BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF044O13

Length=625
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             163   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             162   2e-43   Vitis vinifera
gb|KJB72025.1|  hypothetical protein B456_011G154000                    157   2e-43   Gossypium raimondii
gb|KJB19538.1|  hypothetical protein B456_003G108500                    162   3e-43   Gossypium raimondii
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                161   5e-43   
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  160   8e-43   Nelumbo nucifera [Indian lotus]
gb|AFV46215.1|  hypothetical protein                                    157   1e-42   Scutellaria baicalensis [Baikal skullcap]
gb|KJB72026.1|  hypothetical protein B456_011G154000                    157   1e-42   Gossypium raimondii
dbj|BAF01736.1|  adenosylhomocysteinase                                 150   1e-42   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA03710.1|  cytokinin binding protein CBP57                        159   1e-42   Nicotiana sylvestris
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  160   1e-42   Nelumbo nucifera [Indian lotus]
gb|KHN44476.1|  Adenosylhomocysteinase                                  156   1e-42   Glycine soja [wild soybean]
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             160   2e-42   Nicotiana sylvestris
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  159   2e-42   Gossypium arboreum [tree cotton]
emb|CDP11183.1|  unnamed protein product                                159   3e-42   Coffea canephora [robusta coffee]
emb|CAH69227.1|  putative adenosylhomocysteinase                        154   3e-42   Nicotiana glauca [glaucous tobacco]
gb|KJB72027.1|  hypothetical protein B456_011G154000                    158   4e-42   Gossypium raimondii
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             159   4e-42   Phoenix dactylifera
gb|AFK46472.1|  unknown                                                 155   4e-42   Lotus japonicus
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             159   4e-42   
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  159   4e-42   Sesamum indicum [beniseed]
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  159   4e-42   Gossypium arboreum [tree cotton]
gb|KJB37873.1|  hypothetical protein B456_006G223900                    159   5e-42   Gossypium raimondii
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     158   5e-42   Nicotiana tabacum [American tobacco]
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             158   5e-42   Nicotiana tomentosiformis
gb|KHN12344.1|  Adenosylhomocysteinase                                  157   5e-42   Glycine soja [wild soybean]
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           158   6e-42   Tarenaya hassleriana [spider flower]
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                158   7e-42   Eucalyptus grandis [rose gum]
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      158   7e-42   Gossypium hirsutum [American cotton]
gb|KJB72029.1|  hypothetical protein B456_011G154000                    158   7e-42   Gossypium raimondii
dbj|BAH57232.1|  AT4G13940                                              154   7e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KHG17040.1|  Adenosylhomocysteinase                                  158   7e-42   Gossypium arboreum [tree cotton]
gb|AAA33855.1|  S-adenosylhomocysteine hydrolase                        152   7e-42   Petroselinum crispum
gb|KJB72024.1|  hypothetical protein B456_011G154000                    158   8e-42   Gossypium raimondii
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  158   8e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB28098.1|  hypothetical protein B456_005G027700                    158   8e-42   Gossypium raimondii
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             157   1e-41   Phaseolus vulgaris [French bean]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         157   1e-41   Jatropha curcas
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  157   1e-41   
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    157   2e-41   Pinus pinaster [cluster pine]
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             157   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             157   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP15078.1|  unnamed protein product                                157   2e-41   Coffea canephora [robusta coffee]
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  156   3e-41   Vitis vinifera
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                156   3e-41   Tarenaya hassleriana [spider flower]
gb|EMT11613.1|  Adenosylhomocysteinase                                  152   4e-41   
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               156   4e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             156   4e-41   Glycine max [soybeans]
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             156   4e-41   Elaeis guineensis
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             155   4e-41   Oryza sativa Japonica Group [Japonica rice]
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     155   4e-41   Eucalyptus grandis [rose gum]
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                156   5e-41   Chlorella variabilis
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             156   5e-41   Elaeis guineensis
ref|NP_001031627.1|  adenosylhomocysteinase 1                           154   5e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KJB72028.1|  hypothetical protein B456_011G154000                    155   5e-41   Gossypium raimondii
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  155   5e-41   Eucalyptus grandis [rose gum]
ref|XP_010097949.1|  hypothetical protein L484_026840                   155   5e-41   Morus notabilis
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             155   7e-41   Glycine max [soybeans]
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    155   7e-41   
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             155   7e-41   Phoenix dactylifera
tpg|DAA38860.1|  TPA: hypothetical protein ZEAMMB73_022938              151   8e-41   
ref|NP_001031628.1|  adenosylhomocysteinase 1                           154   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             155   1e-40   Arabidopsis lyrata subsp. lyrata
ref|NP_001067845.2|  Os11g0455500                                       155   1e-40   
ref|XP_003601687.1|  Adenosylhomocysteinase                             155   1e-40   Medicago truncatula
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   155   1e-40   Ricinus communis
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    155   1e-40   Petroselinum crispum
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    154   1e-40   Medicago sativa [alfalfa]
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             154   1e-40   Sesamum indicum [beniseed]
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          154   1e-40   Amborella trichopoda
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      154   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             154   2e-40   Capsella rubella
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             154   2e-40   Oryza brachyantha
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             154   2e-40   Solanum lycopersicum
ref|XP_010466741.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    150   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             154   2e-40   Sesamum indicum [beniseed]
gb|AGT16642.1|  Adenosylhomocysteinase                                  154   2e-40   Saccharum hybrid cultivar R570
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             154   2e-40   Solanum tuberosum [potatoes]
ref|NP_001265954.1|  adenosylhomocysteinase-like                        154   2e-40   Cicer arietinum [garbanzo]
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             154   2e-40   Cicer arietinum [garbanzo]
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             154   2e-40   Setaria italica
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    154   2e-40   Arabis alpina [alpine rockcress]
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       154   2e-40   Nicotiana suaveolens
gb|ACN34730.1|  unknown                                                 154   2e-40   Zea mays [maize]
ref|NP_001148534.1|  adenosylhomocysteinase                             154   2e-40   
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  154   2e-40   Solanum lycopersicum
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                154   2e-40   Tarenaya hassleriana [spider flower]
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     154   2e-40   Nicotiana tabacum [American tobacco]
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       154   2e-40   Gentiana triflora
ref|NP_001289538.1|  adenosylhomocysteinase                             154   2e-40   Nicotiana sylvestris
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       154   3e-40   Nicotiana benthamiana
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       154   3e-40   Prunus mume [ume]
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  154   3e-40   Phoenix dactylifera
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             154   3e-40   Prunus persica
gb|KIZ05177.1|  adenosylhomocysteinase                                  157   3e-40   Monoraphidium neglectum
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     154   3e-40   Populus tomentosa [Chinese white poplar]
gb|ABK25129.1|  unknown                                                 154   3e-40   Picea sitchensis
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   154   3e-40   Populus tomentosa [Chinese white poplar]
gb|ABK24229.1|  unknown                                                 154   3e-40   Picea sitchensis
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   154   3e-40   Populus tomentosa [Chinese white poplar]
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    154   3e-40   Catharanthus roseus [chatas]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   154   3e-40   Populus tomentosa [Chinese white poplar]
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             154   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             153   3e-40   Cucumis melo [Oriental melon]
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|ACN40278.1|  unknown                                                 153   4e-40   Picea sitchensis
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             153   4e-40   Populus euphratica
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    153   4e-40   Lupinus luteus
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    153   4e-40   
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|ABR17322.1|  unknown                                                 153   4e-40   Picea sitchensis
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             153   4e-40   Cucumis sativus [cucumbers]
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    153   4e-40   Lupinus luteus
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  153   4e-40   Pyrus x bretschneideri [bai li]
gb|ABR16547.1|  unknown                                                 153   4e-40   Picea sitchensis
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  153   4e-40   Malus domestica [apple tree]
gb|ABR16138.1|  unknown                                                 153   4e-40   Picea sitchensis
ref|NP_193130.1|  adenosylhomocysteinase 1                              153   4e-40   Arabidopsis thaliana [mouse-ear cress]
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                153   4e-40   Solanum tuberosum [potatoes]
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            153   4e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   153   4e-40   Populus tomentosa [Chinese white poplar]
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             153   4e-40   Selaginella moellendorffii
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   153   5e-40   Populus tomentosa [Chinese white poplar]
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             153   5e-40   Setaria italica
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       153   5e-40   Gentiana triflora
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               153   6e-40   Capsicum annuum
gb|ABR16573.1|  unknown                                                 153   6e-40   Picea sitchensis
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  153   6e-40   Fragaria vesca subsp. vesca
gb|EPS72602.1|  adenosylhomocysteinase                                  153   7e-40   Genlisea aurea
gb|AAM62888.1|  adenosylhomocysteinase                                  152   8e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   152   8e-40   Populus tomentosa [Chinese white poplar]
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    152   8e-40   
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   152   8e-40   Citrus sinensis [apfelsine]
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    152   9e-40   Arabis alpina [alpine rockcress]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                152   9e-40   
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    152   1e-39   Phalaenopsis sp.
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              152   1e-39   Volvox carteri f. nagariensis
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    152   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|EMS57067.1|  Adenosylhomocysteinase                                  151   1e-39   Triticum urartu
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             153   1e-39   
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  152   1e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|ABR16616.1|  unknown                                                 152   1e-39   Picea sitchensis
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   152   1e-39   Populus tomentosa [Chinese white poplar]
emb|CDY47309.1|  BnaAnng08830D                                          152   1e-39   Brassica napus [oilseed rape]
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   152   1e-39   Citrus sinensis [apfelsine]
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             152   1e-39   Citrus sinensis [apfelsine]
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             152   1e-39   Citrus clementina [clementine]
emb|CDY50423.1|  BnaCnng19320D                                          152   1e-39   Brassica napus [oilseed rape]
emb|CDY01177.1|  BnaA04g06420D                                          152   1e-39   
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                152   1e-39   Brassica rapa
gb|AAM19782.1|  AT3g23810/MYM9_15                                       152   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                152   1e-39   Erythranthe guttata [common monkey flower]
ref|NP_189023.1|  adenosylhomocysteinase 2                              152   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             152   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                152   2e-39   Brassica rapa
ref|XP_003629610.1|  Adenosylhomocysteinase                             152   2e-39   Medicago truncatula
gb|AEI54335.1|  adenosylhomocysteinase                                  151   2e-39   Glycine max [soybeans]
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   151   2e-39   Populus tomentosa [Chinese white poplar]
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           151   2e-39   Brassica rapa
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             151   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             152   2e-39   
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   151   2e-39   Populus tomentosa [Chinese white poplar]
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             151   2e-39   Eutrema salsugineum [saltwater cress]
dbj|BAE71233.1|  putative adenosylhomocysteinase                        151   2e-39   Trifolium pratense [peavine clover]
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            151   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             151   2e-39   Phaseolus vulgaris [French bean]
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  151   2e-39   Chlamydomonas reinhardtii
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            151   3e-39   Arabidopsis thaliana [mouse-ear cress]
gb|EMS57266.1|  Adenosylhomocysteinase                                  153   3e-39   Triticum urartu
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   151   3e-39   Populus tomentosa [Chinese white poplar]
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   151   3e-39   Populus tomentosa [Chinese white poplar]
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        151   3e-39   
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       151   3e-39   
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     151   3e-39   Phaseolus vulgaris [French bean]
ref|XP_001755929.1|  predicted protein                                  150   3e-39   
ref|XP_001755926.1|  predicted protein                                  150   3e-39   
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        150   3e-39   Kalanchoe daigremontiana
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     150   4e-39   Cucumis sativus [cucumbers]
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                150   4e-39   Cucumis melo [Oriental melon]
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             150   4e-39   
ref|XP_001755906.1|  predicted protein                                  150   4e-39   
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    150   5e-39   Arabis alpina [alpine rockcress]
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  150   5e-39   Malus domestica [apple tree]
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                150   6e-39   Erythranthe guttata [common monkey flower]
ref|NP_001234012.1|  adenosylhomocysteinase                             150   6e-39   
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   150   7e-39   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   150   7e-39   Populus tomentosa [Chinese white poplar]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   150   7e-39   Populus tomentosa [Chinese white poplar]
gb|EMT01272.1|  Adenosylhomocysteinase                                  150   7e-39   
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       150   8e-39   Chlamydomonas sp. ICE-L
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                149   9e-39   Camelina sativa [gold-of-pleasure]
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     149   9e-39   Populus tomentosa [Chinese white poplar]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           149   9e-39   Camelina sativa [gold-of-pleasure]
ref|XP_008671500.1|  PREDICTED: adenosylhomocysteinase-like             149   9e-39   
ref|XP_006373090.1|  adenosylhomocysteinase family protein              149   9e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    149   1e-38   Camelina sativa [gold-of-pleasure]
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    149   1e-38   Mesembryanthemum crystallinum
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                150   1e-38   Erythranthe guttata [common monkey flower]
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    150   1e-38   Linum usitatissimum
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
ref|XP_003057172.1|  adenosylhomocysteinase                             149   1e-38   Micromonas pusilla CCMP1545
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      149   1e-38   Petunia x hybrida [garden petunia]
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             149   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  149   1e-38   Populus euphratica
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     149   1e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     149   2e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     149   2e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     149   2e-38   Populus tomentosa [Chinese white poplar]
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                149   2e-38   Brassica rapa
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     149   2e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     149   2e-38   Populus tomentosa [Chinese white poplar]
ref|XP_002505983.1|  adenosylhomocysteinase                             149   2e-38   Micromonas commoda
ref|XP_002300147.1|  adenosylhomocysteinase family protein              149   2e-38   Populus trichocarpa [western balsam poplar]
gb|KFK36282.1|  hypothetical protein AALP_AA4G102500                    141   2e-38   Arabis alpina [alpine rockcress]
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       148   2e-38   Dunaliella salina
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    147   3e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003081254.1|  SAHH_PETCR Adenosylhomocysteinase (ISS)            147   5e-38   
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    147   5e-38   Ostreococcus tauri
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     147   5e-38   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     147   6e-38   Populus tomentosa [Chinese white poplar]
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     147   7e-38   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     146   1e-37   Populus tomentosa [Chinese white poplar]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     146   1e-37   Populus tomentosa [Chinese white poplar]
gb|ABJ53283.1|  S-adenosyl-L-homocysteine hydrolase                     144   1e-37   
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     146   1e-37   Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     146   1e-37   Populus tomentosa [Chinese white poplar]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     146   1e-37   Populus tomentosa [Chinese white poplar]
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                146   2e-37   Bathycoccus prasinos
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      145   4e-37   Polytomella sp. Pringsheim 198.80
ref|XP_001419579.1|  predicted protein                                  144   7e-37   Ostreococcus lucimarinus CCE9901
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    144   1e-36   Triticum aestivum [Canadian hard winter wheat]
gb|ACI31554.1|  S-adenosyl homocysteine hydrolase                       137   4e-36   Nicotiana benthamiana
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  141   1e-35   Coccomyxa subellipsoidea C-169
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     140   2e-35   Helicosporidium sp. ATCC 50920
ref|XP_011397211.1|  Adenosylhomocysteinase                             139   8e-35   Auxenochlorella protothecoides
gb|AAL09400.1|AF307335_1  cytokinin binding protein                     137   2e-34   Petunia x hybrida [garden petunia]
gb|EJK64241.1|  hypothetical protein THAOC_15047                        133   2e-34   Thalassiosira oceanica
ref|WP_038031735.1|  adenosylhomocysteinase                             137   3e-34   
ref|XP_005708566.1|  adenosylhomocysteinase                             136   6e-34   
gb|KDO17385.1|  hypothetical protein SPRG_17078                         129   7e-34   
ref|WP_014245567.1|  S-adenosyl-L-homocysteine hydrolase                133   4e-33   
ref|WP_021266239.1|  adenosylhomocysteinase                             133   5e-33   
ref|XP_002177758.1|  adenosylhomocysteinase                             133   6e-33   
ref|WP_012975209.1|  S-adenosyl-L-homocysteine hydrolase                132   9e-33   
ref|WP_020590636.1|  S-adenosyl-L-homocysteine hydrolase                132   9e-33   
ref|XP_008872075.1|  adenosylhomocysteinase 2                           132   1e-32   
ref|WP_013817471.1|  S-adenosyl-L-homocysteine hydrolase                132   2e-32   
ref|WP_026869144.1|  adenosylhomocysteinase                             132   2e-32   
ref|WP_013164653.1|  S-adenosyl-L-homocysteine hydrolase                131   2e-32   
gb|EKD42312.1|  hypothetical protein ACD_73C00209G0001                  126   2e-32   
ref|WP_029207109.1|  hypothetical protein                               126   2e-32   
gb|ETO04662.1|  hypothetical protein RFI_32734                          127   3e-32   
ref|WP_028072773.1|  hypothetical protein                               124   3e-32   
gb|ETO08386.1|  hypothetical protein RFI_29000                          128   3e-32   
ref|WP_022926989.1|  S-adenosyl-L-homocysteine hydrolase                131   3e-32   
ref|XP_009493630.1|  adenosylhomocysteinase 1                           131   3e-32   
ref|WP_042691048.1|  adenosylhomocysteinase                             130   4e-32   
ref|WP_018050034.1|  hypothetical protein                               125   4e-32   
ref|WP_039756265.1|  hypothetical protein                               123   5e-32   
ref|WP_013219512.1|  S-adenosyl-L-homocysteine hydrolase                130   5e-32   
ref|WP_013664531.1|  S-adenosyl-L-homocysteine hydrolase                130   6e-32   
ref|WP_026147028.1|  adenosylhomocysteinase                             130   6e-32   
ref|WP_037452032.1|  adenosylhomocysteinase                             130   6e-32   
ref|WP_029167185.1|  adenosylhomocysteinase                             130   7e-32   
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase                130   8e-32   
ref|WP_044401865.1|  adenosylhomocysteinase                             130   9e-32   
ref|WP_021273157.1|  adenosylhomocysteinase                             129   9e-32   
ref|WP_036277747.1|  adenosylhomocysteinase                             129   9e-32   
ref|WP_036273174.1|  adenosylhomocysteinase                             129   1e-31   
ref|WP_005850713.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    129   1e-31   
ref|WP_020248605.1|  hypothetical protein                               125   1e-31   
ref|WP_009825689.1|  S-adenosyl-L-homocysteine hydrolase                129   1e-31   
ref|WP_037965658.1|  S-adenosyl-L-homocysteine hydrolase                129   1e-31   
ref|XP_008611237.1|  adenosylhomocysteinase                             129   1e-31   
gb|AHG90399.1|  Adenosylhomocysteinase                                  130   1e-31   
dbj|BAQ16042.1|  adenosylhomocysteinase                                 129   1e-31   
ref|WP_041537150.1|  adenosylhomocysteinase                             129   1e-31   
ref|WP_033157853.1|  adenosylhomocysteinase                             129   1e-31   
ref|WP_027298975.1|  adenosylhomocysteinase                             129   1e-31   
gb|ADY54122.1|  adenosylhomocysteinase                                  129   2e-31   
ref|WP_044425347.1|  adenosylhomocysteinase                             129   2e-31   
ref|WP_026814658.1|  adenosylhomocysteinase                             129   2e-31   
ref|WP_011629999.1|  S-adenosyl-L-homocysteine hydrolase                129   2e-31   
ref|WP_028061676.1|  hypothetical protein                               129   2e-31   
ref|WP_009505589.1|  S-adenosyl-L-homocysteine hydrolase                129   2e-31   
ref|WP_029015961.1|  adenosylhomocysteinase                             129   2e-31   
ref|WP_006914979.1|  S-adenosyl-L-homocysteine hydrolase                129   2e-31   
ref|XP_002290951.1|  hypothetical protein THAPSDRAFT_28496              129   2e-31   
ref|WP_011134520.1|  S-adenosyl-L-homocysteine hydrolase                129   3e-31   
ref|WP_041295981.1|  S-adenosyl-L-homocysteine hydrolase                129   3e-31   
gb|ACV25657.1|  adenosylhomocysteinase                                  129   3e-31   
ref|WP_043612994.1|  S-adenosyl-L-homocysteine hydrolase                128   3e-31   
ref|WP_033921247.1|  S-adenosyl-L-homocysteine hydrolase                128   3e-31   
ref|WP_028607543.1|  adenosylhomocysteinase                             128   3e-31   
ref|XP_009833581.1|  adenosylhomocysteinase 2                           128   3e-31   
ref|WP_009520877.1|  S-adenosyl-L-homocysteine hydrolase                128   3e-31   
ref|WP_028769932.1|  S-adenosyl-L-homocysteine hydrolase                128   3e-31   
ref|WP_020039523.1|  S-adenosyl-L-homocysteine hydrolase                128   4e-31   
ref|WP_008889059.1|  S-adenosyl-L-homocysteine hydrolase                128   4e-31   
ref|XP_009033133.1|  hypothetical protein AURANDRAFT_69644              128   4e-31   
ref|WP_010185446.1|  S-adenosyl-L-homocysteine hydrolase                128   4e-31   
ref|WP_020557949.1|  S-adenosyl-L-homocysteine hydrolase                128   4e-31   
ref|WP_009103322.1|  adenosylhomocysteinase                             128   4e-31   
ref|WP_026910859.1|  S-adenosyl-L-homocysteine hydrolase                128   4e-31   
ref|WP_027420126.1|  adenosylhomocysteinase                             128   4e-31   
ref|WP_044830294.1|  adenosylhomocysteinase                             127   4e-31   
ref|WP_020569867.1|  S-adenosyl-L-homocysteine hydrolase                128   4e-31   
ref|WP_021277051.1|  adenosylhomocysteinase                             127   4e-31   
ref|WP_021777722.1|  cytoplasmic protein                                127   5e-31   
ref|WP_043623602.1|  S-adenosyl-L-homocysteine hydrolase                128   5e-31   
ref|WP_028289662.1|  adenosylhomocysteinase                             127   5e-31   
ref|WP_018623436.1|  S-adenosyl-L-homocysteine hydrolase                128   5e-31   
ref|WP_037447629.1|  S-adenosyl-L-homocysteine hydrolase                127   5e-31   
ref|WP_013846693.1|  S-adenosyl-L-homocysteine hydrolase                127   5e-31   
ref|WP_021271961.1|  adenosylhomocysteinase                             127   5e-31   
ref|WP_009033568.1|  S-adenosyl-L-homocysteine hydrolase                127   6e-31   
gb|EOZ95806.1|  Adenosylhomocysteinase                                  127   6e-31   
ref|WP_007088263.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    127   6e-31   
gb|ESR25508.1|  Adenosylhomocysteinase                                  127   6e-31   
ref|WP_029416908.1|  S-adenosyl-L-homocysteine hydrolase                127   6e-31   
ref|WP_040485396.1|  S-adenosyl-L-homocysteine hydrolase                127   6e-31   
ref|WP_044229607.1|  adenosylhomocysteinase                             127   6e-31   
ref|WP_029008569.1|  adenosylhomocysteinase                             127   6e-31   
ref|WP_041905710.1|  adenosylhomocysteinase                             121   6e-31   
ref|WP_044211631.1|  adenosylhomocysteinase                             127   6e-31   
ref|WP_042083461.1|  adenosylhomocysteinase                             127   7e-31   
ref|WP_027006534.1|  hypothetical protein                               127   7e-31   
ref|WP_006831854.1|  S-adenosyl-L-homocysteine hydrolase                127   7e-31   
ref|WP_035725859.1|  hypothetical protein                               120   8e-31   
ref|WP_037400614.1|  hypothetical protein                               120   8e-31   
ref|WP_029012526.1|  adenosylhomocysteinase                             127   8e-31   
ref|WP_043959717.1|  S-adenosyl-L-homocysteine hydrolase                127   8e-31   
ref|WP_017509613.1|  S-adenosyl-L-homocysteine hydrolase                127   8e-31   
ref|WP_014076680.1|  S-adenosyl-L-homocysteine hydrolase                127   8e-31   
ref|WP_002684089.1|  S-adenosyl-L-homocysteine hydrolase                127   8e-31   
ref|WP_025609025.1|  adenosylhomocysteinase                             127   8e-31   
ref|WP_013992718.1|  S-adenosyl-L-homocysteine hydrolase                127   8e-31   
ref|WP_028488271.1|  S-adenosyl-L-homocysteine hydrolase                127   9e-31   
ref|WP_028880176.1|  S-adenosyl-L-homocysteine hydrolase                127   9e-31   
gb|AAX40985.1|  S-adenosyl-L-homocysteine hydrolase                     126   9e-31   
ref|WP_035634402.1|  adenosylhomocysteinase                             127   9e-31   
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013             127   1e-30   
ref|WP_014198090.1|  S-adenosyl-L-homocysteine hydrolase                127   1e-30   
ref|WP_040133848.1|  adenosylhomocysteinase                             127   1e-30   
ref|WP_029133360.1|  S-adenosyl-L-homocysteine hydrolase                127   1e-30   
emb|CEG61910.1|  Adenosylhomocysteinase                                 127   1e-30   
ref|WP_008518824.1|  S-adenosyl-L-homocysteine hydrolase                127   1e-30   
ref|WP_035678075.1|  adenosylhomocysteinase                             127   1e-30   
ref|WP_036944508.1|  hypothetical protein                               127   1e-30   
ref|WP_012789710.1|  S-adenosyl-L-homocysteine hydrolase                127   1e-30   
ref|WP_037332720.1|  S-adenosyl-L-homocysteine hydrolase                127   1e-30   
ref|WP_029207545.1|  adenosylhomocysteinase                             126   1e-30   
ref|WP_043580304.1|  S-adenosyl-L-homocysteine hydrolase                127   1e-30   
ref|WP_022734627.1|  S-adenosyl-L-homocysteine hydrolase                126   1e-30   
ref|WP_040963546.1|  S-adenosyl-L-homocysteine hydrolase                127   1e-30   
ref|WP_029037337.1|  adenosylhomocysteinase                             126   1e-30   
ref|WP_012463008.1|  S-adenosyl-L-homocysteine hydrolase                126   1e-30   
ref|WP_000574234.1|  hypothetical protein                               120   1e-30   
ref|WP_035685897.1|  adenosylhomocysteinase                             126   1e-30   
ref|WP_041516432.1|  adenosylhomocysteinase                             126   1e-30   
ref|WP_039117485.1|  adenosylhomocysteinase                             126   1e-30   
ref|WP_039111837.1|  adenosylhomocysteinase                             126   1e-30   
ref|WP_002088505.1|  S-adenosyl-L-homocysteine hydrolase-like pro...    120   1e-30   
ref|WP_007805093.1|  S-adenosyl-L-homocysteine hydrolase                126   1e-30   
ref|WP_042566226.1|  adenosylhomocysteinase                             126   1e-30   
ref|WP_022829157.1|  S-adenosyl-L-homocysteine hydrolase                126   1e-30   
gb|EMF40486.1|  S-adenosyl-L-homocysteine hydrolase-like protein        120   1e-30   
ref|WP_027079175.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_017970479.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_014373727.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_026983772.1|  adenosylhomocysteinase                             126   2e-30   
ref|WP_024569279.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_029033999.1|  adenosylhomocysteinase                             126   2e-30   
ref|WP_008641860.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    126   2e-30   
ref|WP_029271915.1|  adenosylhomocysteinase                             126   2e-30   
ref|WP_022733905.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_035881275.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_017943331.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_014085452.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_035623705.1|  adenosylhomocysteinase                             126   2e-30   
ref|WP_031394782.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_037530116.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_017971399.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_017969866.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_029640941.1|  adenosylhomocysteinase                             126   2e-30   
ref|WP_031439895.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_010402859.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|XP_005535237.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
gb|EAT09143.1|  S-adenosyl-L-homocysteine hydrolase                     124   2e-30   
gb|EDM44261.1|  S-adenosylhomocysteine hydrolase                        126   2e-30   
emb|CCC95534.1|  hypothetical protein, unlikely                         120   2e-30   
ref|WP_026716775.1|  adenosylhomocysteinase                             126   2e-30   
gb|EEG40706.1|  Adenosylhomocysteinase                                  119   2e-30   
ref|WP_028837649.1|  adenosylhomocysteinase                             125   2e-30   
ref|WP_002659990.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
ref|WP_029704012.1|  adenosylhomocysteinase                             125   2e-30   
ref|WP_014217427.1|  S-adenosyl-L-homocysteine hydrolase                125   2e-30   
ref|WP_039751703.1|  adenosylhomocysteinase                             125   2e-30   
ref|WP_041881374.1|  adenosylhomocysteinase                             125   2e-30   
ref|WP_029564431.1|  adenosylhomocysteinase                             125   2e-30   
ref|WP_017355275.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
emb|CBJ28078.1|  S-Adenosyl homocysteine hydrolase                      126   2e-30   
dbj|GAL66347.1|  adenosylhomocysteinase                                 124   2e-30   
ref|WP_009778569.1|  S-adenosyl-L-homocysteine hydrolase                125   2e-30   
ref|WP_028035955.1|  adenosylhomocysteinase                             125   2e-30   
ref|WP_014952665.1|  S-adenosyl-L-homocysteine hydrolase                125   2e-30   
ref|WP_021476517.1|  S-adenosyl-L-homocysteine hydrolase                125   2e-30   
ref|WP_022683191.1|  S-adenosyl-L-homocysteine hydrolase                125   2e-30   
ref|WP_041432771.1|  S-adenosyl-L-homocysteine hydrolase                126   2e-30   
dbj|GAL84085.1|  S-adenosyl-L-homocysteine hydrolase                    125   2e-30   
ref|WP_018633571.1|  S-adenosyl-L-homocysteine hydrolase                125   2e-30   
ref|WP_008545544.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    125   3e-30   
gb|AAZ98472.1|  S-adenosyl-L-homocysteine hydrolase                     126   3e-30   
ref|WP_036825409.1|  adenosylhomocysteinase                             125   3e-30   
ref|WP_033963836.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
gb|ACE96401.1|  C-x8-C-x5-C-x3-H type Zn-finger                         120   3e-30   
dbj|GAN45334.1|  S-adenosyl-L-homocysteine hydrolase                    125   3e-30   
ref|WP_026998046.1|  adenosylhomocysteinase                             125   3e-30   
ref|WP_034918438.1|  adenosylhomocysteinase                             125   3e-30   
ref|WP_026611089.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
ref|WP_011341670.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
ref|WP_018036870.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    125   3e-30   
ref|WP_026989957.1|  adenosylhomocysteinase                             125   3e-30   
gb|ACE96407.1|  C-x8-C-x5-C-x3-H type Zn-finger                         120   3e-30   
ref|WP_009061313.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
ref|WP_018078465.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
ref|WP_018003160.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
ref|WP_025548907.1|  S-adenosyl-L-homocysteine hydrolase                124   3e-30   
gb|ETZ21451.1|  S-adenosyl-L-homocysteine hydrolase                     125   3e-30   
ref|WP_020214791.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
ref|WP_033070594.1|  adenosylhomocysteinase                             125   3e-30   
ref|WP_043803716.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
ref|WP_026932687.1|  adenosylhomocysteinase                             125   3e-30   
ref|WP_023647917.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
ref|WP_042883859.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
ref|WP_029455964.1|  adenosylhomocysteinase                             125   3e-30   
ref|WP_039721884.1|  adenosylhomocysteinase                             125   3e-30   
ref|WP_011614423.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
ref|WP_019864392.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
ref|WP_022533304.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
ref|WP_026809083.1|  adenosylhomocysteinase                             125   3e-30   
ref|WP_007689212.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    125   3e-30   
ref|WP_018304590.1|  S-adenosyl-L-homocysteine hydrolase                125   3e-30   
ref|WP_026988822.1|  hypothetical protein                               119   4e-30   
ref|WP_012351529.1|  S-adenosyl-L-homocysteine hydrolase                125   4e-30   
ref|WP_018004682.1|  S-adenosyl-L-homocysteine hydrolase                125   4e-30   
ref|WP_011296403.1|  S-adenosyl-L-homocysteine hydrolase                125   4e-30   
ref|WP_028283194.1|  adenosylhomocysteinase                             125   4e-30   
ref|WP_015753611.1|  S-adenosyl-L-homocysteine hydrolase                125   4e-30   
ref|WP_030539572.1|  S-adenosyl-L-homocysteine hydrolase                122   4e-30   
dbj|GAL69592.1|  adenosylhomocysteinase                                 124   4e-30   
ref|WP_007118437.1|  S-adenosyl-L-homocysteine hydrolase                125   4e-30   
ref|WP_029047363.1|  S-adenosyl-L-homocysteine hydrolase                125   4e-30   
ref|WP_018312297.1|  S-adenosyl-L-homocysteine hydrolase                125   4e-30   
ref|WP_010813332.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    125   4e-30   
ref|WP_011584013.1|  S-adenosyl-L-homocysteine hydrolase                125   4e-30   
ref|WP_010568439.1|  S-adenosyl-L-homocysteine hydrolase                125   4e-30   
gb|EDN69065.1|  S-adenosylhomocysteine hydrolase                        125   4e-30   



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/97 (96%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPAHYRY  485



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/97 (96%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+PEQAAYIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSPEQAAYISVPVEGPYKPTHYRY  485



>gb|KJB72025.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=265

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  169  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  228

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  229  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  265



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERGSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGAKLTKLTP+QAAYIS+PVEGPYKPPHYRY
Sbjct  449  SLHLGKLGAKLTKLTPDQAAYISVPVEGPYKPPHYRY  485



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/97 (95%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERGTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKPP YRY
Sbjct  449  ALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPPRYRY  485



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLADGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKGTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPAHYRY  485



>gb|AFV46215.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=302

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  206  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERTSGKYEKKVYVLPKHLDEKVA  265

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +Q+ YISIPVEGPYKPPHYRY
Sbjct  266  ALHLGKLGAKLTKLTKDQSDYISIPVEGPYKPPHYRY  302



>gb|KJB72026.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=345

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  249  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  308

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  309  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  345



>dbj|BAF01736.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=96

 Score =   150 bits (379),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  601  LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaa  422
            LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA 
Sbjct  1    LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVAL  60

Query  421  lhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  61   LHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  96



>dbj|BAA03710.1| cytokinin binding protein CBP57 [Nicotiana sylvestris]
Length=450

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  354  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  413

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  414  ALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  450



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/97 (95%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT EQAAYIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTSEQAAYISVPVEGPYKPAHYRY  485



>gb|KHN44476.1| Adenosylhomocysteinase [Glycine soja]
Length=291

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  195  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGSGKYEKKVYVLPKHLDEKVA  254

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  255  SLHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  291



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  485



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDE V 
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERGSGKYEKKVYVLPKHLDEMVG  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGAKLTKLTP+QAAYIS+PVEGPYKPPHYRY
Sbjct  449  SLHLGKLGAKLTKLTPDQAAYISVPVEGPYKPPHYRY  485



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPPHYRY  485



>emb|CAH69227.1| putative adenosylhomocysteinase [Nicotiana glauca]
Length=264

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  168  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  227

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  228  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  264



>gb|KJB72027.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=423

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  327  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  386

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  387  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  423



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLTP QA YIS+P EGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQAEYISVPTEGPYKPPHYRY  485



>gb|AFK46472.1| unknown [Lotus japonicus]
Length=290

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  194  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGSGKYEKKVYVLPKHLDEKVA  253

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL  +Q+ YISIP+EGPYKP HYRY
Sbjct  254  ALHLGKLGARLTKLRKDQSDYISIPIEGPYKPAHYRY  290



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+P QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSPAQADYISVPVEGPYKPAHYRY  485



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT EQA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTKEQADYISVPVEGPYKPPHYRY  485



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +QA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQADYISVPVEGPYKPPHYRY  485



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +QA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQADYISVPVEGPYKPPHYRY  485



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  383  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  442

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +QA YIS+PV+GPYKPPHYRY
Sbjct  443  ALHLGKLGARLTKLSKDQADYISVPVDGPYKPPHYRY  479



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +QA YIS+PV+GPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVPVDGPYKPPHYRY  485



>gb|KHN12344.1| Adenosylhomocysteinase [Glycine soja]
Length=408

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  312  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  371

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYRY
Sbjct  372  ALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  408



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLSTDQADYISVPIEGPYKPPHYRY  485



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPPHYRY  485



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>gb|KJB72029.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=456

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  360  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  419

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  420  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  456



>dbj|BAH57232.1| AT4G13940 [Arabidopsis thaliana]
Length=291

 Score =   154 bits (389),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  195  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  254

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  255  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  291



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>gb|AAA33855.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=227

 Score =   152 bits (384),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYV PKHLDEKVA
Sbjct  131  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVCPKHLDEKVA  190

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  191  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  227



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKTTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQADYISVPIEGPYKPAHYRY  485



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWTEKSTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGAKLTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLVKLGAKLTKLTKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLG+LGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGQLGAKLTKLTKEQADYISVPVEGPYKPVHYRY  485



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW+EK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWREKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLTP QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTPAQAEYISVPIEGPYKPPHYRY  485



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGA LTKL+PEQAAYI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGAHLTKLSPEQAAYINVPVEGPYKPAHYRY  485



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERETGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQAEYISVPIEGPYKPAHYRY  485



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERKTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLTP QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQAEYISVPVEGPYKPVHYRY  485



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRL NLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLTNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT  QAAYI++PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTSGQAAYINVPVEGPYKPPHYRY  485



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +Q+ YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYISVPIEGPYKPPHYRY  485



>gb|EMT11613.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=292

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  196  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  255

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  256  ALHLGKLGARLTKLTKAQSEYISIPVEGPYKPAAYRY  292



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  485



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  485



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLTP QA YISIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQAEYISIPIEGPYKPAHYRY  485



>gb|ABA93500.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA93501.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG93815.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  354  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  413

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  414  ALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  450



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKY+K+VYVLPKHLDEKVA
Sbjct  371  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYKKEVYVLPKHLDEKVA  430

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ EQA YIS+PVEGPYKPPHYRY
Sbjct  431  ALHLGKLGAKLTKLSKEQADYISVPVEGPYKPPHYRY  467



>ref|XP_005843353.1| S-adenosyl-L-homocysteine hydrolase [Chlorella variabilis]
 gb|EFN51251.1| S-adenosyl-L-homocysteine hydrolase [Chlorella variabilis]
Length=483

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRL+NLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  387  VLAEGRLLNLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVA  446

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGAKLTKLTP+QA YI++P+EGPYKPPHYRY
Sbjct  447  ALHLNKLGAKLTKLTPDQATYINVPIEGPYKPPHYRY  483



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLTP QA YISIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQAEYISIPIEGPYKPAHYRY  485



>ref|NP_001031627.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83346.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=364

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  268  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  327

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  328  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  364



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYR  317
            ALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYR
Sbjct  449  ALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYR  484



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKY+K+VYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYKKEVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ EQA YIS+PVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLSKEQADYISVPVEGPYKPPHYRY  485



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERTTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLSKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE++TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERSTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT  QA YISIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKSQADYISIPIEGPYKPAHYRY  485



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQADYISVPIEGPYKPAHYRY  485



>tpg|DAA38860.1| TPA: hypothetical protein ZEAMMB73_022938 [Zea mays]
Length=270

 Score =   151 bits (381),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQV+AQLELWKEKN+GKYEKKVYVLPKHLDEKV 
Sbjct  174  ILAEGRLMNLGCATGHPSFVMSCSFTNQVLAQLELWKEKNSGKYEKKVYVLPKHLDEKVN  233

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGK GAKLTKLT  QA YI +P+EGPYK  HYRY
Sbjct  234  ALHLGKHGAKLTKLTKSQADYIRVPIEGPYKLAHYRY  270



>ref|NP_001031628.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83347.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=440

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  344  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  403

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  404  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  440



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYISIPIEGPYKPPHYRY  485



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  419  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  478

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  479  ALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  515



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW+EK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWREKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLG+LGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGQLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKY+K+VYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYQKQVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA LTKL+P+QA YI++P+EGPYKPP YRY
Sbjct  449  SLHLGKLGAHLTKLSPDQAEYINVPIEGPYKPPQYRY  485



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPPHYRY  485



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKSQADYISVPVEGPYKPAHYRY  485



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLG+LG KLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGQLGVKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_010466741.1| PREDICTED: adenosylhomocysteinase 2-like isoform X2 [Camelina 
sativa]
Length=291

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  195  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  254

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  255  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  291



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVPIEGPYKPPHYRY  485



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLG+LG KLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGQLGVKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+N+GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERNSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGAKLTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLNKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+  QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKSQADYISVPIEGPYKPAHYRY  485



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT +Q+ YISIP++GPYKPPHYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYISIPIQGPYKPPHYRY  485



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKY+K+VYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTGKYKKEVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+P++GPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPIDGPYKPPHYRY  485



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPLHYRY  485



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLTP QA YI++P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQAEYINVPIEGPYKPAHYRY  485



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>gb|KIZ05177.1| adenosylhomocysteinase [Monoraphidium neglectum]
Length=1031

 Score =   157 bits (397),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604   ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
             +LAEGRL+NLGCATGHPSFVMSCSFTNQVIAQLELW E+N+G+YEKKVYVLPKHLDEKVA
Sbjct  935   VLAEGRLLNLGCATGHPSFVMSCSFTNQVIAQLELWNERNSGRYEKKVYVLPKHLDEKVA  994

Query  424   alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             ALHL KLG KLT+LTP QA YI++PV+GPYKPP YRY
Sbjct  995   ALHLPKLGVKLTRLTPSQATYINVPVDGPYKPPAYRY  1031



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGAKLTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGAKLTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQADYISVPIEGPYKPAHYRY  485



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAHYRY  485



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFHYRY  485



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+L KL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLAKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAHYRY  485



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAHYRY  485



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  392  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  451

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  452  ALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFHYRY  488



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  449  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+++GKYEKKVYVLPKHLDEKVA
Sbjct  388  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERSSGKYEKKVYVLPKHLDEKVA  447

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +QA YIS+PVEGPYKP HYRY
Sbjct  448  ALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAHYRY  484



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  449  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGAKLTKL+ +QAAYI++PVEGPYKP HYRY
Sbjct  449  ALHLPKLGAKLTKLSADQAAYINVPVEGPYKPAHYRY  485



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+  Q+ YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKSQSDYISVPIEGPYKPAHYRY  485



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT EQA YIS+PVEGPYKP  YRY
Sbjct  449  ALHLGKLGAKLTKLTKEQADYISVPVEGPYKPLAYRY  485



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCA GHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCAAGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGA+LTKL+P+QA YI++P+EGPYKP HYRY
Sbjct  449  ALHLPKLGARLTKLSPDQAEYINVPIEGPYKPAHYRY  485



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ EQA YIS+P+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKEQADYISVPIEGPYKPAHYRY  485



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+++GKYEKKVYVLPKHLDEKVA
Sbjct  471  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERSSGKYEKKVYVLPKHLDEKVA  530

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ EQA YIS+ VEGPYKP HYRY
Sbjct  531  ALHLGKLGAKLTKLSKEQADYISVAVEGPYKPAHYRY  567



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHLGKLGA+LTKL+ +Q  Y+SIP+EGPYKPPHYRY
Sbjct  449  LLHLGKLGARLTKLSKDQXDYVSIPIEGPYKPPHYRY  485



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  PLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAHYRY  485



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  349  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  408

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  409  ALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  445



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY  485



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYR  317
            ALHL KLGAKLTKL+ EQA YIS+PVEGPYKP HYR
Sbjct  449  ALHLPKLGAKLTKLSKEQADYISVPVEGPYKPAHYR  484



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMS SFTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSSSFTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLTP QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTPSQADYISVPVEGPYKPAHYRY  485



>ref|XP_002950429.1| hypothetical protein VOLCADRAFT_74602 [Volvox carteri f. nagariensis]
 gb|EFJ48630.1| hypothetical protein VOLCADRAFT_74602 [Volvox carteri f. nagariensis]
Length=483

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRL+NLGCATGHPSFVMSCSFTNQVIAQLELW E+++G+YEKKVYVLPKHLDEKVA
Sbjct  387  ILAEGRLLNLGCATGHPSFVMSCSFTNQVIAQLELWNERSSGRYEKKVYVLPKHLDEKVA  446

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGAKLT+L+PEQA YI++PV+GPYKP HYRY
Sbjct  447  ALHLPKLGAKLTRLSPEQATYINVPVDGPYKPLHYRY  483



>emb|CAB09795.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
Length=467

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  371  VLAQGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  430

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHLGKLGA+L KL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  431  LLHLGKLGARLRKLSKDQSDYVSIPIEGPYKPPHYRY  467



>gb|EMS57067.1| Adenosylhomocysteinase [Triticum urartu]
Length=416

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TGKYEKKVYVLPKHLDEKVA
Sbjct  320  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATGKYEKKVYVLPKHLDEKVA  379

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  380  ALHLGKLGARLTKLTKSQSDYISIPVEGPYKPAAYRY  416



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  492  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  551

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKP HYRY
Sbjct  552  ALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY  588



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  391  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  450

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGAKLTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  451  ALHLNKLGAKLTKLTKDQSDYLSIPVEGPYKPAHYRY  487



>gb|ABR16616.1| unknown [Picea sitchensis]
Length=450

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  354  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  413

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGA+LTKL+P+QA YI++PV+GPYKP HYRY
Sbjct  414  ALHLPKLGARLTKLSPDQAEYINVPVDGPYKPAHYRY  450



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKH DEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHFDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  390  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  449

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  450  ALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  486



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  449  ALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  449  ALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  449  ALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKY K+VYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYGKEVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT EQ+ YISIPVEGPYKPPHYRY
Sbjct  449  ALHLGKLGAKLTKLTKEQSDYISIPVEGPYKPPHYRY  485



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL LWKEK+ GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLGLWKEKSIGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  485



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKV+VLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVHVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPIEGPYKPGHYRY  485



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  449  ALHLGKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY  485



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  411  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  470

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYRY
Sbjct  471  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  507



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWSEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR+
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRH  485



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPIEGPYKPVHYRY  485



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHL+EKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLNEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  449  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +QA YIS+ VEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVAVEGPYKPTHYRY  485



>ref|XP_001693339.1| S-Adenosyl homocysteine hydrolase [Chlamydomonas reinhardtii]
 gb|EDP03365.1| S-Adenosyl homocysteine hydrolase [Chlamydomonas reinhardtii]
Length=483

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRL+NLGCATGHPSFVMSCSFTNQVIAQLELW E++TG+YEKKVYVLPKHLDEKVA
Sbjct  387  VLAEGRLLNLGCATGHPSFVMSCSFTNQVIAQLELWNERSTGRYEKKVYVLPKHLDEKVA  446

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLG KLTKL+ +QAAYI++PV+GPYKP HYRY
Sbjct  447  ALHLPKLGVKLTKLSADQAAYINVPVDGPYKPAHYRY  483



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSF NQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFINQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  449  LLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>gb|EMS57266.1| Adenosylhomocysteinase [Triticum urartu]
Length=752

 Score =   153 bits (387),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 86/97 (89%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TGKYEKKVYVLPKHLDEKVA
Sbjct  656  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATGKYEKKVYVLPKHLDEKVA  715

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT  Q+ YISIPV+GPYKP  YRY
Sbjct  716  ALHLGKLGARLTKLTKAQSEYISIPVDGPYKPAAYRY  752



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK + KYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSSKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLD KVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDGKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  485



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYR  317
            ALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYR
Sbjct  449  ALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYR  484



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +QA YIS+ VEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKDQADYISVAVEGPYKPTHYRY  485



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHL KLGA+LTKL+ +QA+YI++PV GPYKP HYRY
Sbjct  449  LLHLEKLGARLTKLSEDQASYINVPVGGPYKPAHYRY  485



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHL KLGA+LTKL+ +QA+YI++PV GPYKP HYRY
Sbjct  449  LLHLEKLGARLTKLSEDQASYINVPVGGPYKPAHYRY  485



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHL KLGAKLTKLT EQA YIS+P+EGPYKP  YRY
Sbjct  449  ALHLSKLGAKLTKLTKEQADYISVPIEGPYKPAAYRY  485



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAHYRY  485



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAHYRY  485



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAHYRY  485



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHL KLGA+LTKL+ +QA+YI++PV GPYKP HYRY
Sbjct  449  LLHLEKLGARLTKLSDDQASYINVPVGGPYKPAHYRY  485



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  485



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT EQA YIS+PVEGPYKP  YRY
Sbjct  449  ALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAAYRY  485



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKY K+VYVLPKHLDEKVA
Sbjct  451  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYGKEVYVLPKHLDEKVA  510

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +Q+ Y+SIPVEGPYKPPHYRY
Sbjct  511  ALHLGKLGAKLTKLTKDQSDYVSIPVEGPYKPPHYRY  547



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGK GAKLTKLT +QA YI +PVEGPYKP HYRY
Sbjct  449  ALHLGKFGAKLTKLTKDQADYIYVPVEGPYKPAHYRY  485



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ ELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQPELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGR MNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRPMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGR MNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRPMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TGKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  449  ALHLGKLGARLTKLTKSQSDYISIPVEGPYKPAAYRY  485



>gb|ADQ00183.1| S-adenosyl homocysteine hydrolase [Chlamydomonas sp. ICE-L]
Length=487

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRL+NLGCATGHPSFVMSCSFTNQVIAQLELW E++TG+YE KVYVLPKHLDEKVA
Sbjct  391  ILAEGRLLNLGCATGHPSFVMSCSFTNQVIAQLELWNERSTGRYENKVYVLPKHLDEKVA  450

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
             LHL KLG KLTKL+PEQAAYI++P+ GPYKP +YRY
Sbjct  451  TLHLDKLGCKLTKLSPEQAAYINVPIGGPYKPANYRY  487



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +L LGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLRLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>ref|XP_008671500.1| PREDICTED: adenosylhomocysteinase-like [Zea mays]
Length=426

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            ILAEGRLMNLGCATGHPSFVMSCSFTNQV+AQLELWKEKN+GKYEKKVYVLPKHLDEKV 
Sbjct  330  ILAEGRLMNLGCATGHPSFVMSCSFTNQVLAQLELWKEKNSGKYEKKVYVLPKHLDEKVN  389

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGK GAKLTKLT  QA YI +P+EGPYK  HYRY
Sbjct  390  ALHLGKHGAKLTKLTKSQADYIRVPIEGPYKLAHYRY  426



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  449  ALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLM LGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMKLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKY K+VYVLPKHLDEKVA
Sbjct  478  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYGKEVYVLPKHLDEKVA  537

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKLT +Q+ YISIPVEGPYKPPHYRY
Sbjct  538  ALHLGKLGAKLTKLTKDQSDYISIPVEGPYKPPHYRY  574



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA
Sbjct  465  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVA  524

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP  YRY
Sbjct  525  SLHLGKLGARLTKLSKDQADYISVPVEGPYKPAQYRY  561



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_003057172.1| adenosylhomocysteinase [Micromonas pusilla CCMP1545]
 gb|EEH58817.1| adenosylhomocysteinase [Micromonas pusilla CCMP1545]
Length=487

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 91/103 (88%), Gaps = 2/103 (2%)
 Frame = -1

Query  616  DWHHI--LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKH  443
            D H I  LAEGRL+NLGCATGHPSFVMSCSFTNQ IAQLELW E+ TGKYEKKVYVLPKH
Sbjct  385  DGHGIIMLAEGRLLNLGCATGHPSFVMSCSFTNQAIAQLELWNERKTGKYEKKVYVLPKH  444

Query  442  LDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            LDEKVAALHL K+G KLTKL+ EQAAYI++PVEGPYKP  YRY
Sbjct  445  LDEKVAALHLEKIGVKLTKLSAEQAAYINVPVEGPYKPAAYRY  487



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPS VMSCSFTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSVVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYRY
Sbjct  449  ALHLGKLGAKLTKLSKDQADYINVPVEGPYKPVHYRY  485



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPK LDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKRLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            ALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  449  ALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSEDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  604  ILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVa  425
            +LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA
Sbjct  389  VLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVA  448

Query  424  alhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  314
            +LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  449  SLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380