BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF044O24

Length=573
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773920.1|  PREDICTED: CAAX prenyl protease 1 homolog          132   7e-33   Nicotiana sylvestris
ref|XP_009615410.1|  PREDICTED: CAAX prenyl protease 1 homolog          131   2e-32   Nicotiana tomentosiformis
gb|EYU35101.1|  hypothetical protein MIMGU_mgv1a006971mg                129   9e-32   Erythranthe guttata [common monkey flower]
emb|CDP08773.1|  unnamed protein product                                128   1e-31   Coffea canephora [robusta coffee]
gb|KDO86286.1|  hypothetical protein CISIN_1g014430mg                   125   4e-31   Citrus sinensis [apfelsine]
ref|XP_011093122.1|  PREDICTED: CAAX prenyl protease 1 homolog          127   6e-31   Sesamum indicum [beniseed]
ref|XP_004229884.1|  PREDICTED: CAAX prenyl protease 1 homolog          126   8e-31   Solanum lycopersicum
ref|XP_002277525.1|  PREDICTED: CAAX prenyl protease 1 homolog          126   8e-31   Vitis vinifera
ref|XP_002511907.1|  caax prenyl protease ste24, putative               126   8e-31   Ricinus communis
ref|XP_006491174.1|  PREDICTED: CAAX prenyl protease 1 homolog          125   1e-30   Citrus sinensis [apfelsine]
ref|XP_006444969.1|  hypothetical protein CICLE_v10020054mg             125   2e-30   
ref|XP_009349805.1|  PREDICTED: CAAX prenyl protease 1 homolog          125   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_009628878.1|  PREDICTED: CAAX prenyl protease 1 homolog          124   4e-30   Nicotiana tomentosiformis
ref|XP_009762715.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    124   5e-30   Nicotiana sylvestris
ref|XP_009762714.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    124   5e-30   Nicotiana sylvestris
ref|XP_006339615.1|  PREDICTED: CAAX prenyl protease 1 homolog          124   5e-30   Solanum tuberosum [potatoes]
ref|XP_007139795.1|  hypothetical protein PHAVU_008G059300g             124   5e-30   Phaseolus vulgaris [French bean]
ref|XP_007218053.1|  hypothetical protein PRUPE_ppa006168mg             124   6e-30   Prunus persica
ref|XP_003552415.1|  PREDICTED: CAAX prenyl protease 1 homolog          123   9e-30   Glycine max [soybeans]
ref|XP_008232992.1|  PREDICTED: CAAX prenyl protease 1 homolog          123   1e-29   Prunus mume [ume]
ref|XP_008346138.1|  PREDICTED: CAAX prenyl protease 1 homolog          122   2e-29   
ref|XP_003534542.1|  PREDICTED: CAAX prenyl protease 1 homolog          122   3e-29   Glycine max [soybeans]
gb|KHN29321.1|  CAAX prenyl protease 1 like                             121   3e-29   Glycine soja [wild soybean]
gb|KHM99334.1|  CAAX prenyl protease 1 like                             122   3e-29   Glycine soja [wild soybean]
gb|KCW78104.1|  hypothetical protein EUGRSUZ_D02317                     121   3e-29   Eucalyptus grandis [rose gum]
ref|XP_010053753.1|  PREDICTED: CAAX prenyl protease 1 homolog          122   4e-29   Eucalyptus grandis [rose gum]
ref|XP_010112964.1|  CAAX prenyl protease 1-like protein                122   4e-29   
ref|XP_011036976.1|  PREDICTED: CAAX prenyl protease 1 homolog          121   4e-29   Populus euphratica
ref|XP_002320821.1|  CAAX protease family protein                       121   4e-29   Populus trichocarpa [western balsam poplar]
ref|XP_002302601.1|  CAAX protease family protein                       121   5e-29   Populus trichocarpa [western balsam poplar]
ref|XP_008805562.1|  PREDICTED: CAAX prenyl protease 1 homolog          121   6e-29   Phoenix dactylifera
ref|XP_010919128.1|  PREDICTED: CAAX prenyl protease 1 homolog          121   6e-29   Elaeis guineensis
ref|XP_004306744.1|  PREDICTED: CAAX prenyl protease 1 homolog          121   6e-29   Fragaria vesca subsp. vesca
ref|XP_009400731.1|  PREDICTED: CAAX prenyl protease 1 homolog          120   8e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004155836.1|  PREDICTED: CAAX prenyl protease 1 homolog          120   1e-28   
ref|XP_010261328.1|  PREDICTED: CAAX prenyl protease 1 homolog          120   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_004492786.1|  PREDICTED: CAAX prenyl protease 1 homolog          120   2e-28   
ref|XP_004133850.1|  PREDICTED: CAAX prenyl protease 1 homolog          120   2e-28   Cucumis sativus [cucumbers]
gb|EPS68077.1|  hypothetical protein M569_06696                         115   2e-28   Genlisea aurea
ref|XP_008438005.1|  PREDICTED: CAAX prenyl protease 1 homolog          120   2e-28   Cucumis melo [Oriental melon]
gb|AFK35300.1|  unknown                                                 117   2e-28   Lotus japonicus
gb|KHG15702.1|  CAAX prenyl protease 1 -like protein                    119   3e-28   Gossypium arboreum [tree cotton]
gb|KJB41392.1|  hypothetical protein B456_007G102500                    119   3e-28   Gossypium raimondii
ref|XP_010669929.1|  PREDICTED: CAAX prenyl protease 1 homolog          119   4e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|ADE76166.1|  unknown                                                 115   6e-28   Picea sitchensis
ref|XP_004306743.1|  PREDICTED: CAAX prenyl protease 1 homolog          118   6e-28   Fragaria vesca subsp. vesca
ref|XP_006828772.1|  hypothetical protein AMTR_s00001p00094700          117   8e-28   Amborella trichopoda
ref|XP_007051723.1|  Peptidase family M48 family protein                117   1e-27   
ref|XP_003624056.1|  CAAX prenyl protease-like protein                  117   1e-27   Medicago truncatula
ref|XP_010933964.1|  PREDICTED: CAAX prenyl protease 1 homolog          116   3e-27   Elaeis guineensis
ref|XP_009393943.1|  PREDICTED: CAAX prenyl protease 1 homolog          116   3e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001783632.1|  predicted protein                                  115   5e-27   
ref|XP_002961362.1|  hypothetical protein SELMODRAFT_266600             115   7e-27   Selaginella moellendorffii
ref|XP_008810111.1|  PREDICTED: CAAX prenyl protease 1 homolog          115   7e-27   Phoenix dactylifera
ref|XP_010556569.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    112   6e-26   Tarenaya hassleriana [spider flower]
ref|XP_006647687.1|  PREDICTED: CAAX prenyl protease 1 homolog          111   1e-25   Oryza brachyantha
ref|XP_010544403.1|  PREDICTED: CAAX prenyl protease 1 homolog          111   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_001780822.1|  predicted protein                                  110   4e-25   
gb|KDP28583.1|  hypothetical protein JCGZ_14354                         109   7e-25   Jatropha curcas
ref|XP_003570103.1|  PREDICTED: CAAX prenyl protease 1 homolog          109   8e-25   Brachypodium distachyon [annual false brome]
ref|NP_001047739.1|  Os02g0680400                                       108   1e-24   
gb|EEC73787.1|  hypothetical protein OsI_08473                          108   1e-24   Oryza sativa Indica Group [Indian rice]
emb|CDY07191.1|  BnaCnng02060D                                          108   2e-24   
ref|XP_009111448.1|  PREDICTED: CAAX prenyl protease 1 homolog          108   2e-24   Brassica rapa
emb|CDY48517.1|  BnaA09g00060D                                          108   2e-24   Brassica napus [oilseed rape]
ref|NP_567212.1|  CAAX prenyl protease 1 homolog                        108   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422802.1|  PREDICTED: CAAX prenyl protease 1 homolog          108   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_002874990.1|  ATSTE24                                            108   2e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_010427521.1|  PREDICTED: CAAX prenyl protease 1 homolog          108   2e-24   Camelina sativa [gold-of-pleasure]
gb|AAL07084.1|  putative CAAX prenyl protease                           108   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AFW63375.1|  CAAX prenyl protease 1                                  110   2e-24   
ref|NP_001131195.1|  uncharacterized protein LOC100192503               108   2e-24   Zea mays [maize]
ref|XP_002454476.1|  hypothetical protein SORBIDRAFT_04g031850          108   2e-24   Sorghum bicolor [broomcorn]
gb|KFK30712.1|  hypothetical protein AALP_AA6G017800                    108   3e-24   Arabis alpina [alpine rockcress]
ref|XP_004953446.1|  PREDICTED: CAAX prenyl protease 1 homolog          108   3e-24   Setaria italica
emb|CAL26913.1|  CAAX peptidase                                         107   5e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006853576.1|  hypothetical protein AMTR_s00032p00244440          100   6e-24   
ref|XP_010456236.1|  PREDICTED: CAAX prenyl protease 1 homolog          107   6e-24   Camelina sativa [gold-of-pleasure]
gb|AAM76469.1|  putative CAAX prenyl protease                           100   6e-24   Gossypium herbaceum [Arabian cotton]
emb|CDX91888.1|  BnaC03g31900D                                          106   8e-24   
emb|CDX74353.1|  BnaA03g26940D                                          106   9e-24   
ref|XP_009134527.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    106   9e-24   Brassica rapa
ref|XP_006286757.1|  hypothetical protein CARUB_v10003198mg             106   9e-24   Capsella rubella
gb|AAK39514.1|AF353722_1  CaaX processing zinc-metallo endoprotease     106   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001152504.1|  CAAX prenyl protease 1                             106   1e-23   Zea mays [maize]
ref|XP_008643874.1|  PREDICTED: CAAX prenyl protease 1 isoform X2       106   1e-23   
ref|XP_008643873.1|  PREDICTED: CAAX prenyl protease 1 isoform X1       106   1e-23   Zea mays [maize]
ref|XP_006396278.1|  hypothetical protein EUTSA_v10028603mg             106   2e-23   
gb|AAM76472.1|  putative CAAX prenyl protease                         97.1    1e-22   Gossypium hirsutum [American cotton]
ref|XP_004308344.1|  PREDICTED: CAAX prenyl protease 1 homolog          103   2e-22   Fragaria vesca subsp. vesca
gb|EMT24778.1|  CAAX prenyl protease 1-like protein                     102   2e-22   
gb|AAB61028.1|  A_IG002N01.21 gene product                              100   7e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CAB80941.1|  putative CAAX prenyl protease                        93.6    5e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ESA09906.1|  hypothetical protein GLOINDRAFT_80760                 90.5    5e-18   
gb|AIC32889.1|  STE24                                                 90.5    6e-18   Puccinellia tenuiflora
ref|XP_009134526.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  90.5    7e-18   Brassica rapa
emb|CBJ27157.1|  CaaX prenyl protease Ste24                           87.0    2e-16   Ectocarpus siliculosus
ref|XP_002945691.1|  hypothetical protein VOLCADRAFT_78672            85.5    4e-16   Volvox carteri f. nagariensis
emb|CAN83040.1|  hypothetical protein VITISV_034339                   83.6    5e-16   Vitis vinifera
ref|XP_003622455.1|  CAAX prenyl protease-like protein                77.8    5e-15   
emb|CCI48758.1|  unnamed protein product                              82.0    8e-15   Albugo candida
emb|CCA18761.1|  CAAX prenyl protease 1 putative                      82.0    8e-15   Albugo laibachii Nc14
ref|XP_002292916.1|  predicted protein                                80.5    2e-14   Thalassiosira pseudonana CCMP1335
ref|XP_002900396.1|  CAAX prenyl protease 1                           80.5    3e-14   Phytophthora infestans T30-4
ref|XP_003677696.1|  hypothetical protein NCAS_0H00350                80.1    4e-14   Naumovozyma castellii CBS 4309
ref|XP_009042161.1|  hypothetical protein AURANDRAFT_34438            77.8    4e-14   Aureococcus anophagefferens
ref|XP_009497192.1|  hypothetical protein H696_05044                  79.3    6e-14   Fonticula alba
ref|XP_004348317.1|  CAAX prenyl protease 1                           79.7    6e-14   Capsaspora owczarzaki ATCC 30864
gb|EME39248.1|  hypothetical protein DOTSEDRAFT_75093                 79.3    6e-14   Dothistroma septosporum NZE10
ref|XP_009532258.1|  hypothetical protein PHYSODRAFT_250864           79.3    7e-14   Phytophthora sojae
emb|CDH09260.1|  probable CAAX prenyl protease 1                      79.0    9e-14   Zygosaccharomyces bailii ISA1307
emb|CDH15706.1|  probable CAAX prenyl protease 1                      78.6    1e-13   Zygosaccharomyces bailii ISA1307
emb|CDF87226.1|  BN860_01640g1_1                                      78.6    1e-13   Zygosaccharomyces bailii CLIB 213
gb|ETL45293.1|  hypothetical protein L916_04606                       77.8    2e-13   Phytophthora parasitica
gb|ETK91894.1|  hypothetical protein L915_04651                       77.8    2e-13   Phytophthora parasitica
gb|ETI52023.1|  hypothetical protein F443_04763                       77.8    2e-13   Phytophthora parasitica P1569
ref|XP_008902128.1|  hypothetical protein PPTG_09033                  77.8    2e-13   Phytophthora parasitica INRA-310
gb|ETO80780.1|  hypothetical protein F444_04815                       77.8    2e-13   Phytophthora parasitica P1976
gb|ETL98448.1|  hypothetical protein L917_04490                       77.8    2e-13   Phytophthora parasitica
gb|KEH18809.1|  CAAX prenyl protease-like protein                     77.4    2e-13   Medicago truncatula
ref|XP_002181639.1|  predicted protein                                77.8    2e-13   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_453545.1|  hypothetical protein                                77.4    3e-13   Kluyveromyces lactis
ref|XP_011104176.1|  ste24p                                           77.0    4e-13   
ref|XP_002174544.2|  CAA Xprenyl protease                             77.0    4e-13   Schizosaccharomyces japonicus yFS275
pdb|4IL3|A  Chain A, Crystal Structure Of S. Mikatae Ste24p           77.0    4e-13   Saccharomyces mikatae
gb|AJR71904.1|  Ste24p                                                77.0    4e-13   Saccharomyces cerevisiae YJM1450
gb|AJR68004.1|  Ste24p                                                77.0    4e-13   Saccharomyces cerevisiae YJM1250
gb|AJR62890.1|  Ste24p                                                77.0    4e-13   Saccharomyces cerevisiae YJM450
gb|AJR67380.1|  Ste24p                                                77.0    4e-13   Saccharomyces cerevisiae YJM1244
gb|AJR59949.1|  Ste24p                                                77.0    4e-13   Saccharomyces cerevisiae YJM193
gb|EDV12854.1|  CAAX prenyl protease 1                                77.0    4e-13   Saccharomyces cerevisiae RM11-1a
gb|EDN63433.1|  zinc metalloprotease                                  77.0    4e-13   Saccharomyces cerevisiae YJM789
gb|AJR63874.1|  Ste24p                                                76.6    4e-13   Saccharomyces cerevisiae YJM456
gb|AJR61585.1|  Ste24p                                                76.6    4e-13   Saccharomyces cerevisiae YJM271
gb|AJR60606.1|  Ste24p                                                76.6    4e-13   Saccharomyces cerevisiae YJM244
emb|CAY80831.1|  Ste24p                                               76.6    4e-13   Saccharomyces cerevisiae EC1118
gb|EDZ71132.1|  YJR117Wp-like protein                                 76.6    4e-13   Saccharomyces cerevisiae AWRI1631
gb|EHN06284.1|  Ste24p                                                76.6    4e-13   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|AJR60934.1|  Ste24p                                                76.6    4e-13   Saccharomyces cerevisiae YJM248
ref|NP_012651.1|  Ste24p                                              76.6    4e-13   Saccharomyces cerevisiae S288C
ref|XP_008611054.1|  hypothetical protein SDRG_07015                  76.6    4e-13   Saprolegnia diclina VS20
gb|AJR63219.1|  Ste24p                                                76.6    5e-13   Saccharomyces cerevisiae YJM451
gb|EWG95205.1|  Ste24p                                                76.6    5e-13   Saccharomyces cerevisiae R103
gb|EJT41596.1|  STE24-like protein                                    76.6    5e-13   Saccharomyces kudriavzevii IFO 1802
gb|EHN01607.1|  Ste24p                                                76.6    5e-13   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
ref|XP_003880033.1|  putative peptidase family M48 domain-contain...  76.3    6e-13   Neospora caninum Liverpool
ref|XP_009822213.1|  hypothetical protein H257_00958                  76.3    7e-13   Aphanomyces astaci
dbj|BAO41720.1|  CAAX prenyl protease 1                               75.9    8e-13   Kluyveromyces marxianus DMKU3-1042
emb|CDO93753.1|  unnamed protein product                              75.9    8e-13   Kluyveromyces dobzhanskii CBS 2104
dbj|BAP73165.1|  CAAX prenyl protease 1                               75.9    8e-13   Kluyveromyces marxianus
ref|XP_447605.1|  hypothetical protein                                75.9    9e-13   [Candida] glabrata
ref|XP_008861314.1|  hypothetical protein H310_00342                  75.5    1e-12   Aphanomyces invadans
emb|CCK69867.1|  hypothetical protein KNAG_0D01150                    75.5    1e-12   Kazachstania naganishii CBS 8797
ref|XP_002553545.1|  KLTH0E01298p                                     75.1    1e-12   Lachancea thermotolerans CBS 6340
gb|KDO33073.1|  hypothetical protein SPRG_01888                       75.1    2e-12   Saprolegnia parasitica CBS 223.65
gb|ESS30154.1|  CAAX metallo endopeptidase                            72.4    2e-12   Toxoplasma gondii VEG
gb|KFG61038.1|  CAAX metallo endopeptidase                            72.4    2e-12   Toxoplasma gondii RUB
gb|KGO76072.1|  Peptidase M48                                         74.7    2e-12   Penicillium italicum
ref|XP_005651455.1|  hypothetical protein COCSUDRAFT_27312            74.3    3e-12   Coccomyxa subellipsoidea C-169
gb|AJR64199.1|  Ste24p                                                74.3    3e-12   Saccharomyces cerevisiae YJM470
ref|XP_002496515.1|  ZYRO0D01892p                                     74.7    3e-12   Zygosaccharomyces rouxii
gb|KFH71808.1|  hypothetical protein MVEG_02102                       74.3    3e-12   Mortierella verticillata NRRL 6337
ref|XP_003850777.1|  CAAX prenyl protease 1                           73.6    5e-12   Zymoseptoria tritici IPO323
dbj|GAA95272.1|  hypothetical protein E5Q_01928                       73.6    6e-12   Mixia osmundae IAM 14324
gb|EWM26686.1|  caax prenyl protease 1                                73.6    6e-12   Nannochloropsis gaditana
ref|XP_005100140.1|  PREDICTED: CAAX prenyl protease 1 homolog        73.6    7e-12   Aplysia californica
gb|KGO40189.1|  Peptidase M48                                         73.2    7e-12   Penicillium expansum
ref|XP_002565802.1|  Pc22g18990                                       73.2    8e-12   Penicillium rubens Wisconsin 54-1255
gb|EPB83925.1|  hypothetical protein HMPREF1544_09315                 73.2    8e-12   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_001623710.1|  predicted protein                                73.2    8e-12   Nematostella vectensis
gb|EMF09871.1|  CaaX prenyl protease                                  73.2    8e-12   Sphaerulina musiva SO2202
ref|XP_003685564.1|  hypothetical protein TPHA_0E00340                73.2    9e-12   Tetrapisispora phaffii CBS 4417
emb|CEP19164.1|  hypothetical protein                                 72.8    9e-12   Parasitella parasitica
emb|CEJ00851.1|  hypothetical protein RMCBS344292_14897               72.8    9e-12   Rhizopus microsporus
dbj|GAN04268.1|  metallopeptidase                                     72.8    9e-12   Mucor ambiguus
gb|KIW01377.1|  hypothetical protein PV09_07145                       72.8    9e-12   Verruconis gallopava
emb|CEG66514.1|  hypothetical protein RMATCC62417_03079               72.8    9e-12   Rhizopus microsporus
ref|XP_008886307.1|  CAAX metallo endopeptidase                       72.8    1e-11   
ref|XP_002369947.1|  peptidase family M48 domain-containing protein   72.4    1e-11   Toxoplasma gondii ME49
gb|EPZ36837.1|  Peptidase M48 domain-containing protein               70.9    1e-11   Rozella allomycis CSF55
ref|XP_001639206.1|  predicted protein                                72.8    1e-11   Nematostella vectensis
emb|CDJ60176.1|  peptidase family M48 domain-containing protein, ...  72.4    2e-11   Eimeria maxima
ref|XP_007584901.1|  putative prenyl protease protein                 72.0    2e-11   
gb|ETO31171.1|  hypothetical protein RFI_05949                        69.3    2e-11   Reticulomyxa filosa
gb|EKV19760.1|  CaaX prenyl protease Ste24                            72.0    2e-11   Penicillium digitatum PHI26
ref|XP_009152612.1|  STE24 endopeptidase                              72.0    2e-11   Exophiala dermatitidis NIH/UT8656
emb|CDI76342.1|  peptidase family M48 domain-containing protein, ...  72.0    2e-11   Eimeria acervulina
emb|CDS07769.1|  hypothetical protein LRAMOSA01718                    72.0    2e-11   Lichtheimia ramosa
gb|EZF29046.1|  hypothetical protein H101_07272                       68.6    2e-11   Trichophyton interdigitale H6
emb|CDJ68920.1|  peptidase family M48 domain-containing protein, ...  71.6    2e-11   Eimeria necatrix
ref|XP_003661486.1|  hypothetical protein MYCTH_2300946               71.6    3e-11   Thermothelomyces thermophila ATCC 42464
ref|XP_007780353.1|  STE24 endopeptidase                              71.6    3e-11   Coniosporium apollinis CBS 100218
emb|CDM27808.1|  CAAX prenyl protease 1                               71.2    3e-11   Penicillium roqueforti FM164
emb|CDJ42877.1|  peptidase family M48 domain-containing protein, ...  71.2    3e-11   Eimeria tenella
emb|CDJ47135.1|  peptidase family M48 domain-containing protein, ...  71.2    3e-11   Eimeria brunetti
emb|CDH48818.1|  prenyl protease                                      70.9    4e-11   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003649011.1|  hypothetical protein THITE_2107126               70.9    5e-11   Thielavia terrestris NRRL 8126
ref|XP_008553204.1|  PREDICTED: CAAX prenyl protease 1 homolog        70.5    5e-11   Microplitis demolitor
gb|EFZ21267.1|  hypothetical protein SINV_07351                       70.5    5e-11   
gb|KIW82886.1|  hypothetical protein Z517_02129                       70.9    5e-11   Fonsecaea pedrosoi CBS 271.37
ref|XP_002377095.1|  CaaX prenyl protease Ste24                       70.1    5e-11   Aspergillus flavus NRRL3357
ref|XP_011175799.1|  PREDICTED: CAAX prenyl protease 1 homolog        70.5    5e-11   Solenopsis invicta [imported red fire ant]
gb|KEY76113.1|  CaaX prenyl protease Ste24                            70.5    6e-11   Aspergillus fumigatus var. RP-2014
gb|EDP50136.1|  CaaX prenyl protease Ste24                            70.5    6e-11   Aspergillus fumigatus A1163
ref|XP_752066.2|  CaaX prenyl protease Ste24                          70.5    6e-11   Aspergillus fumigatus Af293
ref|XP_001949388.2|  PREDICTED: CAAX prenyl protease 1 homolog        70.1    7e-11   Acyrthosiphon pisum
ref|XP_002427421.1|  caax prenyl protease ste24, putative             70.5    7e-11   Pediculus humanus corporis [human body lice]
ref|XP_003669587.1|  hypothetical protein NDAI_0D00300                70.5    7e-11   Naumovozyma dairenensis CBS 421
ref|XP_007788183.1|  putative caax prenyl protease 1 protein          69.7    8e-11   
gb|AAX27871.2|  SJCHGC08945 protein                                   66.2    1e-10   Schistosoma japonicum
ref|XP_001821320.1|  CAAX prenyl protease 1                           69.7    1e-10   Aspergillus oryzae RIB40
gb|KIX97886.1|  hypothetical protein Z520_06664                       69.7    1e-10   Fonsecaea multimorphosa CBS 102226
ref|XP_001267265.1|  CaaX prenyl protease Ste24                       69.7    1e-10   Aspergillus fischeri NRRL 181
gb|KHJ35024.1|  putative peptidase family m48                         69.7    1e-10   Erysiphe necator
ref|XP_008031232.1|  hypothetical protein SETTUDRAFT_35606            69.7    1e-10   Exserohilum turcica Et28A
ref|XP_009028164.1|  hypothetical protein HELRODRAFT_193946           70.1    1e-10   Helobdella robusta
ref|XP_003954896.1|  hypothetical protein KAFR_0A03260                69.3    2e-10   Kazachstania africana CBS 2517
ref|XP_007688928.1|  hypothetical protein COCMIDRAFT_27157            69.3    2e-10   Bipolaris oryzae ATCC 44560
ref|XP_007712871.1|  hypothetical protein COCCADRAFT_37287            69.3    2e-10   Bipolaris zeicola 26-R-13
gb|EMD85103.1|  hypothetical protein COCHEDRAFT_1035767               69.3    2e-10   Bipolaris maydis C5
gb|EGD96703.1|  CaaX prenyl protease                                  68.9    2e-10   Trichophyton tonsurans CBS 112818
ref|XP_002112567.1|  hypothetical protein TRIADDRAFT_25296            68.9    2e-10   Trichoplax adhaerens
gb|ELU11443.1|  hypothetical protein CAPTEDRAFT_171238                68.9    2e-10   Capitella teleta
gb|KIW26412.1|  hypothetical protein PV07_09509                       68.9    2e-10   Cladophialophora immunda
gb|EPS28736.1|  hypothetical protein PDE_03682                        68.9    2e-10   Penicillium oxalicum 114-2
ref|XP_011398178.1|  CAAX prenyl protease 1-like protein              68.9    2e-10   Auxenochlorella protothecoides
ref|XP_007751798.1|  STE24 endopeptidase                              68.9    2e-10   Cladophialophora psammophila CBS 110553
gb|KIW94481.1|  hypothetical protein Z519_04457                       68.9    2e-10   Cladophialophora bantiana CBS 173.52
ref|XP_003236858.1|  CaaX prenyl protease                             68.9    2e-10   Trichophyton rubrum CBS 118892
gb|EGE06070.1|  CAAX prenyl protease                                  68.9    2e-10   Trichophyton equinum CBS 127.97
ref|XP_006681887.1|  hypothetical protein BATDEDRAFT_17759            68.6    2e-10   Batrachochytrium dendrobatidis JAM81
ref|XP_003023010.1|  hypothetical protein TRV_02831                   68.9    2e-10   Trichophyton verrucosum HKI 0517
ref|XP_003172087.1|  CAAX prenyl protease 1                           68.6    2e-10   Nannizzia gypsea CBS 118893
ref|XP_001939034.1|  CaaX prenyl protease                             68.6    2e-10   Pyrenophora tritici-repentis Pt-1C-BFP
gb|ENH82556.1|  prenyl protease ste24                                 68.6    2e-10   
gb|KIX06592.1|  hypothetical protein Z518_04568                       68.6    3e-10   Rhinocladiella mackenziei CBS 650.93
ref|XP_001271650.1|  CaaX prenyl protease Ste24                       68.6    3e-10   Aspergillus clavatus NRRL 1
gb|EPX72601.1|  CAA Xprenyl protease                                  68.6    3e-10   Schizosaccharomyces octosporus yFS286
gb|EAR85063.2|  M48 family peptidase                                  68.9    3e-10   Tetrahymena thermophila SB210
ref|XP_003300873.1|  hypothetical protein PTT_12236                   68.6    3e-10   
ref|XP_002627156.1|  CaaX prenyl protease                             68.6    3e-10   Blastomyces gilchristii SLH14081
ref|XP_007283748.1|  prenyl protease                                  68.2    3e-10   
ref|XP_007754023.1|  STE24 endopeptidase                              68.2    4e-10   Cladophialophora yegresii CBS 114405
ref|XP_002842311.1|  hypothetical protein                             68.2    4e-10   Tuber melanosporum Mel28
ref|XP_001032726.1|  Peptidase family M48 containing protein          68.6    4e-10   
ref|XP_008724234.1|  hypothetical protein G647_10020                  68.2    4e-10   Cladophialophora carrionii CBS 160.54
gb|EFX04750.1|  prenyl protease ste24                                 68.6    4e-10   Grosmannia clavigera kw1407
gb|EAR82576.3|  CAAX prenyl protease                                  67.8    4e-10   Tetrahymena thermophila SB210
gb|EWG42807.1|  STE24 endopeptidase                                   68.2    4e-10   Fusarium verticillioides 7600
ref|XP_001030239.2|  Peptidase family M48 containing protein          68.2    4e-10   
ref|XP_001911737.1|  hypothetical protein                             68.2    4e-10   Podospora anserina S mat+
ref|XP_006696845.1|  ribosomal protein L34-like protein               68.6    4e-10   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_002843395.1|  CAAX prenyl protease 1                           67.8    4e-10   Microsporum canis CBS 113480
gb|KEY67837.1|  hypothetical protein S7711_04975                      67.8    4e-10   Stachybotrys chartarum IBT 7711
gb|KFA62896.1|  hypothetical protein S40285_02256                     67.8    4e-10   Stachybotrys chlorohalonata IBT 40285
ref|XP_007917686.1|  putative caax prenyl protease 1 protein          67.8    5e-10   Phaeoacremonium minimum UCRPA7
ref|XP_007834407.1|  hypothetical protein PFICI_07635                 67.8    5e-10   Pestalotiopsis fici W106-1
ref|XP_005353368.1|  PREDICTED: CAAX prenyl protease 1 homolog        67.8    5e-10   
gb|KIL91310.1|  hypothetical protein FAVG1_04924                      67.8    5e-10   Fusarium avenaceum
ref|XP_011299959.1|  PREDICTED: CAAX prenyl protease 1 homolog        67.4    5e-10   Fopius arisanus
emb|CEP63868.1|  LALA0S09e04302g1_1                                   67.8    5e-10   Lachancea lanzarotensis
gb|EIE81350.1|  hypothetical protein RO3G_06055                       67.4    5e-10   Rhizopus delemar RA 99-880
gb|KDN65807.1|  putative peptidase family M48                         67.4    6e-10   Colletotrichum sublineola
gb|EFQ29725.1|  peptidase family M48                                  67.4    6e-10   Colletotrichum graminicola M1.001
ref|XP_010624212.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  67.4    6e-10   Fukomys damarensis [Damara mole rat]
ref|XP_010624213.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  67.4    6e-10   Fukomys damarensis [Damara mole rat]
ref|XP_007681419.1|  hypothetical protein BAUCODRAFT_39566            67.4    6e-10   Baudoinia panamericana UAMH 10762
gb|KFH61944.1|  hypothetical protein MVEG_12278                       67.4    6e-10   Mortierella verticillata NRRL 6337
gb|KFY59517.1|  hypothetical protein V496_05652                       67.4    6e-10   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_007737162.1|  STE24 endopeptidase                              67.4    7e-10   Capronia epimyces CBS 606.96
ref|XP_001214622.1|  hypothetical protein ATEG_05444                  67.4    7e-10   Aspergillus terreus NIH2624
gb|KIV77520.1|  hypothetical protein PV11_09310                       67.4    7e-10   Exophiala sideris
ref|XP_007787411.1|  hypothetical protein EPUS_00192                  67.4    7e-10   Endocarpon pusillum Z07020
gb|KFY19341.1|  hypothetical protein V493_08005                       67.0    8e-10   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
emb|CCF47842.1|  peptidase family M48                                 67.0    8e-10   Colletotrichum higginsianum
gb|KFZ20107.1|  hypothetical protein V502_03363                       67.0    8e-10   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
ref|XP_007595308.1|  peptidase family M48                             67.0    8e-10   
ref|XP_002584079.1|  hypothetical protein UREG_04768                  67.0    8e-10   Uncinocarpus reesii 1704
dbj|BAG51388.1|  unnamed protein product                              65.1    9e-10   Homo sapiens [man]
gb|EEH10632.1|  CaaX prenyl protease                                  67.0    9e-10   
gb|EER44696.1|  CaaX prenyl protease                                  67.0    9e-10   
ref|XP_004181343.1|  hypothetical protein TBLA_0F02850                67.0    9e-10   
gb|EGC45621.1|  CaaX prenyl protease                                  67.0    9e-10   
ref|XP_001540370.1|  CaaX prenyl protease                             67.0    9e-10   
gb|ENH68811.1|  CAAX prenyl protease 1                                66.6    9e-10   
gb|EMT68098.1|  CAAX prenyl protease 1                                66.6    1e-09   
ref|XP_002796885.1|  CAAX prenyl protease                             66.6    1e-09   
gb|AAX78522.1|  CaaX prenyl protease                                  66.6    1e-09   
ref|XP_003050604.1|  predicted protein                                67.4    1e-09   
gb|ETE70091.1|  CAAX prenyl protease 1-like protein                   66.6    1e-09   
gb|KIW71892.1|  hypothetical protein PV04_00120                       67.0    1e-09   
ref|XP_003067440.1|  CAAX prenyl protease, putative                   66.6    1e-09   
gb|ERE83119.1|  putative CAAX prenyl protease 1 like protein          66.6    1e-09   
ref|XP_003501864.1|  PREDICTED: CAAX prenyl protease 1 homolog        67.0    1e-09   
ref|XP_001239931.1|  hypothetical protein CIMG_09552                  66.6    1e-09   
ref|XP_010759714.1|  hypothetical protein PADG_04087                  66.6    1e-09   
ref|XP_011330338.1|  PREDICTED: CAAX prenyl protease 1 homolog        66.6    1e-09   
ref|XP_011263701.1|  PREDICTED: CAAX prenyl protease 1 homolog        66.6    1e-09   
ref|XP_003395300.1|  PREDICTED: CAAX prenyl protease 1 homolog        66.6    1e-09   
gb|EXM07215.1|  STE24 endopeptidase                                   66.6    1e-09   
gb|EGU84979.1|  hypothetical protein FOXB_04560                       66.6    1e-09   
gb|KFY38041.1|  hypothetical protein V494_04536                       66.6    1e-09   
ref|XP_007720431.1|  STE24 endopeptidase                              66.6    1e-09   
gb|EXL53967.1|  STE24 endopeptidase                                   66.6    1e-09   
gb|KIV94338.1|  hypothetical protein PV10_02112                       66.6    1e-09   
dbj|GAM83450.1|  hypothetical protein ANO11243_014380                 66.6    1e-09   
gb|KFZ02509.1|  hypothetical protein V501_09542                       67.0    1e-09   
gb|EWZ02551.1|  STE24 endopeptidase                                   66.6    1e-09   
ref|XP_011121081.1|  hypothetical protein AOL_s00076g226              66.6    1e-09   
ref|XP_007430032.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  66.6    1e-09   
gb|KFY09356.1|  hypothetical protein V492_05514                       67.0    1e-09   
gb|KDR22915.1|  CAAX prenyl protease 1-like protein                   66.2    1e-09   
ref|XP_007430031.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  66.6    1e-09   
ref|XP_009848380.1|  hypothetical protein NEUTE1DRAFT_120293          66.2    1e-09   
ref|XP_003349500.1|  hypothetical protein SMAC_03088                  66.6    1e-09   
ref|XP_009949557.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.5    1e-09   
gb|KEF63154.1|  STE24 endopeptidase                                   66.2    1e-09   
ref|XP_010116516.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.5    1e-09   
ref|XP_009501173.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.5    1e-09   
gb|KFX89268.1|  hypothetical protein V490_07139                       66.2    1e-09   
ref|XP_961364.3|  CaaX prenyl protease Ste24                          66.2    1e-09   
gb|KEQ83545.1|  CAAX prenyl protease 1                                66.2    2e-09   
gb|KEQ90314.1|  hypothetical protein AUEXF2481DRAFT_9558              66.2    2e-09   
gb|KFY76197.1|  hypothetical protein V499_04041                       66.6    2e-09   
emb|CBH14419.1|  CAAX prenyl protease 1, putative                     66.2    2e-09   
gb|KEQ71244.1|  hypothetical protein M436DRAFT_83534                  66.2    2e-09   
emb|CCT67513.1|  probable zinc metallo-protease                       66.2    2e-09   
ref|XP_827211.1|  CAAX prenyl protease 1                              66.2    2e-09   
ref|XP_005428744.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
gb|KFY87676.1|  hypothetical protein V500_06835                       66.6    2e-09   
ref|XP_008935450.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.2    2e-09   
ref|XP_007892978.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
emb|CCC09083.1|  unnamed protein product                              66.2    2e-09   
gb|EGU13174.1|  putative CAAX prenyl protease                         66.2    2e-09   
ref|XP_004705331.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
ref|XP_008080326.1|  hypothetical protein GLAREA_07447                65.9    2e-09   
gb|KEQ63120.1|  hypothetical protein M437DRAFT_47585                  65.9    2e-09   
ref|XP_005868719.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
ref|XP_008149410.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
gb|ELR10214.1|  STE24 endopeptidase                                   65.9    2e-09   
emb|CCG83629.1|  CaaX prenyl protease Ste24                           65.9    2e-09   
ref|XP_003765468.1|  PREDICTED: CAAX prenyl protease 1 homolog        66.2    2e-09   
ref|XP_006758037.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
ref|XP_009254473.1|  hypothetical protein FPSE_03079                  65.9    2e-09   
ref|XP_006098203.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
ref|XP_005083884.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
ref|XP_006995844.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
ref|XP_004450692.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    2e-09   
gb|AFI71084.1|  putative CAAX prenyl protease                         62.8    2e-09   
ref|XP_011324509.1|  hypothetical protein FGSG_12839                  65.9    2e-09   
gb|KGB37699.1|  CAAX prenyl protease 1-like protein                   65.9    2e-09   
ref|XP_008473923.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
ref|XP_007077458.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
ref|XP_003989947.2|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
ref|XP_007950886.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.9    2e-09   
gb|KIN03786.1|  hypothetical protein OIDMADRAFT_158613                65.9    2e-09   
tpg|DAA01789.1|  TPA: CaaX prenyl protease                            65.9    2e-09   
gb|KIW50693.1|  hypothetical protein PV05_09481                       65.9    2e-09   
emb|CEJ80463.1|  hypothetical protein VHEMI00644                      65.9    2e-09   
gb|EYE94778.1|  CaaX prenyl protease Ste24                            65.5    2e-09   
gb|EKG14613.1|  Peptidase M48                                         65.9    2e-09   
ref|XP_539577.3|  PREDICTED: CAAX prenyl protease 1 homolog           65.5    2e-09   
ref|NP_593547.1|  CAAX prenyl protease (predicted)                    65.5    3e-09   
ref|XP_003683140.1|  hypothetical protein TDEL_0H00700                65.5    3e-09   
gb|EFB13524.1|  hypothetical protein PANDA_017398                     65.5    3e-09   
ref|XP_003709694.1|  CAAX prenyl protease 1                           65.5    3e-09   
gb|AAK38172.1|  Zmpste24                                              65.5    3e-09   
ref|XP_004740738.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    3e-09   
ref|XP_011233459.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    3e-09   
ref|XP_007492914.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    3e-09   
ref|XP_002927608.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    3e-09   
ref|XP_004740737.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    3e-09   
ref|XP_004415415.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    3e-09   
ref|XP_002715233.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    3e-09   
ref|XP_010158796.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.5    3e-09   
gb|KFY04966.1|  hypothetical protein V491_09229                       65.9    3e-09   
emb|CAD31792.1|  farnesylated-proteins converting enzyme-1            65.5    3e-09   
ref|XP_006737576.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    3e-09   
ref|XP_005898693.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    3e-09   
ref|XP_007492913.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    3e-09   
ref|XP_001381205.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    3e-09   
gb|EHK42306.1|  metallopeptidase M48                                  65.5    3e-09   
ref|XP_008710233.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.5    3e-09   
ref|XP_004665222.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    3e-09   
ref|XP_006503082.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.5    3e-09   
ref|XP_784397.3|  PREDICTED: CAAX prenyl protease 1 homolog           65.1    3e-09   
ref|NP_766288.1|  CAAX prenyl protease 1 homolog                      65.5    3e-09   
ref|NP_001101444.1|  CAAX prenyl protease 1 homolog                   65.5    3e-09   
ref|XP_009654014.1|  CAAX prenyl protease                             65.1    3e-09   
emb|CCD77520.1|  farnesylated-protein converting enzyme 1 (M48 fa...  65.5    3e-09   
gb|ELR54320.1|  CAAX prenyl protease 1-like protein                   65.5    3e-09   
ref|XP_010345849.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    3e-09   
ref|XP_004316653.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
gb|KEZ39101.1|  CAAX prenyl protease 1                                65.1    4e-09   
ref|XP_008589089.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_006886567.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_004266443.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_005607230.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_008999216.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_460632.1|  DEHA2F06248p                                        65.1    4e-09   
dbj|GAD96409.1|  conserved hypothetical protein                       65.9    4e-09   
ref|XP_004614273.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_002485210.1|  CaaX prenyl protease Ste24                       65.1    4e-09   
ref|XP_010345848.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_007114324.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_007164766.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_010352520.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_007977466.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_007453816.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_006188105.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_008589088.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_008063695.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_003891707.2|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_008063694.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_004678903.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
emb|CAH92474.1|  hypothetical protein                                 65.1    4e-09   
gb|ELQ35873.1|  CAAX prenyl protease 1                                65.1    4e-09   
ref|XP_011376276.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_010861023.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_004426071.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
gb|ELK19500.1|  CAAX prenyl protease 1 like protein                   64.7    4e-09   
ref|XP_010861024.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|NP_001179857.1|  CAAX prenyl protease 1 homolog                   65.1    4e-09   
dbj|BAA33727.1|  Ste24p                                               65.1    4e-09   
ref|NP_001288163.1|  zinc metallopeptidase STE24                      65.1    4e-09   
ref|XP_006061988.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_004450691.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_003937059.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_003273371.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_513352.2|  PREDICTED: CAAX prenyl protease 1 homolog           65.1    4e-09   
ref|NP_001244375.1|  CAAX prenyl protease 1 homolog                   65.1    4e-09   
ref|XP_004025583.1|  PREDICTED: CAAX prenyl protease 1 homolog        64.7    4e-09   
ref|XP_006964512.1|  metallopeptidase                                 65.1    4e-09   
ref|XP_006215922.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_005543897.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  64.7    4e-09   
ref|XP_008589087.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_007977465.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_002750699.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_004001889.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|NP_005848.2|  CAAX prenyl protease 1 homolog                      65.1    4e-09   
ref|NP_001126457.1|  CAAX prenyl protease 1 homolog                   65.1    4e-09   
ref|XP_010352519.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  65.1    4e-09   
ref|XP_006904034.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  65.1    4e-09   
ref|XP_005317922.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_003799067.1|  PREDICTED: CAAX prenyl protease 1 homolog        64.7    4e-09   
ref|XP_010958108.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  65.1    4e-09   
ref|XP_005970531.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
ref|XP_010995251.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  65.1    4e-09   
gb|AFI71086.1|  putative CAAX prenyl protease                         62.0    4e-09   
gb|AIC62085.1|  ZMPSTE24                                              65.1    4e-09   
gb|AAH37283.1|  Zinc metallopeptidase (STE24 homolog, S. cerevisiae)  65.1    4e-09   
ref|XP_006867649.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
pdb|2YPT|A  Chain A, Crystal Structure Of The Human Nuclear Membr...  65.1    4e-09   
gb|EMP29923.1|  CAAX prenyl protease 1 like protein                   63.5    4e-09   
gb|AFI71082.1|  putative CAAX prenyl protease                         62.0    4e-09   
ref|XP_003815473.1|  PREDICTED: CAAX prenyl protease 1 homolog        65.1    4e-09   
pdb|4AW6|A  Chain A, Crystal Structure Of The Human Nuclear Membr...  65.1    4e-09   
gb|EHB18901.1|  CAAX prenyl protease 1-like protein                   64.7    4e-09   
gb|ETS02977.1|  hypothetical protein M419DRAFT_129141                 65.5    5e-09   
ref|XP_010593553.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  64.7    5e-09   
emb|CDR49210.1|  RHTO0S24e00782g1_1                                   65.1    5e-09   
ref|XP_001643526.1|  hypothetical protein Kpol_1008p4                 64.7    5e-09   
ref|XP_003415368.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  64.7    5e-09   
ref|XP_010284930.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.2    5e-09   
gb|EMS19341.1|  STE24 endopeptidase                                   64.7    5e-09   
gb|KID79414.1|  Peptidase M48                                         64.7    5e-09   
gb|KFH43653.1|  CAAX prenyl protease-like protein                     64.7    5e-09   
ref|XP_007702220.1|  hypothetical protein COCSADRAFT_146923           64.7    5e-09   
dbj|GAA32070.1|  STE24 endopeptidase                                  64.7    5e-09   
ref|XP_004910060.1|  PREDICTED: CAAX prenyl protease 1 homolog        64.7    5e-09   
ref|XP_004851106.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  64.3    5e-09   
ref|XP_004851105.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  64.7    5e-09   
ref|XP_007295712.1|  peptidase family M48                             64.7    6e-09   
gb|KFP73521.1|  CAAX prenyl protease 1                                63.2    6e-09   
dbj|GAA82676.1|  CaaX prenyl protease Ste24                           64.7    6e-09   
emb|CCX14243.1|  Similar to CAAX prenyl protease 1; acc. no. P47154   64.3    6e-09   
ref|XP_009876903.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.2    6e-09   
ref|XP_003488753.1|  PREDICTED: CAAX prenyl protease 1 homolog        64.3    6e-09   
ref|XP_009222333.1|  CAAX prenyl protease 1                           64.3    6e-09   
ref|XP_001401563.1|  CAAX prenyl protease 1                           64.3    6e-09   
ref|XP_006113335.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  64.3    6e-09   
gb|ABG89280.1|  type I CAAX protease                                  64.3    6e-09   
gb|KIW42251.1|  hypothetical protein PV06_05815                       64.3    6e-09   
ref|XP_006113336.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  64.3    6e-09   
ref|XP_003225003.1|  PREDICTED: CAAX prenyl protease 1 homolog        64.3    6e-09   
ref|XP_011115562.1|  hypothetical protein H072_10056                  64.3    7e-09   
ref|XP_002148969.1|  CaaX prenyl protease Ste24                       64.3    7e-09   
ref|XP_006113334.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  64.3    7e-09   
ref|XP_009168050.1|  hypothetical protein T265_13631                  64.3    7e-09   
ref|XP_007656919.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  63.5    7e-09   
emb|CCE28602.1|  probable zinc metallo-protease                       64.3    8e-09   
ref|XP_009074890.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.9    8e-09   
dbj|GAM40464.1|  zinc metalloprotease                                 63.9    8e-09   
ref|XP_007536149.1|  PREDICTED: CAAX prenyl protease 1 homolog        64.3    8e-09   
gb|KFP82009.1|  CAAX prenyl protease 1                                63.9    8e-09   
ref|XP_009813244.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.5    8e-09   
ref|XP_009491273.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.2    8e-09   
gb|KIW12304.1|  hypothetical protein PV08_09581                       63.9    8e-09   
ref|XP_003462326.1|  PREDICTED: CAAX prenyl protease 1 homolog        63.9    8e-09   
ref|XP_007066142.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  63.9    9e-09   



>ref|XP_009773920.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana sylvestris]
Length=424

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/65 (95%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA PLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP
Sbjct  360  AFEFQADAFAKKLGYAAPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>ref|XP_009615410.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA PLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP
Sbjct  360  TFEFQADAFAKKLGYAAPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  419

Query  376  DKKTD  362
            +KKTD
Sbjct  420  EKKTD  424



>gb|EYU35101.1| hypothetical protein MIMGU_mgv1a006971mg [Erythranthe guttata]
Length=424

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA PLRAGL+KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE 
Sbjct  360  AFEFQADAFAKKLGYATPLRAGLIKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEA  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>emb|CDP08773.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGY+L LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DEP
Sbjct  360  SFEFQADAFAKKLGYSLALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDEP  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKAD  424



>gb|KDO86286.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=309

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP
Sbjct  245  SFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  304

Query  376  DKK  368
            DKK
Sbjct  305  DKK  307



>ref|XP_011093122.1| PREDICTED: CAAX prenyl protease 1 homolog [Sesamum indicum]
Length=424

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGY  PLRAGL+KLQEENLSAMNTD WYSAYHYSHPPLVERLAAIDEP
Sbjct  360  AFEFQADAFAKKLGYGAPLRAGLIKLQEENLSAMNTDHWYSAYHYSHPPLVERLAAIDEP  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>ref|XP_004229884.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum lycopersicum]
Length=424

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA PLRAGLVKLQEENLS+MNTDPWYSAYHYSHPPLVERLAAIDE 
Sbjct  360  AFEFQADAFAKKLGYAAPLRAGLVKLQEENLSSMNTDPWYSAYHYSHPPLVERLAAIDES  419

Query  376  DKKTD  362
            DKKT+
Sbjct  420  DKKTE  424



>ref|XP_002277525.1| PREDICTED: CAAX prenyl protease 1 homolog [Vitis vinifera]
 emb|CBI40422.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DEP
Sbjct  360  SFEFQADAFAKKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDEP  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKED  424



>ref|XP_002511907.1| caax prenyl protease ste24, putative [Ricinus communis]
 gb|EEF50576.1| caax prenyl protease ste24, putative [Ricinus communis]
Length=424

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DEP
Sbjct  360  SFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDEP  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKED  424



>ref|XP_006491174.1| PREDICTED: CAAX prenyl protease 1 homolog [Citrus sinensis]
 gb|KDO86285.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=424

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP
Sbjct  360  SFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  419

Query  376  DKK  368
            DKK
Sbjct  420  DKK  422



>ref|XP_006444969.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
 gb|ESR58209.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
Length=463

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP
Sbjct  399  SFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  458

Query  376  DKK  368
            DKK
Sbjct  459  DKK  461



>ref|XP_009349805.1| PREDICTED: CAAX prenyl protease 1 homolog [Pyrus x bretschneideri]
Length=424

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGY+  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID+P
Sbjct  360  SFEFQADAFAKKLGYSSALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDKP  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKAD  424



>ref|XP_009628878.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERL AIDE 
Sbjct  360  AFEFQADAFAKKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLTAIDEI  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>ref|XP_009762715.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Nicotiana 
sylvestris]
Length=403

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERL AIDE 
Sbjct  339  AFEFQADAFAKKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLTAIDEH  398

Query  376  DKKTD  362
            DKKTD
Sbjct  399  DKKTD  403



>ref|XP_009762714.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Nicotiana 
sylvestris]
Length=424

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERL AIDE 
Sbjct  360  AFEFQADAFAKKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLTAIDEH  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>ref|XP_006339615.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum tuberosum]
Length=424

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA PLRAGLVKLQEENLSAMNTD WYSAYHYSHPPLVERLAAIDE 
Sbjct  360  AFEFQADAFAKKLGYAAPLRAGLVKLQEENLSAMNTDHWYSAYHYSHPPLVERLAAIDES  419

Query  376  DKKTD  362
            DKKT+
Sbjct  420  DKKTE  424



>ref|XP_007139795.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
 gb|ESW11789.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
Length=424

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGYA  LR+GLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLA +DEP
Sbjct  360  SFEFQADAFAKKLGYASELRSGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAVLDEP  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKND  424



>ref|XP_007218053.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
 gb|EMJ19252.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
Length=424

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERL AID+P
Sbjct  360  SFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLDAIDKP  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKAD  424



>ref|XP_003552415.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQAD  AKKLGYA  LR GLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DEP
Sbjct  360  SFEFQADGFAKKLGYASGLRGGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDEP  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKED  424



>ref|XP_008232992.1| PREDICTED: CAAX prenyl protease 1 homolog [Prunus mume]
Length=424

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AK+LGYA  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERL AID+P
Sbjct  360  SFEFQADAFAKRLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLDAIDKP  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKAD  424



>ref|XP_008346138.1| PREDICTED: CAAX prenyl protease 1 homolog [Malus domestica]
Length=424

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGY+  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID+P
Sbjct  360  SFEFQADAFAKKLGYSSALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDKP  419

Query  376  DKKTD  362
             KK D
Sbjct  420  XKKAD  424



>ref|XP_003534542.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQAD  AKKLGYA  LR GLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLA +DEP
Sbjct  360  SFEFQADGFAKKLGYASGLRGGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAVLDEP  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKED  424



>gb|KHN29321.1| CAAX prenyl protease 1 like [Glycine soja]
Length=375

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQAD  AKKLGYA  LR GLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLA +DEP
Sbjct  311  SFEFQADGFAKKLGYASGLRGGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAVLDEP  370

Query  376  DKKTD  362
            DKK D
Sbjct  371  DKKED  375



>gb|KHM99334.1| CAAX prenyl protease 1 like [Glycine soja]
Length=424

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQAD  AKKLGYA  LR GLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D+P
Sbjct  360  SFEFQADGFAKKLGYASGLRGGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDKP  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKED  424



>gb|KCW78104.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=411

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGYA  LR+GLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID+ 
Sbjct  347  SFEFQADAFAKKLGYASELRSGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDKS  406

Query  376  DKKTD  362
            DKK D
Sbjct  407  DKKED  411



>ref|XP_010053753.1| PREDICTED: CAAX prenyl protease 1 homolog [Eucalyptus grandis]
 gb|KCW78103.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=423

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGYA  LR+GLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID+ 
Sbjct  359  SFEFQADAFAKKLGYASELRSGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDKS  418

Query  376  DKKTD  362
            DKK D
Sbjct  419  DKKED  423



>ref|XP_010112964.1| CAAX prenyl protease 1-like protein [Morus notabilis]
 gb|EXC35123.1| CAAX prenyl protease 1-like protein [Morus notabilis]
Length=436

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGY   LR  LVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DEP
Sbjct  372  SFEFQADAFAKKLGYTSSLRVALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDEP  431

Query  376  DKKTD  362
            DKK D
Sbjct  432  DKKAD  436



>ref|XP_011036976.1| PREDICTED: CAAX prenyl protease 1 homolog [Populus euphratica]
Length=424

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGY   LR GLVKLQEENLS+MNTDPWYSAYHYSHPPLVERLAAIDE 
Sbjct  360  SFEFQADAFAKKLGYGSALRGGLVKLQEENLSSMNTDPWYSAYHYSHPPLVERLAAIDES  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKAD  424



>ref|XP_002320821.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE99136.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGY   LR GLVKLQEENLS+MNTDPWYSAYHYSHPPLVERLAAIDE 
Sbjct  360  SFEFQADAFAKKLGYGSALRGGLVKLQEENLSSMNTDPWYSAYHYSHPPLVERLAAIDES  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKAD  424



>ref|XP_002302601.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE81874.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGY   LRAGLVKLQEENLS+MNTDPWYSAYHYSHPPLVERLAAIDE 
Sbjct  360  AFEFQADAFAKKLGYGSALRAGLVKLQEENLSSMNTDPWYSAYHYSHPPLVERLAAIDEA  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKAD  424



>ref|XP_008805562.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805563.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805564.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA++EP
Sbjct  360  AFEFQADAFAKKLGYATALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALEEP  419

Query  376  DKKTD  362
            D+K +
Sbjct  420  DRKKE  424



>ref|XP_010919128.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA++EP
Sbjct  360  AFEFQADAFAKKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALEEP  419

Query  376  DKKTD  362
            D+K +
Sbjct  420  DRKKE  424



>ref|XP_004306744.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=426

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LRAGLV+LQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE 
Sbjct  362  AFEFQADAFAKALGYAASLRAGLVRLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEE  421

Query  376  DKKTD  362
             KKTD
Sbjct  422  TKKTD  426



>ref|XP_009400731.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA  LRAGL+KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI+EP
Sbjct  360  TFEFQADAFAKKLGYAKALRAGLIKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIEEP  419

Query  376  DKKTD  362
            D K +
Sbjct  420  DSKKE  424



>ref|XP_004155836.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
Length=424

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA A+KLGY+ PLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D  
Sbjct  360  SFEFQADAFAQKLGYSAPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDLA  419

Query  376  DKKTD  362
            DKK +
Sbjct  420  DKKEE  424



>ref|XP_010261328.1| PREDICTED: CAAX prenyl protease 1 homolog [Nelumbo nucifera]
Length=424

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLG A PLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DE 
Sbjct  360  SFEFQADAFAKKLGLAKPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDES  419

Query  376  DKKTD  362
            +KK +
Sbjct  420  NKKEE  424



>ref|XP_004492786.1| PREDICTED: CAAX prenyl protease 1 homolog [Cicer arietinum]
Length=432

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQAD  AKKLGY+  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DEP
Sbjct  366  SFEFQADGFAKKLGYSSALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDEP  425

Query  376  DK  371
            DK
Sbjct  426  DK  427



>ref|XP_004133850.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
 gb|KGN56492.1| hypothetical protein Csa_3G121680 [Cucumis sativus]
Length=424

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA A+KLGY+ PLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D  
Sbjct  360  SFEFQADAFAQKLGYSAPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDLA  419

Query  376  DKKTD  362
            DKK +
Sbjct  420  DKKEE  424



>gb|EPS68077.1| hypothetical protein M569_06696, partial [Genlisea aurea]
Length=177

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 60/67 (90%), Gaps = 2/67 (3%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGY  PLRAGL+KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID+ 
Sbjct  111  AFEFQADAFAKKLGYGGPLRAGLIKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDDD  170

Query  376  --DKKTD  362
              DKK +
Sbjct  171  AHDKKRE  177



>ref|XP_008438005.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis melo]
Length=424

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA A+KLGY+ PLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D  
Sbjct  360  SFEFQADAFAQKLGYSAPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDLA  419

Query  376  DKKTD  362
            DKK +
Sbjct  420  DKKEE  424



>gb|AFK35300.1| unknown [Lotus japonicus]
Length=229

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AK LGYA  LR GLV+LQEENLSAMNTDPWYSAYHYSHPPLVERL AID+ 
Sbjct  165  SFEFQADAFAKNLGYAAELRLGLVRLQEENLSAMNTDPWYSAYHYSHPPLVERLEAIDKS  224

Query  376  DKKTD  362
            DKK D
Sbjct  225  DKKAD  229



>gb|KHG15702.1| CAAX prenyl protease 1 -like protein [Gossypium arboreum]
Length=424

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGY   LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  
Sbjct  360  SFEFQADAFAKKLGYGSALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDAA  419

Query  376  DKKTD  362
            DKK +
Sbjct  420  DKKEE  424



>gb|KJB41392.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=424

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AKKLGY   LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  
Sbjct  360  SFEFQADAFAKKLGYGSALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDAA  419

Query  376  DKKTD  362
            DKK +
Sbjct  420  DKKEE  424



>ref|XP_010669929.1| PREDICTED: CAAX prenyl protease 1 homolog [Beta vulgaris subsp. 
vulgaris]
Length=425

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA AK LGYA  L+ GLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DE 
Sbjct  361  SFEFQADAFAKNLGYASELKCGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDET  420

Query  376  DKKTD  362
            DKK D
Sbjct  421  DKKQD  425



>gb|ADE76166.1| unknown [Picea sitchensis]
Length=228

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQAD  AK LGY  PLRAGL+KLQEENLS MNTDPWYSAYHYSHPPLVERLAA+D  
Sbjct  164  AFEFQADGFAKNLGYGAPLRAGLIKLQEENLSTMNTDPWYSAYHYSHPPLVERLAALDRS  223

Query  376  DKKTD  362
            DKK +
Sbjct  224  DKKEE  228



>ref|XP_004306743.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=424

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA  LRA LV+LQEENLSAMNTDPWYSAYHYSHPPLVERLAAI E 
Sbjct  360  AFEFQADAFAKKLGYASSLRASLVRLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIGET  419

Query  376  DKKTD  362
            DKK D
Sbjct  420  DKKAD  424



>ref|XP_006828772.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
 gb|ERM96188.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
Length=424

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGY+ PLRA L+KLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D  
Sbjct  360  AFEFQADAFAKKLGYSTPLRAALIKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDTA  419

Query  376  DKK  368
            DKK
Sbjct  420  DKK  422



>ref|XP_007051723.1| Peptidase family M48 family protein [Theobroma cacao]
 gb|EOX95880.1| Peptidase family M48 family protein [Theobroma cacao]
Length=435

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 60/76 (79%), Gaps = 11/76 (14%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQ-----------EENLSAMNTDPWYSAYHYSHPP  410
            SFEFQADA AKKLGY   LRAGLVKLQ           EENLSAMNTDPWYSAYHYSHPP
Sbjct  360  SFEFQADAFAKKLGYGSALRAGLVKLQVTELEFSPLFQEENLSAMNTDPWYSAYHYSHPP  419

Query  409  LVERLAAIDEPDKKTD  362
            LVERLAAIDEPDKK D
Sbjct  420  LVERLAAIDEPDKKED  435



>ref|XP_003624056.1| CAAX prenyl protease-like protein [Medicago truncatula]
 gb|AES80274.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=426

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQAD  AKKLGY+  LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D P
Sbjct  360  SFEFQADGFAKKLGYSSSLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDIP  419

Query  376  DK  371
            DK
Sbjct  420  DK  421



>ref|XP_010933964.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA  LR+GLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA++EP
Sbjct  360  AFEFQADAFAKKLGYAAALRSGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALEEP  419

Query  376  DKKTD  362
              K +
Sbjct  420  GSKKE  424



>ref|XP_009393943.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA  LRAGL+KLQEENLSAMNTDPWYSAYHYSHPPLVERL+AI+E 
Sbjct  360  AFEFQADAFAKKLGYAKALRAGLIKLQEENLSAMNTDPWYSAYHYSHPPLVERLSAIEEA  419

Query  376  DKKTD  362
            D K +
Sbjct  420  DSKKE  424



>ref|XP_001783632.1| predicted protein [Physcomitrella patens]
 gb|EDQ51527.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A+ LGY  PLRAGL+KLQEENLSAMNTDPWYSAYH+SHPPLVERL A+DE 
Sbjct  364  AFEFQADAFARSLGYREPLRAGLIKLQEENLSAMNTDPWYSAYHHSHPPLVERLQALDET  423

Query  376  DKKTD  362
             KKTD
Sbjct  424  SKKTD  428



>ref|XP_002961362.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
 gb|EFJ36622.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
Length=424

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQAD  A +LGYALPLR GL+KLQEENLSAMNTDPWYS YHYSHPPLVERLAA+D+ 
Sbjct  360  AFEFQADNFAGELGYALPLRGGLIKLQEENLSAMNTDPWYSTYHYSHPPLVERLAALDKF  419

Query  376  DKKTD  362
             KKT+
Sbjct  420  QKKTE  424



>ref|XP_008810111.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AKKLGYA  LR+GLVKLQEENLSAMNTDPWYSAYHYSHPPLVERL A++EP
Sbjct  360  AFEFQADAFAKKLGYAAALRSGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLTALEEP  419

Query  376  DKKTD  362
              K +
Sbjct  420  GSKKE  424



>ref|XP_010556569.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556570.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Tarenaya 
hassleriana]
Length=424

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA A KL YA  LRA LVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  
Sbjct  360  SFEFQADAFAVKLDYAKDLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDGL  419

Query  376  DKKTD  362
            D KTD
Sbjct  420  DPKTD  424



>ref|XP_006647687.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryza brachyantha]
Length=425

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHYSHPPLVERL+A+++P
Sbjct  360  AFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLSALEDP  419

Query  376  DKKTD  362
            D K +
Sbjct  420  DSKKE  424



>ref|XP_010544403.1| PREDICTED: CAAX prenyl protease 1 homolog [Tarenaya hassleriana]
Length=424

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA A KLGY+  LR  LVKLQEENLSAMNTDPWYSAYHYSHPPLVERL AID  
Sbjct  360  SFEFQADAFAVKLGYSQDLRNALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLEAIDGE  419

Query  376  DKKT  365
            DKKT
Sbjct  420  DKKT  423



>ref|XP_001780822.1| predicted protein [Physcomitrella patens]
 gb|EDQ54379.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A+ LGY   LRAGL+KLQEENLSAMNTDPWYSAYHYSHPPLVERL A+DE 
Sbjct  364  AFEFQADAFARSLGYKDSLRAGLIKLQEENLSAMNTDPWYSAYHYSHPPLVERLQALDEA  423

Query  376  DKKTD  362
             KK +
Sbjct  424  SKKEE  428



>gb|KDP28583.1| hypothetical protein JCGZ_14354 [Jatropha curcas]
Length=423

 Score =   109 bits (273),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFE+QADA +KKLGY  PLR+GLVKLQ ENL AMNTDPW+SAYH+SHP LVERLA ++EP
Sbjct  359  SFEYQADAFSKKLGYCSPLRSGLVKLQVENLEAMNTDPWFSAYHHSHPCLVERLAELNEP  418

Query  376  DKKTD  362
            DKK D
Sbjct  419  DKKED  423



>ref|XP_003570103.1| PREDICTED: CAAX prenyl protease 1 homolog [Brachypodium distachyon]
Length=425

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHYSHPPLVERL+AI++ 
Sbjct  360  AFEFQADAFAKNLGYAPELRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLSAIEDL  419

Query  376  DKK  368
            D K
Sbjct  420  DSK  422



>ref|NP_001047739.1| Os02g0680400 [Oryza sativa Japonica Group]
 sp|Q6EPN8.1|FACE1_ORYSJ RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=FACE-1; AltName: 
Full=Prenyl protein-specific endoprotease 1; AltName: Full=Zinc 
metalloproteinase Ste24 homolog [Oryza sativa Japonica 
Group]
 dbj|BAD29382.1| putative Ste24p [Oryza sativa Japonica Group]
 dbj|BAF09653.1| Os02g0680400 [Oryza sativa Japonica Group]
 gb|EEE57578.1| hypothetical protein OsJ_07930 [Oryza sativa Japonica Group]
Length=425

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHYSHPPLVERL+A+++ 
Sbjct  360  AFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLSALEDA  419

Query  376  DKKTD  362
            D K +
Sbjct  420  DSKKE  424



>gb|EEC73787.1| hypothetical protein OsI_08473 [Oryza sativa Indica Group]
Length=425

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHYSHPPLVERL+A+++ 
Sbjct  360  AFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLSALEDA  419

Query  376  DKKTD  362
            D K +
Sbjct  420  DSKKE  424



>emb|CDY07191.1| BnaCnng02060D [Brassica napus]
Length=424

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A KLGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQ  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>ref|XP_009111448.1| PREDICTED: CAAX prenyl protease 1 homolog [Brassica rapa]
Length=424

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A KLGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQ  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>emb|CDY48517.1| BnaA09g00060D [Brassica napus]
Length=424

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A KLGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQ  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>ref|NP_567212.1| CAAX prenyl protease 1 homolog [Arabidopsis thaliana]
 sp|Q8RX88.1|FACE1_ARATH RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=AtFACE-1; Short=FACE-1; 
AltName: Full=Prenyl protein-specific endoprotease 
1; AltName: Full=Zinc metalloproteinase Ste24 homolog; Short=AtSTE24 
[Arabidopsis thaliana]
 gb|AAL90896.1| AT4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AAP21163.1| At4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AEE82008.1| peptidase family M48 family protein [Arabidopsis thaliana]
Length=424

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A KLGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGE  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>ref|XP_010422802.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A KLGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGE  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>ref|XP_002874990.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51249.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A KLGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGE  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>ref|XP_010427521.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A KLGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGE  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>gb|AAL07084.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=424

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A KLGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGE  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>gb|AFW63375.1| CAAX prenyl protease 1 [Zea mays]
Length=628

 Score =   110 bits (274),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHYSHPPLVERL A+++ 
Sbjct  563  AFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLQALEDS  622

Query  376  DKKTD  362
            D K +
Sbjct  623  DSKKE  627



>ref|NP_001131195.1| uncharacterized protein LOC100192503 [Zea mays]
 gb|ACF79503.1| unknown [Zea mays]
 gb|ACG28474.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHYSHPPLVERL A+++ 
Sbjct  360  AFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLQALEDS  419

Query  376  DKKTD  362
            D K +
Sbjct  420  DSKKE  424



>ref|XP_002454476.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
 gb|EES07452.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
Length=425

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHYSHPPLVERL A+++ 
Sbjct  360  AFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLQALEDS  419

Query  376  DKKTD  362
            D K +
Sbjct  420  DSKKE  424



>gb|KFK30712.1| hypothetical protein AALP_AA6G017800 [Arabis alpina]
Length=424

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A KLGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGL  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>ref|XP_004953446.1| PREDICTED: CAAX prenyl protease 1 homolog [Setaria italica]
Length=425

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHYSHPPLVERL A+++ 
Sbjct  360  AFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLQALEDS  419

Query  376  DKKTD  362
            D K +
Sbjct  420  DSKKE  424



>emb|CAL26913.1| CAAX peptidase [Hordeum vulgare subsp. vulgare]
Length=425

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LR  LVKLQEENLSAMNTDPWYSAYHYSHPPLVERL+A+++ 
Sbjct  360  AFEFQADAFAKNLGYAPELRGALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLSALEDL  419

Query  376  DKKTD  362
            D K +
Sbjct  420  DSKKE  424



>ref|XP_006853576.1| hypothetical protein AMTR_s00032p00244440, partial [Amborella 
trichopoda]
 gb|ERN15043.1| hypothetical protein AMTR_s00032p00244440, partial [Amborella 
trichopoda]
Length=60

 Score =   100 bits (249),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  541  ADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  368
            ADA AKKL  + PLRA L+KLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D  DKK
Sbjct  1    ADAFAKKLACSTPLRAALIKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDITDKK  58



>ref|XP_010456236.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A KLGYA  LR  LVKLQEENLSAMNTDP YS YHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSTYHYSHPPLVERLRAIDGE  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>gb|AAM76469.1| putative CAAX prenyl protease [Gossypium herbaceum]
 gb|AAM76470.1| putative CAAX prenyl protease [Gossypium raimondii]
 gb|AAM76471.1| putative CAAX prenyl protease [Gossypium hirsutum]
 gb|AAM76473.1| putative CAAX prenyl protease [Gossypioides kirkii]
Length=55

 Score =   100 bits (248),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  526  KKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  362
            KKLGY   LRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  DKK +
Sbjct  1    KKLGYGSALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDAADKKEE  55



>emb|CDX91888.1| BnaC03g31900D [Brassica napus]
Length=424

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A  LGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVNLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQ  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>emb|CDX74353.1| BnaA03g26940D [Brassica napus]
Length=424

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A  LGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVNLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQ  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>ref|XP_009134527.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Brassica 
rapa]
Length=424

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A  LGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVNLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGE  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>ref|XP_006286757.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
 gb|EOA19655.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
Length=424

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A KLGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGD  419

Query  376  DKKTD  362
            +KKTD
Sbjct  420  EKKTD  424



>gb|AAK39514.1|AF353722_1 CaaX processing zinc-metallo endoprotease [Arabidopsis thaliana]
Length=424

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A KLGYA  LR  LVKLQEENLSAMNTDP +SAYHYSHPPLVERL AID  
Sbjct  360  AFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLHSAYHYSHPPLVERLRAIDGE  419

Query  376  DKKTD  362
            DKKTD
Sbjct  420  DKKTD  424



>ref|NP_001152504.1| CAAX prenyl protease 1 [Zea mays]
 gb|ACG47950.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LRA LVKL EENLSAMNTDPWYSAYHYSHPPLVERL A+++ 
Sbjct  360  AFEFQADAFAKNLGYAPQLRAALVKLHEENLSAMNTDPWYSAYHYSHPPLVERLQALEDS  419

Query  376  DKKTD  362
            D K +
Sbjct  420  DAKKN  424



>ref|XP_008643874.1| PREDICTED: CAAX prenyl protease 1 isoform X2 [Zea mays]
Length=425

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LRA LVKL EENLSAMNTDPWYSAYHYSHPPLVERL A+++ 
Sbjct  360  AFEFQADAFAKNLGYAPQLRAALVKLHEENLSAMNTDPWYSAYHYSHPPLVERLQALEDS  419

Query  376  DKKTD  362
            D K +
Sbjct  420  DAKKN  424



>ref|XP_008643873.1| PREDICTED: CAAX prenyl protease 1 isoform X1 [Zea mays]
 gb|ACN31462.1| unknown [Zea mays]
 gb|AFW72802.1| CAAX prenyl protease 1 [Zea mays]
Length=437

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LRA LVKL EENLSAMNTDPWYSAYHYSHPPLVERL A+++ 
Sbjct  372  AFEFQADAFAKNLGYAPQLRAALVKLHEENLSAMNTDPWYSAYHYSHPPLVERLQALEDS  431

Query  376  DKKTD  362
            D K +
Sbjct  432  DAKKN  436



>ref|XP_006396278.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
 gb|ESQ37731.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
Length=494

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA A  LGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  
Sbjct  430  AFEFQADAFAVNLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQ  489

Query  376  DKKTD  362
            DKKTD
Sbjct  490  DKKTD  494



>gb|AAM76472.1| putative CAAX prenyl protease [Gossypium hirsutum]
Length=55

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -3

Query  526  KKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  362
            KKLGY   LRAGLVKLQE+NLSAMNTDPWYS YHYSHPPLVERLAAID  DKK +
Sbjct  1    KKLGYGSALRAGLVKLQEKNLSAMNTDPWYSTYHYSHPPLVERLAAIDAADKKEE  55



>ref|XP_004308344.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
 ref|XP_011468984.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=425

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FE+QADA AKKLGYA  +RA LV+LQEENL+AMN DPWYSAYHY+HP LVERLAAI + 
Sbjct  360  AFEYQADAFAKKLGYASSIRASLVRLQEENLAAMNIDPWYSAYHYTHPTLVERLAAIGKM  419

Query  376  DKK  368
            DK+
Sbjct  420  DKE  422



>gb|EMT24778.1| CAAX prenyl protease 1-like protein [Aegilops tauschii]
Length=355

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  547  FQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  368
            F ADA AK LGYA  LR  LVKLQEENLSAMNTDPWYSAYHYSHPPLVERL+A+++ D K
Sbjct  293  FMADAFAKNLGYAPELRGALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLSALEDLDSK  352

Query  367  TD  362
             D
Sbjct  353  KD  354



>gb|AAB61028.1| A_IG002N01.21 gene product [Arabidopsis thaliana]
Length=316

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 55/75 (73%), Gaps = 10/75 (13%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQ----------EENLSAMNTDPWYSAYHYSHPPL  407
            +FEFQADA A KLGYA  LR  LVKLQ          EENLSAMNTDP YSAYHYSHPPL
Sbjct  242  AFEFQADAFAVKLGYAKDLRPALVKLQVREDNNRTQTEENLSAMNTDPLYSAYHYSHPPL  301

Query  406  VERLAAIDEPDKKTD  362
            VERL AID  DKKTD
Sbjct  302  VERLRAIDGEDKKTD  316



>emb|CAB80941.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=459

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 55/93 (59%), Gaps = 28/93 (30%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVK----------------------------LQEENLS  461
            +FEFQADA A KLGYA  LR  LVK                            LQEENLS
Sbjct  367  AFEFQADAFAVKLGYAKDLRPALVKLQVREDNNRTQTVTSICVTHLNGFFVGILQEENLS  426

Query  460  AMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  362
            AMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  427  AMNTDPLYSAYHYSHPPLVERLRAIDGEDKKTD  459



>gb|ESA09906.1| hypothetical protein GLOINDRAFT_80760 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX73371.1| Ste24p [Rhizophagus irregularis DAOM 197198w]
Length=430

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            EF+ADA AKKLGY + LR+GL+K+Q +NL  +N DPWYSAYH+SHPPL ERL+AI++ D
Sbjct  372  EFEADAYAKKLGYGVQLRSGLIKIQIKNLGNLNNDPWYSAYHFSHPPLPERLSAIEKID  430



>gb|AIC32889.1| STE24 [Puccinellia tenuiflora]
Length=424

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQADA AK LGYA  LR  LVKLQEEN  AMNTDP YSAYH+SHPPLVE   A+++ 
Sbjct  359  AFEFQADAFAKNLGYAPELRGALVKLQEENSFAMNTDPGYSAYHFSHPPLVEGFFALEDL  418

Query  376  DKKTD  362
            D K +
Sbjct  419  DTKKE  423



>ref|XP_009134526.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Brassica 
rapa]
Length=455

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 54/96 (56%), Gaps = 31/96 (32%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQ-------------------------------EE  470
            +FEFQADA A  LGYA  LR  LVKLQ                               EE
Sbjct  360  AFEFQADAFAVNLGYAKDLRPALVKLQVRETAEIKTQTVYTRVVPCHNGCCFCCGFLQEE  419

Query  469  NLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  362
            NLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  420  NLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKTD  455



>emb|CBJ27157.1| CaaX prenyl protease Ste24 [Ectocarpus siliculosus]
Length=474

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            EF+ADA A KLGY+  L++GLVKLQ ENL  MN DPWYSA+HYSHPPLVERL A+
Sbjct  411  EFEADAYAVKLGYSKGLQSGLVKLQLENLGNMNPDPWYSAFHYSHPPLVERLQAM  465



>ref|XP_002945691.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
 gb|EFJ52686.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
Length=460

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEFQADA A   G+   LR+ L+K++EEN  AM+ DPWYS+YHYSHPPLV+RL AID   
Sbjct  397  FEFQADAFAVHTGHGTELRSALLKMEEENKGAMHVDPWYSSYHYSHPPLVDRLKAIDSAV  456

Query  373  KK  368
            KK
Sbjct  457  KK  458



>emb|CAN83040.1| hypothetical protein VITISV_034339 [Vitis vinifera]
Length=310

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  511  ALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  362
            A  L+  LVKLQEENLSAMNTDPWY AYHYS PPLVERLAA+ EPDKK D
Sbjct  261  AAALQVRLVKLQEENLSAMNTDPWYLAYHYSQPPLVERLAALGEPDKKED  310



>ref|XP_003622455.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=93

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            S EFQADA A KLGY   LR+ LVK Q ENL   N DPWY AY    PP V RL A+DE 
Sbjct  29   SIEFQADAFAVKLGYKSALRSVLVKKQMENLMEFNADPWYYAYRVIQPPAVLRLTAMDEL  88

Query  376  DKKTD  362
            DKK D
Sbjct  89   DKKAD  93



>emb|CCI48758.1| unnamed protein product [Albugo candida]
Length=493

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA A  LG+A  L+ GL K+  ENLS MN D WYSAYHY HPPL+ERL+AI + ++
Sbjct  431  EFQADAFATDLGHAKALQTGLTKISIENLSNMNPDKWYSAYHYDHPPLLERLSAIKQRER  490

Query  370  K  368
            K
Sbjct  491  K  491



>emb|CCA18761.1| CAAX prenyl protease 1 putative [Albugo laibachii Nc14]
 emb|CCA25203.1| CAAX prenyl protease 1 putative [Albugo laibachii Nc14]
Length=493

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA A  LG+A  L+ GL K+  ENLS MN D WYSAYHY HPPL+ERL+AI + + 
Sbjct  431  EFQADAFATDLGHAKALQTGLTKISTENLSNMNPDKWYSAYHYDHPPLLERLSAIKQRES  490

Query  370  K  368
            K
Sbjct  491  K  491



>ref|XP_002292916.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90112.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=425

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EF+AD  + KLG +  L++GL K+  ENL AM  DPWYS YHYSHPPLVERL+A+ + DK
Sbjct  363  EFEADEFSVKLGMSQGLQSGLCKIHLENLGAMLPDPWYSTYHYSHPPLVERLSAMMKMDK  422

Query  370  KT  365
            K+
Sbjct  423  KS  424



>ref|XP_002900396.1| CAAX prenyl protease 1 [Phytophthora infestans T30-4]
 gb|EEY60189.1| CAAX prenyl protease 1 [Phytophthora infestans T30-4]
Length=485

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA A  LG+A+ L++GL KL  ENLS MN D  YSAYHYSHPPLVERL AI    K
Sbjct  423  EFQADAFAVDLGHAVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAK  482

Query  370  KT  365
            K+
Sbjct  483  KS  484



>ref|XP_003677696.1| hypothetical protein NCAS_0H00350 [Naumovozyma castellii CBS 
4309]
 emb|CCC71345.1| hypothetical protein NCAS_0H00350 [Naumovozyma castellii CBS 
4309]
Length=487

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AK LGY   L   L+ LQ +NLS MN DPWYSAYHYSHP L ERL A++  ++
Sbjct  424  EYQADAYAKGLGYTEKLCRALIVLQIKNLSTMNVDPWYSAYHYSHPTLAERLTALEYVNE  483

Query  370  K  368
            K
Sbjct  484  K  484



>ref|XP_009042161.1| hypothetical protein AURANDRAFT_34438, partial [Aureococcus anophagefferens]
 gb|EGB03141.1| hypothetical protein AURANDRAFT_34438 [Aureococcus anophagefferens]
Length=262

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQAD     LGYA PL+ GLVK+  ENL  ++ DP +S YH+SHPPLV+RL AI+E  K
Sbjct  200  EFQADQYGTNLGYAAPLQRGLVKITFENLGVLDPDPLFSTYHHSHPPLVQRLRAIEEGAK  259

Query  370  K  368
            K
Sbjct  260  K  260



>ref|XP_009497192.1| hypothetical protein H696_05044 [Fonticula alba]
 gb|KCV68760.1| hypothetical protein H696_05044 [Fonticula alba]
Length=451

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            SFEFQADA A  LGY   LR+GL+K+Q EN+S M  D  YS Y+Y+HPP++ER++AID+ 
Sbjct  387  SFEFQADAFACGLGYGKVLRSGLLKMQLENMSQMLPDSLYSLYNYTHPPMLERISAIDKL  446

Query  376  DKKTD  362
             +K D
Sbjct  447  LQKKD  451



>ref|XP_004348317.1| CAAX prenyl protease 1 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93739.1| CAAX prenyl protease 1 [Capsaspora owczarzaki ATCC 30864]
Length=519

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            +EFQADA A KLG+   LR  LVKLQ+ NLS M+ DP YS YHYSHPPLVERL AI
Sbjct  459  YEFQADAFAAKLGHGGHLRTALVKLQKNNLSDMDPDPLYSMYHYSHPPLVERLNAI  514



>gb|EME39248.1| hypothetical protein DOTSEDRAFT_75093 [Dothistroma septosporum 
NZE10]
Length=462

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+ADA  KKLGYA  L A L+KLQ +NLS+M+ DP YS+YHYSHP L ERL A+    
Sbjct  376  FEFEADAFGKKLGYAKDLAASLIKLQIQNLSSMDADPLYSSYHYSHPILTERLKAVGWTS  435

Query  373  KK  368
            +K
Sbjct  436  EK  437



>ref|XP_009532258.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
 gb|EGZ11925.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
Length=468

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA A  LG+ + L++GL KL  ENLS MN D  YSAYHYSHPPLVERL AI    K
Sbjct  406  EFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDELYSAYHYSHPPLVERLNAITARAK  465

Query  370  KTD  362
            KT 
Sbjct  466  KTQ  468



>emb|CDH09260.1| probable CAAX prenyl protease 1 [Zygosaccharomyces bailii ISA1307]
Length=459

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AK LGY   L   L+ LQ +NLS MN DPWYSAYHYSHP L ERL A+    +
Sbjct  396  EYQADAYAKALGYTQHLAQALINLQIKNLSTMNVDPWYSAYHYSHPTLAERLNALGYVSR  455

Query  370  K  368
            K
Sbjct  456  K  456



>emb|CDH15706.1| probable CAAX prenyl protease 1 [Zygosaccharomyces bailii ISA1307]
Length=459

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AK LGY   L   L+ LQ +NLS MN DPWYSAYHYSHP L ERL A+    +
Sbjct  396  EYQADAYAKALGYTQHLARALINLQIKNLSTMNVDPWYSAYHYSHPTLAERLNALGYVSR  455

Query  370  K  368
            K
Sbjct  456  K  456



>emb|CDF87226.1| BN860_01640g1_1 [Zygosaccharomyces bailii CLIB 213]
Length=459

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AK LGY   L   L+ LQ +NLS MN DPWYSAYHYSHP L ERL A+    +
Sbjct  396  EYQADAYAKALGYTQHLARALINLQIKNLSTMNVDPWYSAYHYSHPTLAERLNALGYVSR  455

Query  370  K  368
            K
Sbjct  456  K  456



>gb|ETL45293.1| hypothetical protein L916_04606 [Phytophthora parasitica]
Length=484

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA A  LG+ + L++GL KL  ENLS MN D  YSAYHYSHPPLVERL AI    K
Sbjct  422  EFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAK  481

Query  370  KT  365
            K+
Sbjct  482  KS  483



>gb|ETK91894.1| hypothetical protein L915_04651 [Phytophthora parasitica]
 gb|ETP21822.1| hypothetical protein F441_04764 [Phytophthora parasitica CJ01A1]
Length=484

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA A  LG+ + L++GL KL  ENLS MN D  YSAYHYSHPPLVERL AI    K
Sbjct  422  EFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAK  481

Query  370  KT  365
            K+
Sbjct  482  KS  483



>gb|ETI52023.1| hypothetical protein F443_04763 [Phytophthora parasitica P1569]
Length=484

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA A  LG+ + L++GL KL  ENLS MN D  YSAYHYSHPPLVERL AI    K
Sbjct  422  EFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAK  481

Query  370  KT  365
            K+
Sbjct  482  KS  483



>ref|XP_008902128.1| hypothetical protein PPTG_09033 [Phytophthora parasitica INRA-310]
 gb|ETN12113.1| hypothetical protein PPTG_09033 [Phytophthora parasitica INRA-310]
Length=484

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA A  LG+ + L++GL KL  ENLS MN D  YSAYHYSHPPLVERL AI    K
Sbjct  422  EFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAK  481

Query  370  KT  365
            K+
Sbjct  482  KS  483



>gb|ETO80780.1| hypothetical protein F444_04815 [Phytophthora parasitica P1976]
Length=484

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA A  LG+ + L++GL KL  ENLS MN D  YSAYHYSHPPLVERL AI    K
Sbjct  422  EFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAK  481

Query  370  KT  365
            K+
Sbjct  482  KS  483



>gb|ETL98448.1| hypothetical protein L917_04490 [Phytophthora parasitica]
 gb|ETM51609.1| hypothetical protein L914_04599 [Phytophthora parasitica]
 gb|ETP49699.1| hypothetical protein F442_04842 [Phytophthora parasitica P10297]
Length=484

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA A  LG+ + L++GL KL  ENLS MN D  YSAYHYSHPPLVERL AI    K
Sbjct  422  EFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAK  481

Query  370  KT  365
            K+
Sbjct  482  KS  483



>gb|KEH18809.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=436

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            S EFQADA A KLGY   LR+ LVK Q ENL   N DPWY AY    PP V RL A+DE 
Sbjct  372  SIEFQADAFAVKLGYKSALRSVLVKKQMENLMEFNADPWYYAYRVIQPPAVLRLTAMDEL  431

Query  376  DKKTD  362
            DKK D
Sbjct  432  DKKAD  436



>ref|XP_002181639.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46853.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=464

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EF AD  +  LG +  L++GL K+  ENL AM  DPWYS YHYSHPPLVERL A+   D+
Sbjct  402  EFAADRFSVDLGMSQKLQSGLCKIHLENLGAMCPDPWYSTYHYSHPPLVERLGAMMALDR  461

Query  370  KT  365
            KT
Sbjct  462  KT  463



>ref|XP_453545.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAH00641.1| KLLA0D10846p [Kluyveromyces lactis]
Length=456

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+Q+DA AK+LGYA  L   L+ LQ +NLS MN DP YS+YHYSHP L ERL AI+  ++
Sbjct  393  EYQSDAYAKELGYAPHLARALINLQIKNLSTMNVDPLYSSYHYSHPTLAERLIAIEYKNE  452

Query  370  KTD  362
            K D
Sbjct  453  KKD  455



>ref|XP_011104176.1| ste24p [Saccharomyces arboricola H-6]
 gb|EJS43087.1| ste24p [Saccharomyces arboricola H-6]
Length=453

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCKALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>ref|XP_002174544.2| CAA Xprenyl protease [Schizosaccharomyces japonicus yFS275]
 gb|EEB08251.2| CAA Xprenyl protease [Schizosaccharomyces japonicus yFS275]
Length=446

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            S E+QADA AK+LGY   L  GL++L E+N+S ++ D W+SAYH++HPPL+ERL AI   
Sbjct  379  SCEYQADAFAKRLGYGDALAEGLIRLHEDNMSPLDFDRWFSAYHHNHPPLLERLEAIGYG  438

Query  376  DKKTD  362
             + TD
Sbjct  439  AQTTD  443



>pdb|4IL3|A Chain A, Crystal Structure Of S. Mikatae Ste24p
 pdb|4IL3|B Chain B, Crystal Structure Of S. Mikatae Ste24p
Length=461

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|AJR71904.1| Ste24p [Saccharomyces cerevisiae YJM1450]
Length=453

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|AJR68004.1| Ste24p [Saccharomyces cerevisiae YJM1250]
 gb|AJR68974.1| Ste24p [Saccharomyces cerevisiae YJM1417]
 gb|AJR69944.1| Ste24p [Saccharomyces cerevisiae YJM1433]
 gb|AJR73220.1| Ste24p [Saccharomyces cerevisiae YJM1478]
Length=453

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|AJR62890.1| Ste24p [Saccharomyces cerevisiae YJM450]
 gb|AJR71267.1| Ste24p [Saccharomyces cerevisiae YJM1444]
Length=453

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|AJR67380.1| Ste24p [Saccharomyces cerevisiae YJM1244]
 gb|AJR68650.1| Ste24p [Saccharomyces cerevisiae YJM1415]
Length=453

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|AJR59949.1| Ste24p [Saccharomyces cerevisiae YJM193]
Length=453

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|EDV12854.1| CAAX prenyl protease 1 [Saccharomyces cerevisiae RM11-1a]
Length=453

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|EDN63433.1| zinc metalloprotease [Saccharomyces cerevisiae YJM789]
 gb|AJR59292.1| Ste24p [Saccharomyces cerevisiae YJM1133]
 gb|AJR64495.1| Ste24p [Saccharomyces cerevisiae YJM541]
 gb|AJR64762.1| Ste24p [Saccharomyces cerevisiae YJM554]
Length=453

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|AJR63874.1| Ste24p [Saccharomyces cerevisiae YJM456]
 gb|AJR70937.1| Ste24p [Saccharomyces cerevisiae YJM1443]
 gb|AJR74185.1| Ste24p [Saccharomyces cerevisiae YJM1527]
Length=453

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|AJR61585.1| Ste24p [Saccharomyces cerevisiae YJM271]
Length=453

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|AJR60606.1| Ste24p [Saccharomyces cerevisiae YJM244]
Length=453

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>emb|CAY80831.1| Ste24p [Saccharomyces cerevisiae EC1118]
 gb|AJR61257.1| Ste24p [Saccharomyces cerevisiae YJM270]
Length=453

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|EDZ71132.1| YJR117Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gb|EEU08090.1| Ste24p [Saccharomyces cerevisiae JAY291]
 gb|EGA86133.1| Ste24p [Saccharomyces cerevisiae VL3]
 dbj|GAA24463.1| K7_Ste24p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EWG85204.1| Ste24p [Saccharomyces cerevisiae R008]
 gb|EWG88038.1| Ste24p [Saccharomyces cerevisiae P301]
 gb|EWH17657.1| Ste24p [Saccharomyces cerevisiae P283]
 gb|AHY79097.1| Ste24p [Saccharomyces cerevisiae YJM993]
 gb|AJP39798.1| Ste24p [Saccharomyces cerevisiae YJM1078]
 gb|AJR54062.1| Ste24p [Saccharomyces cerevisiae YJM681]
 gb|AJR54392.1| Ste24p [Saccharomyces cerevisiae YJM682]
 gb|AJR54727.1| Ste24p [Saccharomyces cerevisiae YJM683]
 gb|AJR55052.1| Ste24p [Saccharomyces cerevisiae YJM689]
 gb|AJR55361.1| Ste24p [Saccharomyces cerevisiae YJM693]
 gb|AJR55690.1| Ste24p [Saccharomyces cerevisiae YJM969]
 gb|AJR56020.1| Ste24p [Saccharomyces cerevisiae YJM972]
 gb|AJR56347.1| Ste24p [Saccharomyces cerevisiae YJM975]
 gb|AJR56674.1| Ste24p [Saccharomyces cerevisiae YJM978]
 gb|AJR57000.1| Ste24p [Saccharomyces cerevisiae YJM981]
 gb|AJR57327.1| Ste24p [Saccharomyces cerevisiae YJM984]
 gb|AJR57658.1| Ste24p [Saccharomyces cerevisiae YJM987]
 gb|AJR57986.1| Ste24p [Saccharomyces cerevisiae YJM990]
 gb|AJR58314.1| Ste24p [Saccharomyces cerevisiae YJM996]
 gb|AJR58638.1| Ste24p [Saccharomyces cerevisiae YJM1083]
 gb|AJR58966.1| Ste24p [Saccharomyces cerevisiae YJM1129]
 gb|AJR59618.1| Ste24p [Saccharomyces cerevisiae YJM189]
 gb|AJR60272.1| Ste24p [Saccharomyces cerevisiae YJM195]
 gb|AJR61908.1| Ste24p [Saccharomyces cerevisiae YJM320]
 gb|AJR62236.1| Ste24p [Saccharomyces cerevisiae YJM326]
 gb|AJR62569.1| Ste24p [Saccharomyces cerevisiae YJM428]
 gb|AJR63546.1| Ste24p [Saccharomyces cerevisiae YJM453]
 gb|AJR65090.1| Ste24p [Saccharomyces cerevisiae YJM555]
 gb|AJR65420.1| Ste24p [Saccharomyces cerevisiae YJM627]
 gb|AJR65749.1| Ste24p [Saccharomyces cerevisiae YJM1190]
 gb|AJR66077.1| Ste24p [Saccharomyces cerevisiae YJM1199]
 gb|AJR66400.1| Ste24p [Saccharomyces cerevisiae YJM1202]
 gb|AJR67053.1| Ste24p [Saccharomyces cerevisiae YJM1242]
 gb|AJR67676.1| Ste24p [Saccharomyces cerevisiae YJM1248]
 gb|AJR69283.1| Ste24p [Saccharomyces cerevisiae YJM1418]
 gb|AJR70278.1| Ste24p [Saccharomyces cerevisiae YJM1434]
 gb|AJR70606.1| Ste24p [Saccharomyces cerevisiae YJM1439]
 gb|AJR72563.1| Ste24p [Saccharomyces cerevisiae YJM1463]
 gb|AJR72890.1| Ste24p [Saccharomyces cerevisiae YJM1477]
 gb|AJR73551.1| Ste24p [Saccharomyces cerevisiae YJM1479]
 gb|AJR73867.1| Ste24p [Saccharomyces cerevisiae YJM1526]
 gb|AJR74512.1| Ste24p [Saccharomyces cerevisiae YJM1549]
 gb|AJR74842.1| Ste24p [Saccharomyces cerevisiae YJM1573]
 gb|AJR75177.1| Ste24p [Saccharomyces cerevisiae YJM1574]
 gb|AJR75836.1| Ste24p [Saccharomyces cerevisiae YJM1615]
Length=453

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|EHN06284.1| Ste24p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=453

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|AJR60934.1| Ste24p [Saccharomyces cerevisiae YJM248]
 gb|AJR68333.1| Ste24p [Saccharomyces cerevisiae YJM1252]
 gb|AJR72235.1| Ste24p [Saccharomyces cerevisiae YJM1460]
 gb|AJR75507.1| Ste24p [Saccharomyces cerevisiae YJM1592]
Length=453

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>ref|NP_012651.1| Ste24p [Saccharomyces cerevisiae S288c]
 sp|P47154.1|STE24_YEAST RecName: Full=CAAX prenyl protease 1; AltName: Full=A-factor-converting 
enzyme; AltName: Full=Prenyl protein-specific endoprotease 
1; Short=PPSEP 1 [Saccharomyces cerevisiae S288c]
 emb|CAA89647.1| STE24 [Saccharomyces cerevisiae]
 gb|AAB38271.1| zinc metallo-protease [Saccharomyces cerevisiae]
 tpg|DAA08902.1| TPA: Ste24p [Saccharomyces cerevisiae S288c]
 gb|EIW09642.1| Ste24p [Saccharomyces cerevisiae CEN.PK113-7D]
Length=453

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>ref|XP_008611054.1| hypothetical protein SDRG_07015 [Saprolegnia diclina VS20]
 gb|EQC35304.1| hypothetical protein SDRG_07015 [Saprolegnia diclina VS20]
Length=453

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EF ADA A +LG+A  L++GL K+  ENL+ MN DP YSAYHYSHPPL+ERL AI     
Sbjct  391  EFAADAFAVQLGHADALQSGLTKISLENLANMNPDPMYSAYHYSHPPLLERLCAIGITKH  450

Query  370  KT  365
            KT
Sbjct  451  KT  452



>gb|AJR63219.1| Ste24p [Saccharomyces cerevisiae YJM451]
 gb|AJR66725.1| Ste24p [Saccharomyces cerevisiae YJM1208]
 gb|AJR69612.1| Ste24p [Saccharomyces cerevisiae YJM1419]
Length=453

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|EWG95205.1| Ste24p [Saccharomyces cerevisiae R103]
Length=453

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|EJT41596.1| STE24-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=453

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>gb|EHN01607.1| Ste24p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=453

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>ref|XP_003880033.1| putative peptidase family M48 domain-containing protein [Neospora 
caninum Liverpool]
 emb|CBZ49998.1| putative peptidase family M48 domain-containing protein [Neospora 
caninum Liverpool]
Length=429

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EF+ADA A +LGY+ PL+ GLV +  EN S ++ DPW+S +HYSHPPL+ERL AI+   +
Sbjct  364  EFEADAFACELGYSEPLKQGLVAIHAENKSCLDPDPWFSFWHYSHPPLLERLRAIEAIQE  423

Query  370  KTD  362
            K +
Sbjct  424  KEE  426



>ref|XP_009822213.1| hypothetical protein H257_00958 [Aphanomyces astaci]
 gb|ETV87350.1| hypothetical protein H257_00958 [Aphanomyces astaci]
Length=479

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  380
            EFQADA A  LG+  PL++ L K+  ENL+ MN D  YSAYHYSHPPLVERLAAI +
Sbjct  414  EFQADAFAVDLGHGEPLQSALTKISLENLANMNPDTLYSAYHYSHPPLVERLAAISK  470



>dbj|BAO41720.1| CAAX prenyl protease 1 [Kluyveromyces marxianus DMKU3-1042]
Length=455

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+Q+DA AK+LGYA  L   L+ LQ +NLS MN DP YS+YHYSHP L ERL AI+  ++
Sbjct  392  EYQSDAYAKELGYANHLARALINLQIKNLSTMNVDPLYSSYHYSHPTLAERLIAIEYKNE  451

Query  370  K  368
            K
Sbjct  452  K  452



>emb|CDO93753.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=455

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+Q+DA AK+LG+A  L   L+ LQ +NLS MN DP YS+YHYSHP L ERL AI+  ++
Sbjct  392  EYQSDAYAKELGHASHLAKALINLQIKNLSTMNVDPLYSSYHYSHPTLAERLIAIEYKNE  451

Query  370  KTD  362
            K D
Sbjct  452  KKD  454



>dbj|BAP73165.1| CAAX prenyl protease 1 [Kluyveromyces marxianus]
Length=455

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+Q+DA AK+LGYA  L   L+ LQ +NLS MN DP YS+YHYSHP L ERL AI+  ++
Sbjct  392  EYQSDAYAKELGYANHLARALINLQIKNLSTMNVDPLYSSYHYSHPTLAERLIAIEYKNE  451

Query  370  K  368
            K
Sbjct  452  K  452



>ref|XP_447605.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG60542.1| unnamed protein product [Candida glabrata]
Length=460

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AK LGY   L   L+ LQ +NLS M+ DP YS+YHYSHP L ERL AID  ++
Sbjct  397  EYQADAYAKALGYTQNLGRALINLQIKNLSTMDVDPLYSSYHYSHPTLAERLTAIDFVNE  456

Query  370  K  368
            K
Sbjct  457  K  457



>ref|XP_008861314.1| hypothetical protein H310_00342 [Aphanomyces invadans]
 gb|ETW09903.1| hypothetical protein H310_00342 [Aphanomyces invadans]
Length=472

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            EF+ADA A  LGY  PL++ L K+  ENL+ MN D  YSAYHYSHPPLVERL AI
Sbjct  407  EFEADAFAVDLGYGDPLQSALTKISLENLTNMNPDALYSAYHYSHPPLVERLGAI  461



>emb|CCK69867.1| hypothetical protein KNAG_0D01150 [Kazachstania naganishii CBS 
8797]
Length=460

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AK LGYA  L   L+ LQ +NLS M+ D WYS+YH+SHP L ERL A+D   +
Sbjct  397  EYQADAYAKTLGYAKNLCRALIDLQIKNLSTMSVDTWYSSYHFSHPTLAERLTALDYVSE  456

Query  370  K  368
            K
Sbjct  457  K  457



>ref|XP_002553545.1| KLTH0E01298p [Lachancea thermotolerans]
 emb|CAR23108.1| KLTH0E01298p [Lachancea thermotolerans CBS 6340]
Length=455

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  392  EYQADAYAKKLGYTKDLCHALINLQVKNLSTMNVDPLYSSYHYSHPTLPERLEALDYATE  451

Query  370  KTD  362
            K +
Sbjct  452  KKE  454



>gb|KDO33073.1| hypothetical protein SPRG_01888 [Saprolegnia parasitica CBS 223.65]
Length=453

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EF ADA A +LG+A  L++GL K+  ENL+ MN DP YSAYHYSHPPL+ERL+AI     
Sbjct  391  EFAADAFAVQLGHADALQSGLTKISLENLANMNPDPMYSAYHYSHPPLLERLSAIGAVKH  450

Query  370  K  368
            K
Sbjct  451  K  451



>gb|ESS30154.1| CAAX metallo endopeptidase, partial [Toxoplasma gondii VEG]
Length=200

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EF+ADA A +LGY+  L+ GL+ +  EN + ++ DPW+S +HYSHPPL+ERL AI+  ++
Sbjct  135  EFEADAFACELGYSESLKQGLIAIHTENKACLDPDPWFSFWHYSHPPLLERLRAIEAIEE  194

Query  370  K  368
            K
Sbjct  195  K  195



>gb|KFG61038.1| CAAX metallo endopeptidase [Toxoplasma gondii RUB]
Length=204

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EF+ADA A +LGY+  L+ GL+ +  EN + ++ DPW+S +HYSHPPL+ERL AI+  ++
Sbjct  139  EFEADAFACELGYSESLKQGLIAIHTENKACLDPDPWFSFWHYSHPPLLERLRAIEAIEE  198

Query  370  K  368
            K
Sbjct  199  K  199



>gb|KGO76072.1| Peptidase M48 [Penicillium italicum]
Length=456

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEFQAD  A+KLGY+  L + L+KLQ +NLS M+ DP Y++YHYSHP L ERLAA+
Sbjct  375  FEFQADEFAQKLGYSDKLASSLLKLQIQNLSTMDADPIYASYHYSHPILTERLAAL  430



>ref|XP_005651455.1| hypothetical protein COCSUDRAFT_27312 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26911.1| hypothetical protein COCSUDRAFT_27312 [Coccomyxa subellipsoidea 
C-169]
Length=437

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEFQADA A  LG A  L+  L  L  +N SA+N DP YSAYH+SHPPLVERL A+D   
Sbjct  374  FEFQADAFAVSLGKAEELKQALKILDAKNRSAVNVDPLYSAYHHSHPPLVERLTAVDAAT  433

Query  373  KKTD  362
            KK +
Sbjct  434  KKGE  437



>gb|AJR64199.1| Ste24p [Saccharomyces cerevisiae YJM470]
Length=453

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLGY   L   L+ LQ +NLS MN DP YS+Y+YSHP L ERL A+D   +
Sbjct  390  EYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYYYSHPTLAERLTALDYVSE  449

Query  370  K  368
            K
Sbjct  450  K  450



>ref|XP_002496515.1| ZYRO0D01892p [Zygosaccharomyces rouxii]
 emb|CAR27582.1| ZYRO0D01892p [Zygosaccharomyces rouxii]
Length=497

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AK LGY   L   L+ LQ +NLS MN DP YSAYHYSHP L ERL A+    +
Sbjct  434  EYQADAFAKGLGYTQYLAQALINLQIKNLSTMNVDPLYSAYHYSHPTLAERLTALGFVSR  493

Query  370  K  368
            K
Sbjct  494  K  494



>gb|KFH71808.1| hypothetical protein MVEG_02102 [Mortierella verticillata NRRL 
6337]
Length=451

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +EFQADA A+ LGYA  L +GL+KLQ +NL  MN D  +S YH SHP LVERL AI++P
Sbjct  384  YEFQADAFARDLGYAGSLASGLIKLQLKNLGTMNPDWLHSMYHRSHPELVERLNAINQP  442



>ref|XP_003850777.1| CAAX prenyl protease 1 [Zymoseptoria tritici IPO323]
 gb|EGP85753.1| hypothetical protein MYCGRDRAFT_74210 [Zymoseptoria tritici IPO323]
Length=457

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+ADA + KLGYA  L A L+KLQ +NLS+M+ D  YS+YHYSHP L ERL A+    
Sbjct  378  FEFEADAFSLKLGYAKELAASLIKLQIQNLSSMDADHMYSSYHYSHPILTERLKAVGWTS  437

Query  373  KK  368
            +K
Sbjct  438  EK  439



>dbj|GAA95272.1| hypothetical protein E5Q_01928 [Mixia osmundae IAM 14324]
 gb|KEI41234.1| hypothetical protein L969DRAFT_45748 [Mixia osmundae IAM 14324]
Length=492

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E++ADA AK LGYA  L+ GL++L  +N + +  D  YSA+H+SHP L+ERLAA+++ DK
Sbjct  430  EYEADAFAKNLGYAQQLKVGLIRLMSKNSAVLTYDALYSAFHHSHPTLIERLAALEQIDK  489

Query  370  KT  365
            K+
Sbjct  490  KS  491



>gb|EWM26686.1| caax prenyl protease 1 [Nannochloropsis gaditana]
Length=530

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -3

Query  544  QADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            QAD  A  LGY+  L+ GLVKLQ ENLS  + DPWYS YHYSHPPL ERLAAI
Sbjct  466  QADEYAVGLGYSEDLQRGLVKLQIENLSNPSPDPWYSFYHYSHPPLTERLAAI  518



>ref|XP_005100140.1| PREDICTED: CAAX prenyl protease 1 homolog [Aplysia californica]
Length=490

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI-DEPD  374
            EFQADA A  +G++  LR+ L+KL E+NLS   +D  YSA+H+SHPPL++RL A+ D+PD
Sbjct  427  EFQADAFAAGMGWSDTLRSALIKLNEDNLSFPLSDWLYSAWHFSHPPLLDRLRALHDQPD  486

Query  373  KKT  365
            KKT
Sbjct  487  KKT  489



>gb|KGO40189.1| Peptidase M48 [Penicillium expansum]
 gb|KGO53048.1| Peptidase M48 [Penicillium expansum]
 gb|KGO63477.1| Peptidase M48 [Penicillium expansum]
Length=456

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+AD  A+KLGY+  L + L+KLQ +NLS M+ DP Y++YHYSHP L ERLAA+
Sbjct  375  FEFEADEFAQKLGYSDKLASSLLKLQIQNLSTMDADPIYASYHYSHPILTERLAAL  430



>ref|XP_002565802.1| Pc22g18990 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP99187.1| Pc22g18990 [Penicillium rubens Wisconsin 54-1255]
Length=456

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+ADA A+ LGY+  L + L+KLQ +NLS M+ DP Y++YHYSHP L ERLAA+
Sbjct  375  FEFEADAFAQNLGYSDKLASSLLKLQIQNLSTMDADPIYASYHYSHPILTERLAAL  430



>gb|EPB83925.1| hypothetical protein HMPREF1544_09315 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=442

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            E++ADA A KLGYA  LR+ L+KL  +NL   N DPWYSA+++SHP LVERL A+
Sbjct  370  EYEADAYALKLGYASTLRSALIKLSVKNLGGFNVDPWYSAWNHSHPSLVERLKAL  424



>ref|XP_001623710.1| predicted protein [Nematostella vectensis]
 gb|EDO31610.1| predicted protein [Nematostella vectensis]
Length=450

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEFQADA AK+LG+A  LR+ L+KL ++NL     D  YSAYHYSHPPL+ERL A+
Sbjct  390  FEFQADAFAKQLGFAPHLRSALIKLHQDNLGFPIADKLYSAYHYSHPPLLERLRAL  445



>gb|EMF09871.1| CaaX prenyl protease [Sphaerulina musiva SO2202]
Length=465

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+ADA +  LGYA  L A L+KLQ++NLS+M+ D  YSA+HYSHP L ERL AI
Sbjct  376  FEFEADAFSHSLGYASELAAALIKLQKQNLSSMDADWMYSAFHYSHPILTERLKAI  431



>ref|XP_003685564.1| hypothetical protein TPHA_0E00340 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE63130.1| hypothetical protein TPHA_0E00340 [Tetrapisispora phaffii CBS 
4417]
Length=457

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QAD  AK LGY+  L   L+ LQ +NLS MN DP YS+YHYSHP L ERL A+D   +
Sbjct  394  EYQADEYAKDLGYSKHLCKALISLQVKNLSTMNVDPLYSSYHYSHPTLAERLNALDYVSE  453

Query  370  KTD  362
            K +
Sbjct  454  KKE  456



>emb|CEP19164.1| hypothetical protein [Parasitella parasitica]
Length=442

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            E++ADA A KLGYA  LR+ L+KL  +NL   N DPWYSA+++SHP LVERL A+
Sbjct  370  EYEADAYALKLGYASTLRSALIKLSVKNLGGFNVDPWYSAWNHSHPSLVERLKAL  424



>emb|CEJ00851.1| hypothetical protein RMCBS344292_14897 [Rhizopus microsporus]
Length=440

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            E++ADA A KLGYA  LR+ L+KL  +NL   N DPWYSA+++SHP LVERL A+
Sbjct  368  EYEADAYALKLGYASTLRSALIKLSVKNLGGFNVDPWYSAWNHSHPSLVERLNAL  422



>dbj|GAN04268.1| metallopeptidase [Mucor ambiguus]
Length=442

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            E++ADA A KLGYA  LR+ L+KL  +NL   N DPWYSA+++SHP LVERL A+
Sbjct  370  EYEADAYALKLGYASTLRSALIKLSVKNLGGFNVDPWYSAWNHSHPSLVERLKAL  424



>gb|KIW01377.1| hypothetical protein PV09_07145 [Verruconis gallopava]
Length=462

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            +FEFQAD  A KLGY   L   L+KLQ +NLS+M+ D +YS+YHYSHP L ERL AI   
Sbjct  378  TFEFQADNFALKLGYQAELAQALIKLQIKNLSSMDADFYYSSYHYSHPILTERLKAIQWT  437

Query  376  DKK  368
             +K
Sbjct  438  GEK  440



>emb|CEG66514.1| hypothetical protein RMATCC62417_03079 [Rhizopus microsporus]
Length=440

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            E++ADA A KLGYA  LR+ L+KL  +NL   N DPWYSA+++SHP LVERL A+
Sbjct  368  EYEADAYALKLGYASTLRSALIKLSVKNLGGFNVDPWYSAWNHSHPSLVERLNAL  422



>ref|XP_008886307.1| CAAX metallo endopeptidase [Hammondia hammondi]
 gb|KEP63193.1| CAAX metallo endopeptidase [Hammondia hammondi]
Length=432

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EF+ADA A +LGY+  L+ GL+ +  EN + ++ DPW+S +HYSHPPL+ERL AI+  ++
Sbjct  367  EFEADAFACELGYSESLKQGLIAIHTENKACLDPDPWFSFWHYSHPPLLERLRAIEAIEE  426

Query  370  KTD  362
            K  
Sbjct  427  KNS  429



>ref|XP_002369947.1| peptidase family M48 domain-containing protein [Toxoplasma gondii 
ME49]
 gb|EPR58595.1| CAAX metallo endopeptidase [Toxoplasma gondii GT1]
 gb|EPT31952.1| CAAX metallo endopeptidase [Toxoplasma gondii ME49]
Length=432

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EF+ADA A +LGY+  L+ GL+ +  EN + ++ DPW+S +HYSHPPL+ERL AI+  ++
Sbjct  367  EFEADAFACELGYSESLKQGLIAIHTENKACLDPDPWFSFWHYSHPPLLERLRAIEAIEE  426

Query  370  K  368
            K
Sbjct  427  K  427



>gb|EPZ36837.1| Peptidase M48 domain-containing protein [Rozella allomycis CSF55]
Length=276

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E++ADA A K GY+L L   L+K+  ENLS +N D WY  YHY HP L ER+ AI   D 
Sbjct  214  EYEADAFAVKHGYSLELVNALIKIHSENLSNLNPDRWYVTYHYCHPTLFERIEAITSVDI  273

Query  370  KTD  362
            K +
Sbjct  274  KQE  276



>ref|XP_001639206.1| predicted protein [Nematostella vectensis]
 gb|EDO47143.1| predicted protein [Nematostella vectensis]
Length=563

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEFQADA AK+LG+A  LR+ L+KL ++NL     D  YSAYHYSHPPL+ERL A+
Sbjct  503  FEFQADAFAKQLGFAPHLRSALIKLHQDNLGFPIADKLYSAYHYSHPPLLERLRAL  558



>emb|CDJ60176.1| peptidase family M48 domain-containing protein, putative [Eimeria 
maxima]
Length=489

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA A +L Y   L+  L  +  EN S ++ DPWYS +HYSHPPL+ERL+AID    
Sbjct  380  EFQADAFACELNYGEQLKEALCTIHTENKSTLDPDPWYSWWHYSHPPLLERLSAIDAILT  439

Query  370  KT  365
            KT
Sbjct  440  KT  441



>ref|XP_007584901.1| putative prenyl protease protein [Neofusicoccum parvum UCRNP2]
 gb|EOD47581.1| putative prenyl protease protein [Neofusicoccum parvum UCRNP2]
Length=456

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+ADA A K GYA  L   L+KLQ +NLSAM+ D  YS++HYSHP L ERL AI    
Sbjct  377  FEFEADAFAMKQGYAQELAGSLIKLQIQNLSAMDADWMYSSFHYSHPILTERLRAIGYKG  436

Query  373  KKTD  362
            +K+ 
Sbjct  437  EKSS  440



>gb|ETO31171.1| hypothetical protein RFI_05949 [Reticulomyxa filosa]
Length=179

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEFQAD  A  LGY   +  GL+K+ +EN + +N D  +SAYHYSHPPL++RL AI +  
Sbjct  118  FEFQADKFAVDLGYQDHIYHGLIKIHQENKATLNPDWLFSAYHYSHPPLIQRLQAIRDAK  177

Query  373  K  371
            K
Sbjct  178  K  178



>gb|EKV19760.1| CaaX prenyl protease Ste24 [Penicillium digitatum PHI26]
 gb|EKV20861.1| CaaX prenyl protease Ste24 [Penicillium digitatum Pd1]
Length=456

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+AD  A KLGY+  L + L+KLQ +NLS M+ DP Y++YHYSHP L ERLAA+
Sbjct  375  FEFEADEFAHKLGYSDKLASSLLKLQIQNLSTMDADPIYASYHYSHPILTERLAAL  430



>ref|XP_009152612.1| STE24 endopeptidase [Exophiala dermatitidis NIH/UT8656]
 gb|EHY52151.1| STE24 endopeptidase [Exophiala dermatitidis NIH/UT8656]
Length=471

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+AD+ A+ LGY   L   L+KLQ +NLS M+ DP Y++YHYSHP L ERLAA+
Sbjct  383  FEFEADSFARNLGYQKELAKSLIKLQVQNLSTMDADPLYASYHYSHPILAERLAAL  438



>emb|CDI76342.1| peptidase family M48 domain-containing protein, putative [Eimeria 
acervulina]
Length=472

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA A +L Y   L+  L  +  EN S ++ DPWYS +HYSHPPL+ERL+AID   K
Sbjct  366  EFQADAFACELNYGEQLKEALCTIHTENKSTLDPDPWYSWWHYSHPPLLERLSAIDAILK  425

Query  370  K  368
            K
Sbjct  426  K  426



>emb|CDS07769.1| hypothetical protein LRAMOSA01718 [Absidia idahoensis var. thermophila]
Length=447

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            E++ADA A KLGYA  LR+ L+KL  +NL   N DPWYSA++ SHP L ERLAA+
Sbjct  373  EYEADAYAFKLGYAATLRSALIKLSVKNLGGFNVDPWYSAWNRSHPSLTERLAAL  427



>gb|EZF29046.1| hypothetical protein H101_07272 [Trichophyton interdigitale H6]
Length=140

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+ADA A KLGY+  L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  58   FEFEADAFAVKLGYSKELARSLLKLQIQNLSTMDADWMYASYHYSHPILSERLAAL  113



>emb|CDJ68920.1| peptidase family M48 domain-containing protein, putative [Eimeria 
necatrix]
Length=474

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  383
            EFQADA A +L Y   L+  L  +  EN S ++ DPWYS +HYSHPPL+ERLAAID
Sbjct  366  EFQADAFACRLHYGEQLKEALCTVHTENKSTLDPDPWYSWWHYSHPPLLERLAAID  421



>ref|XP_003661486.1| hypothetical protein MYCTH_2300946 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO56241.1| hypothetical protein MYCTH_2300946 [Myceliophthora thermophila 
ATCC 42464]
Length=461

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-EP  377
            FEFQADA A KLGY + L   L+KLQ +NLS M+ D  +++YH+SHP L ERL A++ +P
Sbjct  375  FEFQADAFANKLGYNIQLARSLIKLQIQNLSTMDADWMFASYHFSHPILTERLKALNWQP  434

Query  376  DKKTD  362
             +K +
Sbjct  435  TEKVE  439



>ref|XP_007780353.1| STE24 endopeptidase [Coniosporium apollinis CBS 100218]
 gb|EON65036.1| STE24 endopeptidase [Coniosporium apollinis CBS 100218]
Length=457

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            S E++ADA AKKLGY   L + L KLQ +NLS+M+ D  YS+YHYSHP L ERL AI   
Sbjct  376  SMEYEADAFAKKLGYTAELASALTKLQIQNLSSMDADWMYSSYHYSHPILTERLKAIGWK  435

Query  376  DKKTD  362
              K +
Sbjct  436  GGKVE  440



>emb|CDM27808.1| CAAX prenyl protease 1 [Penicillium roqueforti FM164]
Length=456

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+AD  A+ LGY+  L + L+KLQ +NLS M+ DP Y++YHYSHP L ERLAA+
Sbjct  375  FEFEADKFAQNLGYSDKLASSLLKLQIQNLSTMDADPIYASYHYSHPILTERLAAL  430



>emb|CDJ42877.1| peptidase family M48 domain-containing protein, putative [Eimeria 
tenella]
Length=474

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  383
            EFQADA A +L Y   L+  L  +  EN S ++ DPWYS +HYSHPPL+ERLAAID
Sbjct  366  EFQADAFACQLHYGEQLKEALCTVHTENKSTLDPDPWYSWWHYSHPPLLERLAAID  421



>emb|CDJ47135.1| peptidase family M48 domain-containing protein, putative [Eimeria 
brunetti]
Length=458

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA A +L Y   L+  L  +  EN S ++ DPWYS +HYSHPPL+ERL+AID   K
Sbjct  351  EFQADAFACELDYGEQLKEALCTIHTENKSTLDPDPWYSWWHYSHPPLLERLSAIDAILK  410

Query  370  K  368
            K
Sbjct  411  K  411



>emb|CDH48818.1| prenyl protease [Lichtheimia corymbifera JMRC:FSU:9682]
Length=447

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            E++ADA A KLGYA  LR+ L+KL  +NL   N DPWYSA++ SHP L ERL+A+
Sbjct  373  EYEADAYALKLGYAATLRSALIKLSVKNLGGFNVDPWYSAWNRSHPSLTERLSAL  427



>ref|XP_003649011.1| hypothetical protein THITE_2107126 [Thielavia terrestris NRRL 
8126]
 gb|AEO62675.1| hypothetical protein THITE_2107126 [Thielavia terrestris NRRL 
8126]
Length=461

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-EP  377
            FEFQADA A KLGY+  L   L+KLQ +NLS M+ D  +++YH+SHP L ERL A++ +P
Sbjct  375  FEFQADAFANKLGYSTELCRSLIKLQIQNLSTMDADWMFASYHFSHPILSERLKALNWQP  434

Query  376  DKKTD  362
             +K +
Sbjct  435  TQKVE  439



>ref|XP_008553204.1| PREDICTED: CAAX prenyl protease 1 homolog [Microplitis demolitor]
 gb|EZA46084.1| prenyl protease type I-like protein [Microplitis demolitor]
Length=445

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEFQADA  KKLG+A  L+  LVKL ++NLS    D  YS +H+SHPPL+ERL A+D+ D
Sbjct  386  FEFQADAFGKKLGHAAALKRALVKLHKDNLSFPLYDKLYSGWHHSHPPLLERLEALDKYD  445



>gb|EFZ21267.1| hypothetical protein SINV_07351 [Solenopsis invicta]
Length=436

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  380
            EFQAD  A KLG+  PL+A L+KLQ++NL     D WYS +++SHPP++ERL AID+
Sbjct  378  EFQADKFATKLGHGEPLKAALLKLQKDNLGYPLYDKWYSCWNHSHPPIIERLEAIDK  434



>gb|KIW82886.1| hypothetical protein Z517_02129 [Fonsecaea pedrosoi CBS 271.37]
Length=472

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+ADA A KLGY   L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+    
Sbjct  383  FEFEADAFATKLGYEKELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAALGWKS  442

Query  373  KKTD  362
             K+ 
Sbjct  443  SKSS  446



>ref|XP_002377095.1| CaaX prenyl protease Ste24 [Aspergillus flavus NRRL3357]
 gb|EED53849.1| CaaX prenyl protease Ste24 [Aspergillus flavus NRRL3357]
Length=379

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-EP  377
            FEFQADA A KLGY+  L + L+KLQ +NLS M+ D  Y++YHYSHP L ERL A+  + 
Sbjct  298  FEFQADAFAVKLGYSEKLASSLLKLQIQNLSTMDADWMYASYHYSHPILSERLKALGWKG  357

Query  376  DKKTD  362
             K TD
Sbjct  358  GKVTD  362



>ref|XP_011175799.1| PREDICTED: CAAX prenyl protease 1 homolog [Solenopsis invicta]
Length=441

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  380
            EFQAD  A KLG+  PL+A L+KLQ++NL     D WYS +++SHPP++ERL AID+
Sbjct  383  EFQADKFATKLGHGEPLKAALLKLQKDNLGYPLYDKWYSCWNHSHPPIIERLEAIDK  439



>gb|KEY76113.1| CaaX prenyl protease Ste24 [Aspergillus fumigatus var. RP-2014]
Length=456

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-EP  377
            FEF+ADA A KLGY+  L A L+KLQ +NLS M+ D  Y++YHYSHP L ERL A+  + 
Sbjct  375  FEFEADAFAVKLGYSEQLAASLLKLQIQNLSTMDADWMYASYHYSHPILTERLKALGWQG  434

Query  376  DKKTD**VEQPHAP  335
             K TD   E    P
Sbjct  435  GKVTDAKTEDSERP  448



>gb|EDP50136.1| CaaX prenyl protease Ste24 [Aspergillus fumigatus A1163]
Length=479

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-EP  377
            FEF+ADA A KLGY+  L A L+KLQ +NLS M+ D  Y++YHYSHP L ERL A+  + 
Sbjct  398  FEFEADAFAVKLGYSEQLAASLLKLQIQNLSTMDADWMYASYHYSHPILTERLKALGWQG  457

Query  376  DKKTD**VEQPHAP  335
             K TD   E    P
Sbjct  458  GKVTDAKTEDSERP  471



>ref|XP_752066.2| CaaX prenyl protease Ste24 [Aspergillus fumigatus Af293]
 gb|EAL90028.2| CaaX prenyl protease Ste24 [Aspergillus fumigatus Af293]
Length=465

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-EP  377
            FEF+ADA A KLGY+  L A L+KLQ +NLS M+ D  Y++YHYSHP L ERL A+  + 
Sbjct  384  FEFEADAFAVKLGYSEQLAASLLKLQIQNLSTMDADWMYASYHYSHPILTERLKALGWQG  443

Query  376  DKKTD**VEQPHAP  335
             K TD   E    P
Sbjct  444  GKVTDAKTEDSERP  457



>ref|XP_001949388.2| PREDICTED: CAAX prenyl protease 1 homolog [Acyrthosiphon pisum]
 ref|XP_008186215.1| PREDICTED: CAAX prenyl protease 1 homolog [Acyrthosiphon pisum]
Length=450

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            EFQADA AKKLGYA PL +GL++L  +NL     D  +SA+H++HP L+ERL AI + D
Sbjct  392  EFQADAFAKKLGYAKPLESGLIRLHNDNLGFPVYDSLFSAWHHTHPQLLERLEAISKTD  450



>ref|XP_002427421.1| caax prenyl protease ste24, putative [Pediculus humanus corporis]
 gb|EEB14683.1| caax prenyl protease ste24, putative [Pediculus humanus corporis]
Length=465

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+AD  AKKLG++  L+  L+KL  +NL     DPWYS +H+SHPPL+ERL A+ + D
Sbjct  406  FEFEADNFAKKLGHSNALKNALIKLNSDNLGFPIYDPWYSKWHHSHPPLLERLQALSKED  465



>ref|XP_003669587.1| hypothetical protein NDAI_0D00300 [Naumovozyma dairenensis CBS 
421]
 emb|CCD24344.1| hypothetical protein NDAI_0D00300 [Naumovozyma dairenensis CBS 
421]
Length=459

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AK LGY   L   L++LQ +NLS MN D  YS+YHYSHP L ERL A+    +
Sbjct  396  EYQADAYAKALGYTQHLCRALIELQIKNLSTMNVDTLYSSYHYSHPTLAERLTALGYVSE  455

Query  370  K  368
            K
Sbjct  456  K  456



>ref|XP_007788183.1| putative caax prenyl protease 1 protein [Eutypa lata UCREL1]
 gb|EMR72723.1| putative caax prenyl protease 1 protein [Eutypa lata UCREL1]
Length=370

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  383
            FEFQAD  A++LGY   L + L+KLQ +NLS M+ D  Y++YH+SHP L ERL A+D
Sbjct  290  FEFQADGFAQELGYKTELASSLIKLQIQNLSTMDADWMYASYHFSHPILSERLKALD  346



>gb|AAX27871.2| SJCHGC08945 protein [Schistosoma japonicum]
Length=126

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEFQADA A KLGY   L++ LV L ++NLS    D  YS +++SHPPL+ERL+AID+  
Sbjct  65   FEFQADAFAAKLGYKDYLKSALVTLLKDNLSFPVCDWLYSMFNHSHPPLLERLSAIDKC-  123

Query  373  KKTD  362
             KTD
Sbjct  124  -KTD  126



>ref|XP_001821320.1| CAAX prenyl protease 1 [Aspergillus oryzae RIB40]
 dbj|BAE59318.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EIT78461.1| metalloprotease [Aspergillus oryzae 3.042]
 gb|KDE82767.1| metalloprotease [Aspergillus oryzae 100-8]
Length=456

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-EP  377
            FEFQADA A KLGY+  L + L+KLQ +NLS M+ D  Y++YHYSHP L ERL A+  + 
Sbjct  375  FEFQADAFAVKLGYSEKLASSLLKLQIQNLSTMDADWMYASYHYSHPILSERLKALGWKG  434

Query  376  DKKTD  362
             K TD
Sbjct  435  GKVTD  439



>gb|KIX97886.1| hypothetical protein Z520_06664 [Fonsecaea multimorphosa CBS 
102226]
Length=472

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+ADA A +LGY   L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+    
Sbjct  383  FEFEADAFATRLGYEKELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAALGWKS  442

Query  373  KKTD  362
             K+ 
Sbjct  443  SKSS  446



>ref|XP_001267265.1| CaaX prenyl protease Ste24 [Neosartorya fischeri NRRL 181]
 gb|EAW25368.1| CaaX prenyl protease Ste24 [Neosartorya fischeri NRRL 181]
Length=465

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-EP  377
            FEF+ADA A KLGY+  L A L+KLQ +NLS M+ D  Y++YHYSHP L ERL A+  + 
Sbjct  384  FEFEADAFAVKLGYSEQLAASLLKLQIQNLSTMDADWMYASYHYSHPILSERLKALGWQG  443

Query  376  DKKTD**VEQPHAP  335
             K TD   E    P
Sbjct  444  GKVTDAKTEDSEKP  457



>gb|KHJ35024.1| putative peptidase family m48 [Erysiphe necator]
Length=456

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 11/74 (15%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI----  386
            +EFQAD  AK+LGY+  L   L+KLQ +NLS M+ D  Y++YH+SHP L ERL+AI    
Sbjct  375  YEFQADNFAKELGYSKDLAQSLIKLQIQNLSTMDADWIYASYHFSHPILTERLSAIGWYS  434

Query  385  -------DEPDKKT  365
                   DE D+KT
Sbjct  435  EQKIVGNDEKDEKT  448



>ref|XP_008031232.1| hypothetical protein SETTUDRAFT_35606 [Setosphaeria turcica Et28A]
 gb|EOA80677.1| hypothetical protein SETTUDRAFT_35606 [Setosphaeria turcica Et28A]
Length=461

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-E  380
            S E++ADA A KLGYA  L A L+KLQ +NLS+M+ D +YS++H+SHP L ERL A++  
Sbjct  378  SMEYEADAFAVKLGYARELGASLIKLQIQNLSSMDADWFYSSFHHSHPILTERLKAMNWV  437

Query  379  PDKKT  365
             DKK 
Sbjct  438  GDKKV  442



>ref|XP_009028164.1| hypothetical protein HELRODRAFT_193946 [Helobdella robusta]
 gb|ESN93745.1| hypothetical protein HELRODRAFT_193946 [Helobdella robusta]
Length=1187

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQAD  A KLGY   +++ LVKL  +NLS   TD  YS +HYSHPPL+ERL+A+   D 
Sbjct  348  EFQADGFACKLGYCRYIKSALVKLNLDNLSFPITDKLYSTFHYSHPPLLERLSAMGGADT  407

Query  370  KT  365
             T
Sbjct  408  DT  409



>ref|XP_003954896.1| hypothetical protein KAFR_0A03260 [Kazachstania africana CBS 
2517]
 emb|CCF55761.1| hypothetical protein KAFR_0A03260 [Kazachstania africana CBS 
2517]
Length=456

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AK LG+   L   L+ LQ +NLS MN D  YS+YHYSHP L ERL A++   +
Sbjct  393  EYQADAYAKMLGFENDLCHALINLQIKNLSTMNVDSLYSSYHYSHPTLAERLTALNYVSE  452

Query  370  K  368
            K
Sbjct  453  K  453



>ref|XP_007688928.1| hypothetical protein COCMIDRAFT_27157 [Bipolaris oryzae ATCC 
44560]
 gb|EUC44545.1| hypothetical protein COCMIDRAFT_27157 [Bipolaris oryzae ATCC 
44560]
Length=461

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            S E++ADA A KLGYA  L A L+KLQ +NLS+M+ D +YS++H+SHP L ERL A+   
Sbjct  378  SMEYEADAFAVKLGYARELGASLIKLQIQNLSSMDADWFYSSFHHSHPILTERLKAMKWT  437

Query  376  DKK  368
             +K
Sbjct  438  GEK  440



>ref|XP_007712871.1| hypothetical protein COCCADRAFT_37287 [Bipolaris zeicola 26-R-13]
 gb|EUC32856.1| hypothetical protein COCCADRAFT_37287 [Bipolaris zeicola 26-R-13]
 gb|EUN26116.1| hypothetical protein COCVIDRAFT_38569 [Bipolaris victoriae FI3]
Length=461

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            S E++ADA A KLGYA  L A L+KLQ +NLS+M+ D +YS++H+SHP L ERL A+   
Sbjct  378  SMEYEADAFAVKLGYARELGASLIKLQIQNLSSMDADWFYSSFHHSHPILTERLKAMKWT  437

Query  376  DKK  368
             +K
Sbjct  438  GEK  440



>gb|EMD85103.1| hypothetical protein COCHEDRAFT_1035767 [Bipolaris maydis C5]
 gb|ENH99233.1| hypothetical protein COCC4DRAFT_28605 [Bipolaris maydis ATCC 
48331]
Length=461

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  377
            S E++ADA A KLGYA  L A L+KLQ +NLS+M+ D +YS++H+SHP L ERL A+   
Sbjct  378  SMEYEADAFAVKLGYARELGASLIKLQIQNLSSMDADWFYSSFHHSHPILTERLKAMKWT  437

Query  376  DKK  368
             +K
Sbjct  438  GEK  440



>gb|EGD96703.1| CaaX prenyl protease [Trichophyton tonsurans CBS 112818]
Length=431

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+ADA A KLGY+  L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  375  FEFEADAFAVKLGYSKELARSLLKLQIQNLSTMDADWMYASYHYSHPILSERLAAL  430



>ref|XP_002112567.1| hypothetical protein TRIADDRAFT_25296 [Trichoplax adhaerens]
 gb|EDV24677.1| hypothetical protein TRIADDRAFT_25296 [Trichoplax adhaerens]
Length=481

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+AD  AK++G A  L  GL+KL E+NLS    D  YSA++YSHPPL+ERL  + +  
Sbjct  418  FEFEADRYAKEMGKANLLSVGLIKLHEDNLSFPVVDRLYSAFNYSHPPLLERLKELRKSS  477

Query  373  KKTD  362
            KK+D
Sbjct  478  KKSD  481



>gb|ELU11443.1| hypothetical protein CAPTEDRAFT_171238 [Capitella teleta]
Length=459

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+AD  AK LG A PLR+ LVKL ++NL    +D  YS +HYSHPPL+ER+ A+++ +
Sbjct  400  FEFEADRFAKSLGRAAPLRSALVKLNKDNLGFPISDWLYSTWHYSHPPLIERMKALEKEE  459



>gb|KIW26412.1| hypothetical protein PV07_09509 [Cladophialophora immunda]
Length=472

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+ADA A +LGY   L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+    
Sbjct  383  FEFEADAFATRLGYEKELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAALGWKS  442

Query  373  KK  368
             K
Sbjct  443  SK  444



>gb|EPS28736.1| hypothetical protein PDE_03682 [Penicillium oxalicum 114-2]
Length=456

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+ADA A+ LG++  L A L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  375  FEFEADAFAQGLGFSNELAASLMKLQIQNLSTMDADWMYASYHYSHPILTERLAAL  430



>ref|XP_011398178.1| CAAX prenyl protease 1-like protein [Auxenochlorella protothecoides]
 gb|KFM25286.1| CAAX prenyl protease 1-like protein [Auxenochlorella protothecoides]
Length=439

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  383
            FEFQADA     G A  L+A L+ L +EN S  +TDP YSAYHYSHPPL+ERL AID
Sbjct  366  FEFQADAFGVAQGRAEDLKAALLVLDKENKSPPHTDPLYSAYHYSHPPLLERLRAID  422



>ref|XP_007751798.1| STE24 endopeptidase [Cladophialophora psammophila CBS 110553]
 gb|EXJ53790.1| STE24 endopeptidase [Cladophialophora psammophila CBS 110553]
Length=471

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+ADA A +LGY   L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+    
Sbjct  383  FEFEADAFATRLGYEKELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAALGWKS  442

Query  373  KK  368
             K
Sbjct  443  SK  444



>gb|KIW94481.1| hypothetical protein Z519_04457 [Cladophialophora bantiana CBS 
173.52]
Length=471

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+ADA A +LGY   L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+    
Sbjct  383  FEFEADAFATRLGYEKELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAALGWKS  442

Query  373  KK  368
             K
Sbjct  443  SK  444



>ref|XP_003236858.1| CaaX prenyl protease [Trichophyton rubrum CBS 118892]
 gb|EGD85309.1| hypothetical protein TERG_01583 [Trichophyton rubrum CBS 118892]
 gb|EZF13842.1| hypothetical protein H100_06223 [Trichophyton rubrum MR850]
 gb|EZF39575.1| hypothetical protein H102_06190 [Trichophyton rubrum CBS 100081]
 gb|EZF50099.1| hypothetical protein H103_06215 [Trichophyton rubrum CBS 288.86]
 gb|EZF60731.1| hypothetical protein H104_06202 [Trichophyton rubrum CBS 289.86]
 gb|EZF71568.1| hypothetical protein H105_06229 [Trichophyton soudanense CBS 
452.61]
 gb|EZF82058.1| hypothetical protein H110_06211 [Trichophyton rubrum MR1448]
 gb|EZF92801.1| hypothetical protein H113_06258 [Trichophyton rubrum MR1459]
 gb|EZG03811.1| hypothetical protein H106_06053 [Trichophyton rubrum CBS 735.88]
 gb|EZG14381.1| hypothetical protein H107_06355 [Trichophyton rubrum CBS 202.88]
 gb|KDB31307.1| hypothetical protein H112_06208 [Trichophyton rubrum D6]
Length=459

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+ADA A KLGY+  L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  376  FEFEADAFAVKLGYSKELARSLLKLQIQNLSTMDADWMYASYHYSHPILSERLAAL  431



>gb|EGE06070.1| CAAX prenyl protease [Trichophyton equinum CBS 127.97]
 gb|KDB23738.1| hypothetical protein H109_04418 [Trichophyton interdigitale MR816]
Length=457

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+ADA A KLGY+  L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  375  FEFEADAFAVKLGYSKELARSLLKLQIQNLSTMDADWMYASYHYSHPILSERLAAL  430



>ref|XP_006681887.1| hypothetical protein BATDEDRAFT_17759 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77279.1| hypothetical protein BATDEDRAFT_17759 [Batrachochytrium dendrobatidis 
JAM81]
Length=438

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            EFQADA AK   YA  L+ GL+K+  +N S +N D  YS +HYSHPPLVERL+A+ +  K
Sbjct  377  EFQADAYAKNRNYATDLKNGLIKIHLKNSSNLNPDKLYSIWHYSHPPLVERLSALLQKSK  436



>ref|XP_003023010.1| hypothetical protein TRV_02831 [Trichophyton verrucosum HKI 0517]
 gb|EFE42392.1| hypothetical protein TRV_02831 [Trichophyton verrucosum HKI 0517]
Length=585

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+ADA A KLGY+  L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  502  FEFEADAFAVKLGYSKELARSLLKLQIQNLSTMDADWMYASYHYSHPILSERLAAL  557



>ref|XP_003172087.1| CAAX prenyl protease 1 [Microsporum gypseum CBS 118893]
 gb|EFR01676.1| CAAX prenyl protease 1 [Microsporum gypseum CBS 118893]
Length=457

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+ADA A KLGY+  L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  375  FEFEADAFAVKLGYSKELARSLLKLQIQNLSTMDADWMYASYHYSHPILSERLAAL  430



>ref|XP_001939034.1| CaaX prenyl protease [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU41753.1| CaaX prenyl protease [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=461

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-E  380
            S E++ADA A KLGYA  L + L+KLQ +NLS+M+ D +YS++H+SHP L ERL A+   
Sbjct  378  SMEYEADAFAVKLGYARELGSSLIKLQIQNLSSMDADWFYSSFHHSHPILTERLKAMKWT  437

Query  379  PDKKT  365
             DKK 
Sbjct  438  GDKKV  442



>gb|ENH82556.1| prenyl protease ste24 [Colletotrichum orbiculare MAFF 240422]
Length=454

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  383
            +EFQADA A+KLGY++ L   L+KLQ +NLS M+ D  Y+ YH+SHP L ERL A++
Sbjct  375  YEFQADAFAQKLGYSVDLAKSLLKLQIQNLSTMDADWMYATYHFSHPHLSERLQALN  431



>gb|KIX06592.1| hypothetical protein Z518_04568 [Rhinocladiella mackenziei CBS 
650.93]
Length=465

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+AD  A+ LGY   L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+    
Sbjct  377  FEFEADTFARNLGYQKELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAALGWKS  436

Query  373  KKT  365
             K+
Sbjct  437  SKS  439



>ref|XP_001271650.1| CaaX prenyl protease Ste24 [Aspergillus clavatus NRRL 1]
 gb|EAW10224.1| CaaX prenyl protease Ste24 [Aspergillus clavatus NRRL 1]
Length=456

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+ADA A KLGY+  L A L+KLQ +NLS M+ D  Y++YHYSHP L ERL A+
Sbjct  375  FEFEADAFAVKLGYSEQLAASLLKLQIQNLSTMDADWMYASYHYSHPILSERLKAL  430



>gb|EPX72601.1| CAA Xprenyl protease [Schizosaccharomyces octosporus yFS286]
Length=457

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -3

Query  550  EFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  371
            E+QADA AKKLG A  L  GL+++  +NLS +  DP Y++YH+SHP L +RLAAID  + 
Sbjct  394  EYQADAFAKKLGLAKDLGDGLIRIHNDNLSPLEYDPLYTSYHHSHPILTDRLAAIDYMEL  453

Query  370  KTD  362
            K +
Sbjct  454  KKN  456



>gb|EAR85063.2| M48 family peptidase [Tetrahymena thermophila SB210]
Length=800

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  380
            FEFQAD  A  LGY   L +GL K+Q+E++S +N DPWY+ + +SHP L ERL  I +
Sbjct  336  FEFQADTFACNLGYGYYLMSGLTKIQKEDVSTLNPDPWYAWFKHSHPGLFERLKRIKQ  393



>ref|XP_003300873.1| hypothetical protein PTT_12236 [Pyrenophora teres f. teres 0-1]
 gb|EFQ91005.1| hypothetical protein PTT_12236 [Pyrenophora teres f. teres 0-1]
Length=484

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = -3

Query  556  SFEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-E  380
            S E++ADA A KLGYA  L + L+KLQ +NLS+M+ D +YS++H+SHP L ERL A+   
Sbjct  401  SMEYEADAFAVKLGYARELGSSLIKLQIQNLSSMDADWFYSSFHHSHPILTERLKAMKWT  460

Query  379  PDKKT  365
             DKK 
Sbjct  461  GDKKV  465



>ref|XP_002627156.1| CaaX prenyl protease [Blastomyces dermatitidis SLH14081]
 gb|EEQ74796.1| CaaX prenyl protease [Blastomyces dermatitidis SLH14081]
 gb|EEQ88614.1| CaaX prenyl protease [Blastomyces dermatitidis ER-3]
 gb|EGE77219.1| CaaX prenyl protease [Blastomyces dermatitidis ATCC 18188]
 gb|EQL38711.1| STE24 endopeptidase [Blastomyces dermatitidis ATCC 26199]
Length=456

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEF+ADA A  LGY+  L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  375  FEFEADAFAVNLGYSTELAKSLLKLQIQNLSTMDADWMYASYHYSHPILTERLAAL  430



>ref|XP_007283748.1| prenyl protease [Colletotrichum gloeosporioides Nara gc5]
 gb|ELA27205.1| prenyl protease [Colletotrichum gloeosporioides Nara gc5]
 gb|EQB58878.1| peptidase family M48 [Colletotrichum gloeosporioides Cg-14]
Length=454

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  383
            +EFQADA A+KLGY++ L   L+KLQ +NLS M+ D  Y+ YH+SHP L ERL A++
Sbjct  375  YEFQADAFAQKLGYSVELAKSLLKLQIQNLSTMDADWVYATYHFSHPHLSERLKALN  431



>ref|XP_007754023.1| STE24 endopeptidase [Cladophialophora yegresii CBS 114405]
 gb|EXJ65456.1| STE24 endopeptidase [Cladophialophora yegresii CBS 114405]
Length=474

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+AD  AK LGY   L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+    
Sbjct  383  FEFEADKFAKDLGYQNELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAALGWKS  442

Query  373  KKTD  362
             K +
Sbjct  443  SKGE  446



>ref|XP_002842311.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ86502.1| unnamed protein product [Tuber melanosporum]
Length=438

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+ADA A  LGYA  L   L+KLQ +NL+ M+ D  YS YHY+HP L ERL A++   
Sbjct  375  FEFEADAFAVNLGYAEELSKSLIKLQVQNLATMDADWLYSCYHYTHPILPERLRALELKG  434

Query  373  KK  368
            KK
Sbjct  435  KK  436



>ref|XP_001032726.1| Peptidase family M48 containing protein [Tetrahymena thermophila]
Length=753

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  380
            FEFQAD  A  LGY   L +GL K+Q+E++S +N DPWY+ + +SHP L ERL  I +
Sbjct  289  FEFQADTFACNLGYGYYLMSGLTKIQKEDVSTLNPDPWYAWFKHSHPGLFERLKRIKQ  346



>ref|XP_008724234.1| hypothetical protein G647_10020 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI26921.1| hypothetical protein G647_10020 [Cladophialophora carrionii CBS 
160.54]
Length=474

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            FEF+AD  AK LGY   L   L+KLQ +NLS M+ D  Y++YHYSHP L ERLAA+    
Sbjct  383  FEFEADKFAKDLGYQNELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAALGWKS  442

Query  373  KKTD  362
             K +
Sbjct  443  SKGE  446



>gb|EFX04750.1| prenyl protease ste24 [Grosmannia clavigera kw1407]
Length=637

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  383
            +EFQADA A+ LGY+  L   L+KLQ +NLS M+ D  Y+ YH+SHP L ERL AID
Sbjct  375  YEFQADAFARGLGYSEDLARSLIKLQIQNLSTMDADWMYANYHFSHPILTERLKAID  431



>gb|EAR82576.3| CAAX prenyl protease [Tetrahymena thermophila SB210]
Length=434

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            +EFQAD  A ++GYA  L AGL+K+ +EN   +   P YS YHYSHPPL ERL  ID   
Sbjct  371  YEFQADNYAFQMGYAKQLYAGLIKMFKENAGNLLPHPIYSWYHYSHPPLKERLEQIDNLL  430

Query  373  KKTD  362
            KK++
Sbjct  431  KKSN  434



>gb|EWG42807.1| STE24 endopeptidase [Fusarium verticillioides 7600]
Length=463

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  386
            FEFQADA AKKLGY   L   L+KLQ +NLS M+ D  Y++YH+SHP L ERL A+
Sbjct  375  FEFQADAFAKKLGYPEELARSLLKLQIQNLSTMDADWMYASYHFSHPHLSERLKAL  430



>ref|XP_001030239.2| Peptidase family M48 containing protein [Tetrahymena thermophila]
Length=476

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -3

Query  553  FEFQADAXAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  374
            +EFQAD  A ++GYA  L AGL+K+ +EN   +   P YS YHYSHPPL ERL  ID   
Sbjct  413  YEFQADNYAFQMGYAKQLYAGLIKMFKENAGNLLPHPIYSWYHYSHPPLKERLEQIDNLL  472

Query  373  KKTD  362
            KK++
Sbjct  473  KKSN  476



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750