYSFPLADKVKAFLADPS  273



>gb|ACH73063.1| ribosomal protein LP0-like protein, partial [Epinephelus coioides]
Length=189

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  51   LNISPFSYGLIIQQVYDNGSVYSPEVLDITEAALQARFLEGVRNIASVCLEIGYPTLASV  110

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYL  384
            PH +INGYK VL++AVETDYSFPLADKVKE+L
Sbjct  111  PHSIINGYKRVLAVAVETDYSFPLADKVKEFL  142



>ref|XP_005850392.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
 gb|EFN58290.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
Length=314

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGI+PFSYGL++L VYDNGS+  P+VLD+T+DDL      G+  V +  L +SYPT+A+ 
Sbjct  180  LGIKPFSYGLVILQVYDNGSLYDPKVLDITDDDLGNLITAGLRNVAAACLELSYPTIASV  239

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH LINGYKNVL+IAVETDYSFPLA+KVK +L DPS F
Sbjct  240  PHSLINGYKNVLAIAVETDYSFPLAEKVKAFLADPSAF  277



>gb|EOA96285.1| 60S acidic ribosomal protein P0, partial [Anas platyrhynchos]
Length=124

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TED L ++F  GV  V S+ L I YPT+A+ 
Sbjct  23   LNISPFSFGLVIQQVFDNGSIYNPEVLDITEDTLHKRFLEGVRNVASVCLQIGYPTIASV  82

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  83   PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  120



>ref|XP_001697060.1| acidic ribosomal protein P0 [Chlamydomonas reinhardtii]
 gb|EDP00752.1| acidic ribosomal protein P0 [Chlamydomonas reinhardtii]
Length=320

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LG++PF YGL++L V ++G+V  P+V+D+T++D++     G+  V +LSL   YPTLAAA
Sbjct  186  LGVKPFKYGLLILKVIESGAVYDPKVMDITDEDMMASVIAGIREVAALSLGAQYPTLAAA  245

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH++I+GYKNVL+IAVETDY+FPLA KVK+YL DPSKF
Sbjct  246  PHVIIDGYKNVLAIAVETDYTFPLAQKVKDYLADPSKF  283



>dbj|BAF98695.1| ribosomal protein LP0 [Solea senegalensis]
Length=315

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEDCLHARFLEGVRNIASVCLEIGYPTLASI  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++AVETDYSFP+ADKVK +L DPS
Sbjct  238  PHSIINGYKRVLAVAVETDYSFPMADKVKAFLADPS  273



>gb|AHB33743.1| 60S acidic ribosomal protein P0 [Cyprinus carpio]
Length=316

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TED L ++F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEDALHKRFLEGVRNIASVCLQIGYPTLASI  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++AVETDYSFPLA+KVK YL DP+
Sbjct  238  PHSIINGYKRVLAVAVETDYSFPLAEKVKAYLADPT  273



>ref|XP_008292997.1| PREDICTED: 60S acidic ribosomal protein P0 [Stegastes partitus]
Length=315

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GLI+  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSFGLIIQQVYDNGSVYSPEVLDITEASLHTRFLEGVRNIASVCLEIGYPTLASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  238  PHSVINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>ref|XP_008318611.1| PREDICTED: 60S acidic ribosomal protein P0 [Cynoglossus semilaevis]
Length=315

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGL++  VYDNGSV SPEVLD+TE+ L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLLIQQVYDNGSVYSPEVLDITEESLHVRFLEGVRNIASVCLEIGYPTLASL  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  238  PHSIINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>gb|ACH70801.1| acidic ribosomal protein P0 [Salmo salar]
 gb|ACI69835.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACN10322.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACN12682.1| 60S acidic ribosomal protein P0 [Salmo salar]
Length=315

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  VYDNGSV SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSFGLLIQQVYDNGSVYSPEVLDITEDALHARFLEGVRNIASVCLEIGYPTLASI  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  375
            PH +INGYK VL++AVETDYSFPLADKVK+YL DP
Sbjct  238  PHTIINGYKRVLAVAVETDYSFPLADKVKDYLADP  272



>sp|Q9DG68.1|RLA0_RANSY RecName: Full=60S acidic ribosomal protein P0; AltName: Full=60S 
ribosomal protein L10E [Rana sylvatica]
 gb|AAG09233.1| brain acidic ribosomal phosphoprotein P0 [Rana sylvatica]
Length=315

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GLI+  VYDNGS+ SPEVLD+TED L  +F  GV  + S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLIIQQVYDNGSIYSPEVLDITEDALRARFLEGVRNIASVCLQIGYPTVASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH ++NGYK VL++AVETDYSFPLADKVK +L DPS F
Sbjct  238  PHSVVNGYKRVLALAVETDYSFPLADKVKAFLADPSAF  275



>gb|ABU63975.1| ribosomal protein large P0-like protein [Perca flavescens]
Length=314

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGL +  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLNIQQVYDNGSVYSPEVLDITEACLHARFLEGVRNIASVCLEIGYPTLASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  238  PHTIINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>ref|XP_011415179.1| PREDICTED: 60S acidic ribosomal protein P0-like [Crassostrea 
gigas]
 gb|EKC26031.1| 60S acidic ribosomal protein P0 [Crassostrea gigas]
Length=314

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LG+ PFSYGL V  VYD+G++  PE+LD+T+DDL  KF +GV  + ++SL I YPT A+A
Sbjct  178  LGVSPFSYGLAVEKVYDSGTIFEPEILDITDDDLKAKFLMGVRNIAAISLTIGYPTAASA  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH + NG+K +L+IAVETDY+FP A+K KEYLKDPSKF
Sbjct  238  PHSIANGFKRLLAIAVETDYTFPAAEKTKEYLKDPSKF  275



>emb|CDQ67134.1| unnamed protein product [Oncorhynchus mykiss]
Length=315

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  VYDNGSV SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSFGLLIQQVYDNGSVYSPEVLDITEDALHARFLEGVRNIASVCLEIGYPTLASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  375
            PH +INGYK VL++AVETDYSFPLADKVK YL DP
Sbjct  238  PHTIINGYKRVLAVAVETDYSFPLADKVKAYLADP  272



>gb|ACI68961.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACI70184.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACN09916.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACN12263.1| 60S acidic ribosomal protein P0 [Salmo salar]
Length=315

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  VYDNGSV SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSFGLLIQQVYDNGSVYSPEVLDITEDALHARFLEGVRNIASVCLEIGYPTLASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  375
            PH +INGYK VL++AVETDYSFPLADKVK YL DP
Sbjct  238  PHTIINGYKRVLAVAVETDYSFPLADKVKAYLADP  272



>ref|XP_010879645.1| PREDICTED: 60S acidic ribosomal protein P0 [Esox lucius]
Length=315

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSFGLLIQQVYDNGSVYSPEVLDITEAALHARFLEGVRNIASVCLEIGYPTLASI  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  375
            PH +INGYK VL++AVETDYSFPLADKVK YL DP
Sbjct  238  PHTIINGYKRVLAVAVETDYSFPLADKVKAYLADP  272



>gb|KJB74260.1| hypothetical protein B456_011G283700 [Gossypium raimondii]
Length=273

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  551  KFALGVSMVTSLSLAISYPTLAAAPHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            KFA GVSMVT+LSLAISYPTLAAAPHM INGYKN+L++AV T+YSFP ADKVKEYL DPS
Sbjct  169  KFATGVSMVTALSLAISYPTLAAAPHMFINGYKNILAVAVATEYSFPQADKVKEYLADPS  228

Query  371  KFavaaapvaaaaagsapaaaaaaeekkeepeeesEDEMGFSLFD  237
            KFAVAAAPVAAA  G+APAAA A EEKK EPEEES+D+MGFSLFD
Sbjct  229  KFAVAAAPVAAAGGGAAPAAAPAEEEKKPEPEEESDDDMGFSLFD  273



>gb|ACO09070.1| 60S acidic ribosomal protein P0 [Osmerus mordax]
Length=314

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGL +  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLGIQQVYDNGSVYSPEVLDITETALQARFLEGVRNIASVCLEIGYPTLASI  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++AVETDYSFPLADKVK +L DPS
Sbjct  238  PHSIINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>emb|CDQ63253.1| unnamed protein product [Oncorhynchus mykiss]
Length=315

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  VYDNGSV SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSFGLLIQQVYDNGSVYSPEVLDITEDALHARFLEGVRNIASVCLEIGYPTLASI  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDP  375
            PH +INGYK VL++AVETDYSFPLADKVK YL DP
Sbjct  238  PHTIINGYKRVLAVAVETDYSFPLADKVKAYLADP  272



>gb|ADF97607.1| large ribosomal protein P0 [Hypophthalmichthys molitrix]
Length=316

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TED L ++F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEDALHKRFLEGVRNIASVCLQIGYPTLASI  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++AVETDYSFPLA+KVK +L DP+
Sbjct  238  PHSVINGYKRVLAVAVETDYSFPLAEKVKAFLADPT  273



>sp|Q9PV90.1|RLA0_DANRE RecName: Full=60S acidic ribosomal protein P0; AltName: Full=60S 
ribosomal protein L10E [Danio rerio]
 gb|AAD54776.1|AF134852_1 acidic ribosomal phophoprotein P0 [Danio rerio]
Length=319

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TED L ++F  GV  + S+ L I YPTLA+ 
Sbjct  181  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEDALHKRFLKGVRNIASVCLQIGYPTLASI  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++ VETDY+FPLA+KVK YL DP+
Sbjct  241  PHTIINGYKRVLAVTVETDYTFPLAEKVKAYLADPT  276



>ref|NP_571655.2| 60S acidic ribosomal protein P0 [Danio rerio]
 gb|AAH62854.1| Rplp0 protein [Danio rerio]
 gb|AAI46739.1| Rplp0 protein [Danio rerio]
Length=316

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TED L ++F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEDALHKRFLEGVRNIASVCLQIGYPTLASI  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++ VETDY+FPLA+KVK YL DP+
Sbjct  238  PHTIINGYKRVLAVTVETDYTFPLAEKVKAYLADPT  273



>gb|KDD72928.1| hypothetical protein H632_c2720p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=273

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGI+PF+YGL++ +VYDNG++ +P+VLD+TEDDL+   + G++ V + SL +++PTLA+A
Sbjct  176  LGIKPFTYGLVLRNVYDNGALYNPKVLDITEDDLVAAMSRGIANVAAASLQLNFPTLASA  235

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +++G+KNVLS+AV TDYSFPLADKVK YL DPS F
Sbjct  236  PHSIVHGFKNVLSVAVATDYSFPLADKVKAYLADPSAF  273



>gb|KFQ02732.1| 60S acidic ribosomal protein P0, partial [Haliaeetus albicilla]
Length=262

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  156  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  215

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  216  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  253



>gb|ADU04571.1| 60S acidic ribosomal protein PO [Phaseolus vulgaris]
 gb|AGV54610.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L  RP   GL  L       V SPE  DLTEDDLLEKFA GVSMVT LSLAISYPTLAAA
Sbjct  181  LAFRPSHMGLGALLFIKMAPVFSPEGPDLTEDDLLEKFAAGVSMVTFLSLAISYPTLAAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PHM +N YKN+LS+A+ TDYSFP ADKVKEYLKDPSKF
Sbjct  241  PHMFVNAYKNLLSVAIATDYSFPEADKVKEYLKDPSKF  278



>ref|XP_007434308.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X1 [Python 
bivittatus]
 ref|XP_007434309.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X2 [Python 
bivittatus]
 ref|XP_007434310.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X3 [Python 
bivittatus]
Length=315

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GLI+  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLIIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTVASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDYSFPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYSFPLAEKVKAFLADPSAF  275



>gb|KFO65132.1| 60S acidic ribosomal protein P0, partial [Corvus brachyrhynchos]
Length=279

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_008639852.1| PREDICTED: 60S acidic ribosomal protein P0, partial [Corvus brachyrhynchos]
Length=280

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_009915794.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P0, partial [Haliaeetus albicilla]
Length=272

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  168  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  227

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  228  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  265



>sp|P50345.1|RLA0_LUPLU RecName: Full=60S acidic ribosomal protein P0 [Lupinus luteus]
 emb|CAA63786.1| P0 ribosomal protein [Lupinus luteus]
Length=322

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            LGIRPFSYGL+VLSVYDNGSV  PEVLDLTEDDLLEKFA+GVS       +   P  +AA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFKPEVLDLTEDDLLEKFAIGVSQCYFSDTSHFIPNPSAA  240

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKFavaaapvaaaaagsapaaaaaa  300
            PH+ IN YKNVL++AV T+YSFP AD+VKEYLKDPSKFA  AA  A AA   A  AAAA 
Sbjct  241  PHVFINAYKNVLAVAVATEYSFPQADEVKEYLKDPSKFAAVAAAAAPAADSGAAPAAAAK  300

Query  299  eekkeepeeesEDEMGFSLFDD  234
             EK+EEP EES+DEMGF LFD+
Sbjct  301  AEKEEEPAEESDDEMGFGLFDE  322



>gb|AEA51182.1| acidic ribosomal protein P0, partial [Oryzias melastigma]
Length=212

 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GLI+  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  75   LNISPFSFGLIIQQVYDNGSVYSPEVLDITEASLQARFLEGVRNIASVCLEIGYPTLASI  134

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++AVETDY+FP A+KVK +L DPS
Sbjct  135  PHSVINGYKRVLTVAVETDYTFPQAEKVKAFLADPS  170



>gb|AAI04646.1| RPLP0 protein, partial [Homo sapiens]
Length=157

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  18   LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASV  77

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL+++VETDY+FPLA+KVK +L DPS F
Sbjct  78   PHSIINGYKRVLALSVETDYTFPLAEKVKAFLADPSAF  115



>ref|XP_010396743.1| PREDICTED: 60S acidic ribosomal protein P0 [Corvus cornix cornix]
Length=290

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>gb|KFQ10333.1| 60S acidic ribosomal protein P0, partial [Leptosomus discolor]
Length=279

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_004545259.1| PREDICTED: 60S acidic ribosomal protein P0-like [Maylandia zebra]
 ref|XP_005731359.1| PREDICTED: 60S acidic ribosomal protein P0-like [Pundamilia nyererei]
Length=316

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEASLHTRFLEGVRNIASVCLEIGYPTLASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  378
            PH +INGYK VL++AVETDYSFPLADKVK +L D
Sbjct  238  PHSVINGYKRVLAVAVETDYSFPLADKVKAFLAD  271



>ref|XP_003973625.1| PREDICTED: 60S acidic ribosomal protein P0-like [Takifugu rubripes]
Length=314

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TE  L  +F  GV  V S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNVASVCLEIGYPTLASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  378
            PH +INGYKNVL++ VET YSFPLADKVK YL D
Sbjct  238  PHTVINGYKNVLAVTVETGYSFPLADKVKAYLAD  271



>ref|XP_005918671.1| PREDICTED: 60S acidic ribosomal protein P0-like [Haplochromis 
burtoni]
Length=316

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNIASVCLEIGYPTLASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  378
            PH +INGYK VL++AVETDYSFPLADKVK +L D
Sbjct  238  PHSVINGYKRVLAVAVETDYSFPLADKVKAFLAD  271



>ref|XP_005421617.1| PREDICTED: 60S acidic ribosomal protein P0 [Geospiza fortis]
Length=312

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  173  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  232

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  233  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  270



>ref|XP_009582133.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P0, partial [Fulmarus glacialis]
Length=257

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  158  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  217

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH ++NGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  218  PHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  255



>ref|XP_003441603.1| PREDICTED: 60S acidic ribosomal protein P0 [Oreochromis niloticus]
Length=315

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNIASVCLEIGYPTLASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKD  378
            PH +INGYK VL++AVETDYSFPLADKVK +L D
Sbjct  238  PHSVINGYKRVLAVAVETDYSFPLADKVKAFLAD  271



>gb|AEA51110.1| 60S acidic ribosomal protein P0 [Oryzias melastigma]
Length=299

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GLI+  VYDNGSV SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSFGLIIQQVYDNGSVYSPEVLDITEASLQARFLEGVRNIASVCLEIGYPTLASI  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FP A++VK +L DPS F
Sbjct  238  PHSVINGYKRVLAVAVETDYTFPQAEEVKAFLADPSAF  275



>gb|KFZ54738.1| 60S acidic ribosomal protein P0, partial [Podiceps cristatus]
Length=261

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  160  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  219

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH ++NGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  220  PHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  257



>ref|XP_009487343.1| PREDICTED: 60S acidic ribosomal protein P0, partial [Pelecanus 
crispus]
 gb|KFQ54485.1| 60S acidic ribosomal protein P0, partial [Pelecanus crispus]
Length=291

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  154  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  213

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  214  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  251



>gb|KFQ53080.1| 60S acidic ribosomal protein P0, partial [Nestor notabilis]
Length=270

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  160  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  219

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH ++NGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  220  PHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  257



>gb|AAH49058.1| Rplp0 protein [Danio rerio]
Length=316

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFSYGLI+  VYDNGSV  PEVLD+TED L ++F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYGPEVLDITEDALHKRFLEGVRNIASVCLQIGYPTLASI  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPS  372
            PH +INGYK VL++ VETDY+FPLA+KVK YL DP+
Sbjct  238  PHTIINGYKRVLAVTVETDYTFPLAEKVKAYLADPT  273



>ref|XP_005054917.1| PREDICTED: 60S acidic ribosomal protein P0 [Ficedula albicollis]
Length=324

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_002199561.1| PREDICTED: 60S acidic ribosomal protein P0 [Taeniopygia guttata]
Length=318

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_005524479.1| PREDICTED: 60S acidic ribosomal protein P0 [Pseudopodoces humilis]
Length=318

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_005493516.1| PREDICTED: 60S acidic ribosomal protein P0 [Zonotrichia albicollis]
 ref|XP_009090551.1| PREDICTED: 60S acidic ribosomal protein P0 [Serinus canaria]
Length=318

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_008924020.1| PREDICTED: 60S acidic ribosomal protein P0 [Manacus vitellinus]
 gb|KFW82516.1| 60S acidic ribosomal protein P0 [Manacus vitellinus]
Length=318

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_010133581.1| PREDICTED: 60S acidic ribosomal protein P0, partial [Buceros 
rhinoceros silvestris]
Length=300

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  659  LGIRPFSYGLIVLSVYDNGSVXSPevldlteddllEKFALGVSMVTSLSLAISYPTLAAA  480
            L I PFS+GL++  V+DNGS+ +PEVLD+TE+ L ++F  GV  V S+ L I YPT+A+ 
Sbjct  160  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  219

Query  479  PHMLINGYKNVLSIAVETDYSFPLADKVKEYLKDPSKF  366
            PH +INGYK VL++AVETDY+FPLA+KVK +L DPS F
Sbjct  220  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  257



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320