BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF044N08

Length=573
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006356754.1|  PREDICTED: nitrate transporter 1.4-like            129   1e-31   Solanum tuberosum [potatoes]
ref|XP_006347704.1|  PREDICTED: nitrate transporter 1.4-like            129   3e-31   Solanum tuberosum [potatoes]
ref|XP_009608738.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    128   3e-31   Nicotiana tomentosiformis
ref|XP_009608737.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    128   5e-31   Nicotiana tomentosiformis
ref|XP_009781779.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       125   3e-30   Nicotiana sylvestris
emb|CDP10398.1|  unnamed protein product                                124   1e-29   Coffea canephora [robusta coffee]
ref|XP_009778211.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       123   3e-29   Nicotiana sylvestris
ref|XP_002524480.1|  oligopeptide transporter, putative                 122   4e-29   Ricinus communis
gb|KJB64772.1|  hypothetical protein B456_010G064200                    121   8e-29   Gossypium raimondii
gb|KJB64773.1|  hypothetical protein B456_010G064200                    121   8e-29   Gossypium raimondii
ref|XP_011093557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       122   9e-29   Sesamum indicum [beniseed]
gb|KJB64774.1|  hypothetical protein B456_010G064200                    121   1e-28   Gossypium raimondii
ref|XP_009591624.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    121   2e-28   Nicotiana tomentosiformis
ref|XP_009591623.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    121   2e-28   Nicotiana tomentosiformis
gb|KJB64775.1|  hypothetical protein B456_010G064200                    121   2e-28   Gossypium raimondii
ref|XP_004230062.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       120   3e-28   Solanum lycopersicum
ref|XP_010533169.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            119   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_007013426.1|  Major facilitator superfamily protein isoform 2    118   2e-27   
ref|XP_007013425.1|  Major facilitator superfamily protein isoform 1    118   2e-27   
ref|XP_010541927.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            118   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_006475799.1|  PREDICTED: nitrate transporter 1.4-like isof...    116   6e-27   Citrus sinensis [apfelsine]
ref|XP_006450986.1|  hypothetical protein CICLE_v10007850mg             117   6e-27   Citrus clementina [clementine]
ref|XP_006475796.1|  PREDICTED: nitrate transporter 1.4-like isof...    116   7e-27   Citrus sinensis [apfelsine]
ref|XP_006475798.1|  PREDICTED: nitrate transporter 1.4-like isof...    116   8e-27   Citrus sinensis [apfelsine]
gb|KJB07736.1|  hypothetical protein B456_001G041900                    116   1e-26   Gossypium raimondii
ref|XP_008457678.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            114   6e-26   Cucumis melo [Oriental melon]
ref|XP_010656420.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    113   1e-25   Vitis vinifera
ref|XP_002281975.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    113   1e-25   Vitis vinifera
gb|KGN60671.1|  hypothetical protein Csa_2G006170                       113   1e-25   
gb|AFR11354.1|  nitrate transporter                                     113   1e-25   Cucumis sativus [cucumbers]
ref|XP_004139418.1|  PREDICTED: nitrate transporter 1.4-like            113   2e-25   
ref|XP_004159415.1|  PREDICTED: nitrate transporter 1.4-like            113   2e-25   
ref|XP_004243154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       112   2e-25   
emb|CAD33927.1|  nitrate transporter                                    106   1e-24   Cicer arietinum [garbanzo]
emb|CDY30787.1|  BnaC07g16870D                                          108   5e-24   Brassica napus [oilseed rape]
emb|CDX71495.1|  BnaC04g17300D                                          108   1e-23   
ref|XP_009103552.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            107   1e-23   Brassica rapa
gb|KDP32393.1|  hypothetical protein JCGZ_13318                         107   1e-23   Jatropha curcas
ref|XP_010049998.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    107   1e-23   Eucalyptus grandis [rose gum]
emb|CDY45207.1|  BnaA07g12830D                                          107   1e-23   Brassica napus [oilseed rape]
ref|XP_010688014.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            107   2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010050000.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    105   5e-23   Eucalyptus grandis [rose gum]
ref|XP_004508509.1|  PREDICTED: nitrate transporter 1.4-like            106   5e-23   Cicer arietinum [garbanzo]
gb|KFK32490.1|  hypothetical protein AALP_AA6G249500                    105   6e-23   Arabis alpina [alpine rockcress]
gb|AAB95302.1|  putative nitrate transporter                            105   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010093242.1|  Nitrate transporter 1.4                            105   1e-22   
ref|XP_002880817.1|  nitrate transporter                                105   1e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_007154995.1|  hypothetical protein PHAVU_003G164000g             104   2e-22   Phaseolus vulgaris [French bean]
ref|NP_850084.1|  nitrate transporter 1.4                               103   3e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20651.1|  putative nitrate transporter                            103   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293915.1|  hypothetical protein CARUB_v10022906mg             103   3e-22   
ref|XP_010510873.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    103   3e-22   Camelina sativa [gold-of-pleasure]
gb|KHN34550.1|  Nitrate transporter 1.4                                 100   4e-22   Glycine soja [wild soybean]
ref|XP_010417814.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       102   8e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006408723.1|  hypothetical protein EUTSA_v10001943mg             102   1e-21   
ref|XP_010049997.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       102   1e-21   Eucalyptus grandis [rose gum]
gb|KCW82843.1|  hypothetical protein EUGRSUZ_C04214                     102   1e-21   Eucalyptus grandis [rose gum]
ref|XP_010473052.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       102   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006408724.1|  hypothetical protein EUTSA_v10001943mg             102   2e-21   Eutrema salsugineum [saltwater cress]
gb|EYU29790.1|  hypothetical protein MIMGU_mgv1a003653mg                100   3e-21   Erythranthe guttata [common monkey flower]
gb|KHN15097.1|  Nitrate transporter 1.4                                 100   3e-21   Glycine soja [wild soybean]
ref|XP_010510874.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    100   4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_011458172.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            100   4e-21   Fragaria vesca subsp. vesca
ref|XP_006837800.1|  hypothetical protein AMTR_s00104p00113760          100   5e-21   
ref|XP_006600752.1|  PREDICTED: nitrate transporter 1.4-like          99.4    1e-20   Glycine max [soybeans]
ref|XP_008444009.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     99.4    1e-20   Cucumis melo [Oriental melon]
ref|XP_003609313.1|  Nitrate transporter                              99.0    2e-20   Medicago truncatula
gb|AGA60121.1|  nitrate transporter NRT1.4B                           98.6    2e-20   Cucumis sativus [cucumbers]
ref|XP_004150978.1|  PREDICTED: nitrate transporter 1.4-like          98.2    3e-20   
ref|XP_010254380.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...  98.2    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010254379.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...  98.2    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_006450457.1|  hypothetical protein CICLE_v10008198mg           95.1    2e-19   
ref|XP_006483349.1|  PREDICTED: nitrate transporter 1.4-like isof...  95.5    2e-19   Citrus sinensis [apfelsine]
gb|KDO61703.1|  hypothetical protein CISIN_1g008020mg                 95.1    3e-19   Citrus sinensis [apfelsine]
ref|XP_006483348.1|  PREDICTED: nitrate transporter 1.4-like isof...  95.1    3e-19   Citrus sinensis [apfelsine]
emb|CCN27382.1|  low affinity nitrate transporter                     88.6    1e-18   Triticum aestivum [Canadian hard winter wheat]
gb|KHN47160.1|  Nitrate transporter 1.4                               93.6    1e-18   Glycine soja [wild soybean]
ref|XP_008792048.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  93.2    2e-18   Phoenix dactylifera
ref|XP_008792049.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  93.2    2e-18   
ref|XP_007204809.1|  hypothetical protein PRUPE_ppa021603mg           92.0    5e-18   
ref|XP_007011887.1|  Major facilitator superfamily protein isoform 2  91.7    6e-18   
ref|XP_007011886.1|  Major facilitator superfamily protein, putat...  91.3    9e-18   
ref|XP_008337300.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     90.9    1e-17   
ref|XP_008352261.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     90.9    1e-17   
ref|XP_004968920.1|  PREDICTED: nitrate transporter 1.4-like isof...  90.5    2e-17   Setaria italica
gb|EMT23542.1|  Nitrate/chlorate transporter                          89.0    5e-17   
ref|XP_008784904.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     88.2    9e-17   Phoenix dactylifera
gb|KHG05036.1|  Nitrate transporter 1.4 -like protein                 87.4    1e-16   Gossypium arboreum [tree cotton]
ref|XP_009368838.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     87.4    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_003566777.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.2          86.7    3e-16   Brachypodium distachyon [annual false brome]
ref|XP_010914872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     86.3    4e-16   Elaeis guineensis
ref|XP_010925226.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     85.1    9e-16   
dbj|BAJ90833.1|  predicted protein                                    85.1    9e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS53820.1|  Nitrate transporter 1.4                               85.1    9e-16   Triticum urartu
ref|XP_008675518.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     85.1    1e-15   Zea mays [maize]
ref|XP_009397479.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     84.7    1e-15   
gb|EPS59108.1|  hypothetical protein M569_15702                       84.3    1e-15   Genlisea aurea
gb|KJB82816.1|  hypothetical protein B456_013G215400                  84.0    3e-15   Gossypium raimondii
ref|XP_009407665.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     82.8    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010676154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     80.5    4e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW80908.1|  hypothetical protein ZEAMMB73_061861                  79.7    6e-14   
ref|NP_001169613.1|  uncharacterized protein LOC100383494             79.7    6e-14   Zea mays [maize]
ref|XP_009388204.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     79.7    8e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006645998.1|  PREDICTED: nitrate transporter 1.4-like          78.6    2e-13   
dbj|BAD87491.1|  putative dicarboxylate transporter                   77.4    4e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010093702.1|  Nitrate transporter 1.1                          74.3    5e-13   
ref|XP_010670640.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  76.6    7e-13   
ref|XP_010670639.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  76.6    7e-13   
gb|EAY74514.1|  hypothetical protein OsI_02405                        76.3    1e-12   Oryza sativa Indica Group [Indian rice]
gb|EAZ12317.1|  hypothetical protein OsJ_02208                        75.9    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043326.1|  Os01g0556700                                     75.9    1e-12   
ref|XP_003538742.1|  PREDICTED: nitrate transporter 1.1               75.9    1e-12   Glycine max [soybeans]
ref|XP_011033951.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     75.5    1e-12   Populus euphratica
ref|XP_011033950.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     75.5    2e-12   Populus euphratica
ref|XP_009407160.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     74.7    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007157339.1|  hypothetical protein PHAVU_002G061900g           74.7    4e-12   Phaseolus vulgaris [French bean]
ref|XP_002303512.2|  nitrate transporter family protein               74.3    4e-12   Populus trichocarpa [western balsam poplar]
gb|KHN34951.1|  Nitrate transporter 1.1                               73.9    5e-12   Glycine soja [wild soybean]
ref|XP_008794846.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     73.9    6e-12   Phoenix dactylifera
gb|KHN42706.1|  Nitrate transporter 1.1                               73.6    7e-12   Glycine soja [wild soybean]
ref|XP_003517427.1|  PREDICTED: nitrate transporter 1.1-like          73.6    7e-12   Glycine max [soybeans]
ref|XP_004972811.1|  PREDICTED: nitrate transporter 1.1-like isof...  73.6    8e-12   Setaria italica
ref|XP_004972812.1|  PREDICTED: nitrate transporter 1.1-like isof...  73.6    8e-12   
ref|XP_002282012.3|  PREDICTED: protein NRT1/ PTR FAMILY 6.2          73.2    9e-12   
emb|CBI28188.3|  unnamed protein product                              73.2    9e-12   Vitis vinifera
ref|XP_009403461.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     72.8    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007013427.1|  Major facilitator superfamily protein, putative  72.8    1e-11   
ref|XP_004511669.1|  PREDICTED: nitrate transporter 1.1-like isof...  72.4    2e-11   
emb|CAD32549.1|  dicarboxylate transporter                            72.0    2e-11   Alnus glutinosa
ref|XP_003611284.1|  Nitrate transporter                              72.0    3e-11   Medicago truncatula
ref|XP_002972328.1|  hypothetical protein SELMODRAFT_97590            71.6    3e-11   
gb|EMT14752.1|  Peptide transporter PTR2                              71.6    3e-11   
ref|XP_010264234.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     71.6    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_002443879.1|  hypothetical protein SORBIDRAFT_07g003690        71.2    4e-11   Sorghum bicolor [broomcorn]
ref|XP_009411045.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     71.2    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002972498.1|  hypothetical protein SELMODRAFT_97655            71.2    5e-11   
ref|XP_002984329.1|  hypothetical protein SELMODRAFT_119835           70.9    5e-11   
ref|XP_002459192.1|  hypothetical protein SORBIDRAFT_02g000260        70.9    6e-11   
ref|XP_004490642.1|  PREDICTED: peptide transporter PTR1-like         70.5    7e-11   Cicer arietinum [garbanzo]
dbj|BAC99394.1|  putative nitrate transporter                         70.9    7e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003611286.1|  Nitrate transporter                              70.5    7e-11   Medicago truncatula
ref|XP_007155636.1|  hypothetical protein PHAVU_003G218500g           70.1    7e-11   Phaseolus vulgaris [French bean]
ref|NP_001145735.1|  uncharacterized protein LOC100279242             70.5    8e-11   Zea mays [maize]
ref|XP_007155635.1|  hypothetical protein PHAVU_003G218500g           70.5    8e-11   Phaseolus vulgaris [French bean]
gb|AFW57313.1|  hypothetical protein ZEAMMB73_359381                  70.5    9e-11   
ref|XP_008808741.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     70.1    1e-10   Phoenix dactylifera
dbj|BAJ86984.1|  predicted protein                                    70.1    1e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002443661.1|  hypothetical protein SORBIDRAFT_08g023060        69.7    1e-10   
ref|XP_011093558.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     69.7    1e-10   Sesamum indicum [beniseed]
ref|XP_003549905.1|  PREDICTED: nitrate transporter 1.1-like          69.7    1e-10   Glycine max [soybeans]
dbj|BAK08097.1|  predicted protein                                    69.7    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91141.1|  predicted protein                                    69.7    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94405.1|  predicted protein                                    69.7    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96711.1|  predicted protein                                    69.7    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002992556.1|  hypothetical protein SELMODRAFT_135528           69.3    2e-10   
ref|XP_010228489.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1          69.3    2e-10   
dbj|BAK03852.1|  predicted protein                                    69.3    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008437115.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  69.3    2e-10   Cucumis melo [Oriental melon]
ref|XP_008448872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     69.3    2e-10   Cucumis melo [Oriental melon]
ref|NP_001275529.1|  nitrate transporter 1.1-like                     69.3    2e-10   Cucumis sativus [cucumbers]
gb|KHG27943.1|  Uncharacterized protein F383_15837                    69.3    2e-10   Gossypium arboreum [tree cotton]
ref|XP_003573480.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     69.3    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_004972110.1|  PREDICTED: peptide transporter PTR1-like         68.9    2e-10   Setaria italica
ref|XP_004147617.1|  PREDICTED: nitrate transporter 1.1-like          68.9    3e-10   Cucumis sativus [cucumbers]
dbj|BAG91755.1|  unnamed protein product                              68.6    3e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CCN27389.1|  low affinity nitrate transporter                     65.1    3e-10   Triticum aestivum [Canadian hard winter wheat]
gb|ACR34962.1|  unknown                                               68.6    3e-10   Zea mays [maize]
gb|AAL16907.1|AF420016_1  putative low-affinity nitrate transporter   64.7    3e-10   Narcissus pseudonarcissus
ref|XP_010941437.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     68.6    3e-10   Elaeis guineensis
ref|NP_001061020.1|  Os08g0155400                                     68.2    4e-10   
ref|XP_006643742.1|  PREDICTED: peptide transporter PTR1-like         68.2    4e-10   
emb|CCN27378.1|  low affinity nitrate transporter                     65.1    4e-10   Triticum aestivum [Canadian hard winter wheat]
gb|ACF22756.1|  nitrate transporter                                   68.2    5e-10   Brachypodium distachyon [annual false brome]
ref|XP_010906610.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...  68.2    5e-10   
ref|XP_011081220.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     68.2    5e-10   Sesamum indicum [beniseed]
ref|XP_010906609.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...  67.8    5e-10   Elaeis guineensis
emb|CDM81075.1|  unnamed protein product                              67.8    6e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004149470.1|  PREDICTED: peptide transporter PTR2-like         67.8    6e-10   Cucumis sativus [cucumbers]
gb|EAZ16929.1|  hypothetical protein OsJ_32411                        67.8    7e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010533775.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     67.8    7e-10   Tarenaya hassleriana [spider flower]
gb|ABB47972.1|  Nitrate/chlorate transporter, putative, expressed     67.4    8e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAK15441.1|AC037426_3  putative nitrate transporter                67.4    8e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010053448.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3          67.4    9e-10   Eucalyptus grandis [rose gum]
gb|EAY88182.1|  hypothetical protein OsI_09629                        67.4    9e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_004968169.1|  PREDICTED: peptide transporter PTR1-like iso...  67.0    9e-10   
dbj|BAJ91595.1|  predicted protein                                    66.6    1e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN09796.1|  Nitrate transporter 1.1                               67.0    1e-09   Glycine soja [wild soybean]
gb|ABF93501.1|  Nitrate/chlorate transporter, putative, expressed     67.0    1e-09   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ91042.1|  predicted protein                                    66.2    1e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC67416.1|  hypothetical protein OsI_34598                        66.6    1e-09   Oryza sativa Indica Group [Indian rice]
gb|EYU41851.1|  hypothetical protein MIMGU_mgv1a020985mg              66.6    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_009613364.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     66.6    2e-09   Nicotiana tomentosiformis
ref|NP_001065341.2|  Os10g0554200                                     66.2    2e-09   
ref|XP_003562233.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.3          66.6    2e-09   
gb|AAC32034.1|  peptide transporter                                   66.6    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ95903.1|  predicted protein                                    66.6    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002970258.1|  hypothetical protein SELMODRAFT_231570           66.2    2e-09   Selaginella moellendorffii
ref|XP_002978416.1|  hypothetical protein SELMODRAFT_418286           66.2    2e-09   
gb|EMT10378.1|  Nitrate/chlorate transporter                          66.2    2e-09   
ref|XP_009611019.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     66.2    2e-09   Nicotiana tomentosiformis
dbj|BAJ90348.1|  predicted protein                                    66.2    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008466783.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...  66.2    2e-09   Cucumis melo [Oriental melon]
ref|XP_008367055.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     63.2    2e-09   
emb|CCN27377.1|  low affinity nitrate transporter                     63.2    2e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008466778.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...  66.2    2e-09   Cucumis melo [Oriental melon]
gb|EMT28633.1|  Peptide transporter PTR5                              65.9    2e-09   
ref|XP_010937011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     66.2    2e-09   Elaeis guineensis
gb|AAA80582.1|  RCH2 protein                                          65.9    2e-09   Brassica napus [oilseed rape]
ref|XP_004963332.1|  PREDICTED: probable peptide/nitrate transpor...  65.9    2e-09   Setaria italica
ref|XP_011028221.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...  65.9    2e-09   Populus euphratica
gb|AEA35415.1|  nitrate transporter                                   65.9    2e-09   Brassica rapa subsp. chinensis [bok-choy]
emb|CAC07206.1|  nitrate transporter                                  65.9    2e-09   Brassica napus [oilseed rape]
gb|EMS66817.1|  Peptide transporter PTR5                              65.9    2e-09   Triticum urartu
emb|CDY26539.1|  BnaA09g47380D                                        65.9    2e-09   Brassica napus [oilseed rape]
ref|XP_011028220.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like...  65.9    2e-09   Populus euphratica
ref|XP_009118113.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     65.9    2e-09   Brassica rapa
ref|XP_006440345.1|  hypothetical protein CICLE_v10019412mg           65.5    3e-09   
emb|CDY15967.1|  BnaC08g41560D                                        65.9    3e-09   Brassica napus [oilseed rape]
gb|KFK43476.1|  hypothetical protein AALP_AA1G129900                  65.9    3e-09   Arabis alpina [alpine rockcress]
ref|XP_003575234.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4          65.9    3e-09   Brachypodium distachyon [annual false brome]
ref|XP_010476167.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     65.5    3e-09   Camelina sativa [gold-of-pleasure]
gb|KDO61483.1|  hypothetical protein CISIN_1g007736mg                 65.5    3e-09   Citrus sinensis [apfelsine]
gb|EMS68423.1|  Peptide transporter PTR2                              65.5    3e-09   Triticum urartu
ref|XP_006440344.1|  hypothetical protein CICLE_v10019412mg           65.5    3e-09   Citrus clementina [clementine]
ref|XP_006477230.1|  PREDICTED: nitrate transporter 1.1-like          65.5    3e-09   Citrus sinensis [apfelsine]
ref|XP_010324989.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  65.5    3e-09   
ref|XP_003561175.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    65.5    4e-09   Brachypodium distachyon [annual false brome]
gb|KDP24486.1|  hypothetical protein JCGZ_25050                       65.5    4e-09   Jatropha curcas
ref|XP_004245323.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  65.5    4e-09   Solanum lycopersicum
ref|XP_002447891.1|  hypothetical protein SORBIDRAFT_06g017470        65.5    4e-09   Sorghum bicolor [broomcorn]
ref|XP_010933692.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     65.5    4e-09   Elaeis guineensis
ref|XP_009801608.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     65.5    4e-09   Nicotiana sylvestris
emb|CDP09929.1|  unnamed protein product                              65.5    4e-09   Coffea canephora [robusta coffee]
dbj|BAJ95092.1|  predicted protein                                    65.1    4e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010458634.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3          65.1    4e-09   Camelina sativa [gold-of-pleasure]
dbj|BAJ97468.1|  predicted protein                                    65.1    4e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97409.1|  predicted protein                                    65.1    4e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ02298.1|  hypothetical protein OsI_24399                        65.1    4e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_010493752.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     65.1    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_008796822.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     65.1    4e-09   Phoenix dactylifera
emb|CAC00544.1|  putative low-affinity nitrate transporter            65.1    5e-09   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_004516839.1|  PREDICTED: nitrate transporter 1.1-like          65.1    5e-09   Cicer arietinum [garbanzo]
ref|NP_001041994.1|  Os01g0142800                                     65.1    5e-09   
dbj|BAG91734.1|  unnamed protein product                              65.1    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004245746.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     65.1    5e-09   Solanum lycopersicum
gb|ACN26865.1|  unknown                                               65.1    5e-09   Zea mays [maize]
ref|XP_009589428.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like     65.1    5e-09   Nicotiana tomentosiformis
ref|XP_011463731.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3 isof...  64.7    5e-09   Fragaria vesca subsp. vesca
ref|XP_009374278.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     64.7    5e-09   Pyrus x bretschneideri [bai li]
ref|NP_001131161.1|  uncharacterized protein LOC100192469             64.7    5e-09   Zea mays [maize]
ref|XP_003568460.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     64.7    5e-09   Brachypodium distachyon [annual false brome]
ref|XP_006358355.1|  PREDICTED: nitrate transporter 1.1-like          64.7    6e-09   Solanum tuberosum [potatoes]
ref|XP_009779307.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like     64.7    6e-09   Nicotiana sylvestris
ref|XP_003574312.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     64.7    6e-09   Brachypodium distachyon [annual false brome]
gb|AAM47310.1|AF377946_12  putative peptide transporter protein       64.3    6e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004298652.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3 isof...  64.7    6e-09   Fragaria vesca subsp. vesca
ref|XP_009785350.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like     64.7    6e-09   Nicotiana sylvestris
dbj|BAJ98569.1|  predicted protein                                    64.7    6e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP25643.1|  hypothetical protein JCGZ_20799                       64.7    7e-09   Jatropha curcas
ref|XP_010680056.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     64.7    7e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004983703.1|  PREDICTED: nitrate transporter 1.1-like          64.3    7e-09   Setaria italica
ref|XP_010033028.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     64.3    8e-09   
ref|XP_006658184.1|  PREDICTED: peptide transporter PTR5-like         64.3    8e-09   Oryza brachyantha
gb|KJB46719.1|  hypothetical protein B456_008G2375002                 64.3    8e-09   Gossypium raimondii
emb|CAB36812.1|  peptide transporter-like protein                     64.3    9e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001058520.2|  Os06g0705900                                     64.3    9e-09   
ref|XP_010043898.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3          64.3    9e-09   Eucalyptus grandis [rose gum]
ref|XP_009798260.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     64.3    9e-09   Nicotiana sylvestris
gb|KJB20885.1|  hypothetical protein B456_003G170300                  64.3    9e-09   Gossypium raimondii
gb|EAZ02297.1|  hypothetical protein OsI_24398                        63.9    9e-09   Oryza sativa Indica Group [Indian rice]
dbj|BAC42767.1|  putative peptide transporter                         63.9    9e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004244572.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     63.9    9e-09   Solanum lycopersicum
ref|NP_193899.2|  nitrate transporter 1.8                             63.9    9e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EYU35700.1|  hypothetical protein MIMGU_mgv1a0209461mg             62.4    1e-08   Erythranthe guttata [common monkey flower]
gb|KHG24776.1|  Uncharacterized protein F383_04224                    63.9    1e-08   Gossypium arboreum [tree cotton]
ref|XP_008658424.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     63.9    1e-08   Zea mays [maize]
ref|NP_001051098.1|  Os03g0719900                                     63.9    1e-08   
ref|XP_008658431.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     63.9    1e-08   Zea mays [maize]
ref|XP_010923125.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     63.9    1e-08   Elaeis guineensis
ref|XP_008340555.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     62.8    1e-08   
ref|XP_002464068.1|  hypothetical protein SORBIDRAFT_01g011700        63.9    1e-08   
ref|XP_011070105.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     63.9    1e-08   
gb|EEE59822.1|  hypothetical protein OsJ_12376                        63.9    1e-08   
ref|XP_007222294.1|  hypothetical protein PRUPE_ppa003339mg           63.5    1e-08   
ref|XP_004297798.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     63.9    1e-08   
ref|XP_009110669.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3          63.9    1e-08   
ref|XP_006662041.1|  PREDICTED: nitrate transporter 1.1-like          63.9    1e-08   
ref|XP_010519721.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1          63.9    1e-08   
emb|CDY21035.1|  BnaA08g24900D                                        63.9    1e-08   
ref|XP_010907323.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1 isof...  63.9    1e-08   
ref|XP_010676153.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     63.9    1e-08   
emb|CDY31242.1|  BnaC08g15370D                                        63.5    1e-08   
ref|XP_007222295.1|  hypothetical protein PRUPE_ppa003339mg           63.5    1e-08   
ref|XP_002464959.1|  hypothetical protein SORBIDRAFT_01g029470        63.5    1e-08   
ref|XP_006373301.1|  hypothetical protein POPTR_0017s11320g           63.5    1e-08   
gb|EPS69660.1|  hypothetical protein M569_05105                       63.5    1e-08   
tpg|DAA50699.1|  TPA: hypothetical protein ZEAMMB73_457708            63.5    1e-08   
emb|CDP09152.1|  unnamed protein product                              63.5    1e-08   
ref|XP_006659845.1|  PREDICTED: nitrate transporter 1.1-like          63.5    1e-08   
ref|XP_008798043.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     63.5    2e-08   
gb|EMT24437.1|  Peptide transporter PTR1                              63.2    2e-08   
ref|XP_004965186.1|  PREDICTED: probable nitrite transporter At1g...  63.5    2e-08   
ref|XP_010680055.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     63.5    2e-08   
ref|XP_008389126.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     63.5    2e-08   
ref|NP_001130581.1|  uncharacterized protein LOC100191680             63.2    2e-08   
ref|XP_010553465.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     63.2    2e-08   
ref|XP_009606081.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like     63.2    2e-08   
ref|XP_008670500.1|  PREDICTED: uncharacterized protein LOC100191...  63.2    2e-08   
ref|XP_006363053.1|  PREDICTED: peptide transporter PTR1-like         63.2    2e-08   
ref|XP_010449021.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like     63.2    2e-08   
ref|XP_008465942.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like     63.2    2e-08   
gb|EMT27347.1|  Nitrate/chlorate transporter                          63.2    2e-08   
ref|XP_010439444.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like     63.2    2e-08   
ref|NP_174523.2|  nitrate transporter 1.5                             63.2    2e-08   
gb|AAF81343.1|AC007767_23  Contains similarity to a peptide trans...  63.2    2e-08   
ref|XP_004953544.1|  PREDICTED: peptide transporter PTR2-like         63.2    2e-08   
ref|XP_010262762.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     63.2    2e-08   
ref|XP_002521890.1|  peptide transporter, putative                    63.2    2e-08   
ref|XP_010554363.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...  63.2    2e-08   
ref|XP_010554364.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...  63.2    2e-08   
ref|XP_009374284.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...  62.8    2e-08   
ref|XP_010258991.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     63.2    2e-08   
emb|CDX82846.1|  BnaC01g12960D                                        60.5    2e-08   
ref|NP_001058672.1|  Os07g0100600                                     62.8    2e-08   
gb|KHG03840.1|  Uncharacterized protein F383_26454                    62.8    2e-08   
ref|XP_009374282.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...  62.8    2e-08   
gb|EYU30228.1|  hypothetical protein MIMGU_mgv1a003438mg              62.8    2e-08   
ref|NP_197465.1|  putative peptide/nitrate transporter                62.8    2e-08   
ref|XP_006357958.1|  PREDICTED: nitrate transporter 1.3-like          62.8    2e-08   
ref|XP_009351619.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     62.8    2e-08   
gb|ABR32183.1|  peptide transporter                                   62.8    2e-08   
ref|XP_006413747.1|  hypothetical protein EUTSA_v10024762mg           62.8    2e-08   
ref|XP_006355480.1|  PREDICTED: nitrate transporter 1.1-like          62.8    2e-08   
ref|XP_004148494.1|  PREDICTED: nitrate transporter 1.5-like          62.8    2e-08   
ref|XP_006429306.1|  hypothetical protein CICLE_v10011381mg           62.8    2e-08   
ref|XP_008355088.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  62.8    2e-08   
ref|XP_002867832.1|  proton-dependent oligopeptide transport fami...  62.8    3e-08   
ref|XP_008775060.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     62.8    3e-08   
emb|CDY17446.1|  BnaC09g20910D                                        62.8    3e-08   
gb|EMT09323.1|  Nitrate/chlorate transporter                          62.8    3e-08   
gb|EEC75965.1|  hypothetical protein OsI_13072                        62.8    3e-08   
gb|AAT85061.1|  nitrate transporter, putative                         62.8    3e-08   
ref|XP_002441094.1|  hypothetical protein SORBIDRAFT_09g020300        62.8    3e-08   
ref|XP_009114212.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3          62.8    3e-08   
ref|XP_008355414.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     62.8    3e-08   
ref|XP_009114885.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like     62.8    3e-08   
ref|XP_009382412.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     62.4    3e-08   
ref|XP_010434145.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2 isof...  62.4    3e-08   
ref|XP_006417264.1|  hypothetical protein EUTSA_v10007157mg           62.4    3e-08   
ref|XP_011013862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like    62.4    3e-08   
ref|XP_006848110.1|  hypothetical protein AMTR_s00029p00215100        62.4    3e-08   
ref|XP_002529778.1|  oligopeptide transporter, putative               62.4    3e-08   
ref|XP_006283396.1|  hypothetical protein CARUB_v10004438mg           62.4    3e-08   
ref|XP_006656463.1|  PREDICTED: peptide transporter PTR2-like         62.4    3e-08   
ref|XP_011070505.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     62.4    3e-08   
pdb|4OH3|A  Chain A, Crystal Structure Of A Nitrate Transporter       62.4    3e-08   
ref|NP_563899.1|  nitrate transporter 1.1                             62.4    3e-08   
ref|XP_002452347.1|  hypothetical protein SORBIDRAFT_04g024090        62.4    3e-08   
ref|XP_002889915.1|  NRT1.1                                           62.4    3e-08   
ref|XP_006286439.1|  hypothetical protein CARUB_v10003886mg           62.4    3e-08   
gb|ACU17848.1|  unknown                                               60.8    3e-08   
ref|XP_002986344.1|  hypothetical protein SELMODRAFT_425373           62.4    3e-08   
ref|XP_009382411.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     62.4    3e-08   
ref|XP_008466771.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  62.4    3e-08   
ref|XP_008669378.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  62.4    4e-08   
gb|EMT02211.1|  Peptide transporter PTR1                              62.4    4e-08   
gb|AFK33709.1|  unknown                                               62.0    4e-08   
gb|EYU26644.1|  hypothetical protein MIMGU_mgv1a003683mg              62.4    4e-08   
ref|XP_006361731.1|  PREDICTED: nitrate transporter 1.4-like          62.4    4e-08   
ref|XP_010907324.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1 isof...  62.0    4e-08   
ref|XP_002979108.1|  hypothetical protein SELMODRAFT_444106           62.4    4e-08   
dbj|BAK05363.1|  predicted protein                                    62.4    4e-08   
ref|XP_009624729.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     62.4    4e-08   
ref|XP_004491123.1|  PREDICTED: nitrate transporter 1.3-like          62.4    4e-08   
ref|XP_010919516.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...  62.4    4e-08   
ref|XP_006848107.1|  hypothetical protein AMTR_s00029p00214340        62.0    4e-08   
ref|XP_002893724.1|  proton-dependent oligopeptide transport fami...  62.0    4e-08   
ref|XP_010104684.1|  Peptide transporter                              62.0    4e-08   
ref|XP_010939960.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     62.0    4e-08   
ref|XP_006650508.1|  PREDICTED: peptide transporter PTR2-like         62.0    4e-08   
ref|XP_004243520.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4          62.0    4e-08   
ref|XP_002972518.1|  hypothetical protein SELMODRAFT_97812            62.0    4e-08   
ref|XP_006385620.1|  proton-dependent oligopeptide transport fami...  62.0    5e-08   
ref|XP_010493040.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1          62.0    5e-08   
ref|XP_001774033.1|  predicted protein                                62.0    5e-08   
ref|XP_002871897.1|  proton-dependent oligopeptide transport fami...  62.0    5e-08   
ref|XP_008798073.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3          62.0    5e-08   
ref|NP_001173970.1|  Os04g0464400                                     62.0    5e-08   
emb|CDY01274.1|  BnaC05g24580D                                        62.0    5e-08   
ref|XP_006371707.1|  hypothetical protein POPTR_0018s00500g           61.6    5e-08   
emb|CDY03084.1|  BnaC07g21430D                                        61.6    5e-08   
emb|CDX93833.1|  BnaA09g24330D                                        62.0    5e-08   
ref|XP_007032430.1|  Major facilitator superfamily protein            61.6    5e-08   
ref|XP_010420775.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like     61.6    5e-08   
ref|XP_008345515.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     61.6    5e-08   
gb|KJB20886.1|  hypothetical protein B456_003G170400                  61.6    5e-08   
gb|AEX11045.1|  hypothetical protein 0_1143_01                        57.4    6e-08   
ref|XP_009135044.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like     61.6    6e-08   
gb|AFW77995.1|  hypothetical protein ZEAMMB73_297742                  58.9    6e-08   
gb|EAZ38219.1|  hypothetical protein OsJ_22572                        61.6    6e-08   
gb|EAZ02296.1|  hypothetical protein OsI_24397                        61.6    6e-08   
ref|XP_004251535.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4          61.6    6e-08   
ref|NP_001058519.1|  Os06g0705700                                     61.6    6e-08   
ref|XP_011081130.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     61.6    6e-08   
gb|EYU45753.1|  hypothetical protein MIMGU_mgv1a003661mg              61.6    6e-08   
ref|XP_007039561.1|  Nitrate transporter 1.5                          61.6    6e-08   
gb|AEX11041.1|  hypothetical protein 0_1143_01                        57.0    6e-08   
ref|XP_011007525.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like     61.6    6e-08   
ref|XP_002973408.1|  hypothetical protein SELMODRAFT_232069           61.6    6e-08   
emb|CAA54634.1|  oligopeptide transporter 1-1                         61.6    6e-08   
ref|NP_001147810.1|  peptide transporter PTR2                         61.6    6e-08   
ref|XP_002285274.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     61.6    7e-08   
emb|CBI26754.3|  unnamed protein product                              61.2    7e-08   
ref|XP_002976499.1|  hypothetical protein SELMODRAFT_105638           61.6    7e-08   
ref|NP_178313.1|  peptide transporter PTR2                            61.6    7e-08   
ref|XP_002984211.1|  hypothetical protein SELMODRAFT_119838           61.6    7e-08   
ref|XP_002972300.1|  hypothetical protein SELMODRAFT_97069            61.2    7e-08   
ref|XP_002517444.1|  nitrate transporter, putative                    61.6    7e-08   
ref|XP_006352020.1|  PREDICTED: nitrate transporter 1.3-like          61.2    7e-08   
ref|XP_002519847.1|  Peptide transporter, putative                    61.2    7e-08   
ref|XP_003531667.1|  PREDICTED: probable peptide transporter At1g...  61.2    7e-08   
ref|XP_006448045.1|  hypothetical protein CICLE_v10014643mg           61.2    7e-08   
ref|XP_009117889.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     61.2    7e-08   
gb|KDO53228.1|  hypothetical protein CISIN_1g0083672mg                61.2    7e-08   
gb|AEX11044.1|  hypothetical protein 0_1143_01                        57.0    7e-08   
ref|NP_001057335.1|  Os06g0264500                                     61.2    8e-08   
ref|XP_006448044.1|  hypothetical protein CICLE_v10014643mg           61.2    8e-08   
ref|XP_007012104.1|  Major facilitator superfamily protein            61.2    8e-08   
ref|NP_001130360.1|  uncharacterized protein LOC100191455             61.2    8e-08   
emb|CDP09153.1|  unnamed protein product                              61.2    8e-08   
gb|ACG29230.1|  peptide transporter PTR2                              61.2    8e-08   
ref|XP_004983702.1|  PREDICTED: nitrate transporter 1.1-like          61.2    8e-08   
ref|XP_007026785.1|  Peptide transporter 1 isoform 1                  61.2    8e-08   
gb|ACN27476.1|  unknown                                               61.2    8e-08   
ref|XP_006492274.1|  PREDICTED: peptide transporter PTR2-like         61.2    8e-08   
ref|XP_002517463.1|  nitrate transporter, putative                    61.2    8e-08   
gb|KDO53230.1|  hypothetical protein CISIN_1g0083672mg                61.2    8e-08   
ref|XP_002436826.1|  hypothetical protein SORBIDRAFT_10g009530        61.2    8e-08   
ref|NP_001281186.1|  peptide transporter PTR2                         61.2    8e-08   
ref|XP_010326140.1|  PREDICTED: uncharacterized protein LOC101268606  61.6    9e-08   
gb|KJB21046.1|  hypothetical protein B456_003G180200                  61.2    9e-08   
emb|CAN71417.1|  hypothetical protein VITISV_004658                   61.2    9e-08   
gb|EEC73483.1|  hypothetical protein OsI_07814                        61.2    9e-08   
gb|KDP21241.1|  hypothetical protein JCGZ_21712                       61.2    9e-08   
gb|KFK28750.1|  hypothetical protein AALP_AA7G041900                  61.2    9e-08   
ref|XP_009421313.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     61.2    9e-08   
ref|XP_009151431.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3          61.2    9e-08   
ref|XP_006849517.1|  hypothetical protein AMTR_s00024p00147790        61.2    9e-08   
gb|ACJ85754.1|  unknown                                               60.1    9e-08   
ref|XP_002266951.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3          61.2    9e-08   
emb|CDY32284.1|  BnaC05g28620D                                        61.2    9e-08   
ref|XP_002993534.1|  hypothetical protein SELMODRAFT_137176           61.2    9e-08   
ref|XP_004963333.1|  PREDICTED: probable peptide/nitrate transpor...  61.2    9e-08   
emb|CDP05420.1|  unnamed protein product                              61.2    9e-08   
ref|NP_001047240.1|  Os02g0580900                                     61.2    9e-08   
gb|KJB15302.1|  hypothetical protein B456_002G169800                  61.2    9e-08   
ref|XP_008448722.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like     61.2    9e-08   
dbj|BAD31819.1|  putative peptide transport protein                   60.8    9e-08   
ref|XP_009373444.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like     60.8    9e-08   
ref|XP_002300021.1|  hypothetical protein POPTR_0001s34640g           60.8    9e-08   
ref|XP_004150179.1|  PREDICTED: nitrate transporter 1.5-like          60.8    1e-07   
ref|XP_009595682.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like     60.8    1e-07   
gb|EAY94439.1|  hypothetical protein OsI_16210                        60.8    1e-07   
emb|CDY48871.1|  BnaA05g35790D                                        60.8    1e-07   
ref|XP_007207074.1|  hypothetical protein PRUPE_ppa025891mg           60.8    1e-07   
ref|XP_003578426.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9          60.8    1e-07   
ref|XP_006287367.1|  hypothetical protein CARUB_v10000567mg           60.8    1e-07   
gb|AEX11039.1|  hypothetical protein 0_1143_01                        56.6    1e-07   
ref|XP_004982146.1|  PREDICTED: probable peptide/nitrate transpor...  60.8    1e-07   
ref|NP_195738.1|  peptide transporter PTR5                            60.8    1e-07   
gb|AAO64143.1|  putative oligopeptide transporter protein             60.8    1e-07   
dbj|BAF00365.1|  oligopeptide transporter - like protein              60.8    1e-07   
ref|XP_004163981.1|  PREDICTED: nitrate transporter 1.5-like          60.8    1e-07   
gb|KDP38200.1|  hypothetical protein JCGZ_04843                       60.8    1e-07   
ref|XP_010227441.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     60.8    1e-07   
ref|XP_010459209.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    60.8    1e-07   
ref|XP_006395818.1|  hypothetical protein EUTSA_v10003893mg           60.8    1e-07   
ref|XP_008787880.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     60.8    1e-07   
ref|XP_011003660.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...  60.8    1e-07   
ref|XP_008338492.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like     60.8    1e-07   
ref|XP_003530142.1|  PREDICTED: probable peptide transporter At1g...  60.8    1e-07   
ref|XP_008220969.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  60.8    1e-07   
gb|EMT20656.1|  Peptide transporter PTR5                              60.8    1e-07   
gb|KDP46550.1|  hypothetical protein JCGZ_08522                       60.5    1e-07   
ref|XP_002323559.2|  proton-dependent oligopeptide transport fami...  60.8    1e-07   
ref|XP_010423917.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2          60.5    1e-07   
ref|XP_011003661.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...  60.5    1e-07   
emb|CDY59420.1|  BnaA09g56930D                                        60.5    1e-07   
gb|KHN04222.1|  Putative peptide transporter                          60.5    1e-07   
ref|XP_009411557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     60.5    1e-07   
ref|XP_002875108.1|  ATPTR2-B                                         60.5    1e-07   
ref|XP_010452016.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     60.5    1e-07   
ref|XP_002994164.1|  hypothetical protein SELMODRAFT_138285           60.5    1e-07   
gb|AFN53657.1|  putative peptide transporter                          60.5    1e-07   
emb|CDY72659.1|  BnaCnng78690D                                        60.1    1e-07   
emb|CBI16454.3|  unnamed protein product                              60.5    1e-07   
ref|XP_010424976.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     60.5    1e-07   
ref|XP_002972318.1|  hypothetical protein SELMODRAFT_441824           60.5    1e-07   
ref|XP_010937012.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     60.5    1e-07   
gb|KJB25359.1|  hypothetical protein B456_004G187700                  60.5    1e-07   



>ref|XP_006356754.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=580

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFF+SSFLVSV+ K T ++   Q WLAD
Sbjct  465  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFISSFLVSVINKTTKSNATAQGWLAD  524

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  229
            NINYGRLD FYWLLA LGVINF +YL C+ W+KPRK KSA+ MET+ NG G E+KC
Sbjct  525  NINYGRLDFFYWLLAALGVINFAIYLNCATWYKPRKPKSAIPMETLHNGYGAEDKC  580



>ref|XP_006347704.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=575

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 83/116 (72%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  + K  + S+GG DWLAD
Sbjct  461  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLALGFFVSSFLVSIIKKVTGSNGGHDWLAD  519

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            NINYGRLD FY LLA LGVINFV+YL C+ WFKPRK KSA+ MET+ NGN  E+KC
Sbjct  520  NINYGRLDCFYGLLAILGVINFVLYLFCATWFKPRKAKSAINMETINNGNVVEDKC  575



>ref|XP_009608738.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=533

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFF SSFLVS++KKVT  S+GG  WLAD
Sbjct  419  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFFSSFLVSIIKKVTR-SNGGDGWLAD  477

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            NINY RLD FY LLA LGVINF +YLIC+IWFKPRK+KSA++METV NGN  ++KC
Sbjct  478  NINYARLDCFYGLLAILGVINFALYLICAIWFKPRKSKSAIQMETVKNGNAADDKC  533



>ref|XP_009608737.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=578

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFF SSFLVS++KKVT  S+GG  WLAD
Sbjct  464  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFFSSFLVSIIKKVTR-SNGGDGWLAD  522

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            NINY RLD FY LLA LGVINF +YLIC+IWFKPRK+KSA++METV NGN  ++KC
Sbjct  523  NINYARLDCFYGLLAILGVINFALYLICAIWFKPRKSKSAIQMETVKNGNAADDKC  578



>ref|XP_009781779.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=576

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 83/116 (72%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  + K  + S+GG  WLAD
Sbjct  462  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFFSSFLVSIIKKVTGSNGGDGWLAD  520

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            NINY RLD FY LLA LGVINF +YLI +IWFKPRK+KSAV+METV NGN  ++KC
Sbjct  521  NINYARLDCFYGLLAILGVINFALYLIAAIWFKPRKSKSAVQMETVKNGNAADDKC  576



>emb|CDP10398.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 95/116 (82%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFF SS LVS+VK  T  SH G+ WLAD
Sbjct  464  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFFSSMLVSIVKGATR-SHRGEGWLAD  522

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  229
             INYGRLDLFY LLA LGVINFVVY IC++W+KP+K   AVEM  V NG G EEKC
Sbjct  523  KINYGRLDLFYALLAVLGVINFVVYSICAVWYKPKKPNPAVEMGNVANGAGAEEKC  578



>ref|XP_009778211.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=587

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFF+SSFLVSV+KKVT  +   + WLAD
Sbjct  472  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFISSFLVSVIKKVTGGNGTDEGWLAD  531

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            NIN GRLDLFYWLLA LGVINFV+YLIC+ W+KPRK KSA++ME     N  EEKC
Sbjct  532  NINNGRLDLFYWLLAVLGVINFVIYLICATWYKPRKAKSAIQMENPHTKNAAEEKC  587



>ref|XP_002524480.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF37920.1| oligopeptide transporter, putative [Ricinus communis]
Length=581

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 102/118 (86%), Gaps = 3/118 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLV VVK+VT ++ GGQ WLAD
Sbjct  464  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVMVVKRVTGSNGGGQGWLAD  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKN--KSAVEMETVMNGN-GEEKC  229
            NINYGRLD FY LLA LGV+NFVVYLIC++W+KPR +   +A++ME V NG+  EEKC
Sbjct  524  NINYGRLDCFYGLLAVLGVVNFVVYLICALWYKPRNSAKSAALQMENVGNGSLAEEKC  581



>gb|KJB64772.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=446

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 100/118 (85%), Gaps = 3/118 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSS LVSVVK V   S+GGQ WLAD
Sbjct  329  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSLLVSVVKSVMGGSNGGQGWLAD  388

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA-VEMETVMNGN--GEEKC  229
            NIN+GRLD FY LLA LGVINF +Y++ ++WFKPRK+K A ++M+T++NG+   E KC
Sbjct  389  NINHGRLDCFYGLLAVLGVINFALYIVSAVWFKPRKSKPATLQMDTIVNGSSTAENKC  446



>gb|KJB64773.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=517

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 100/118 (85%), Gaps = 3/118 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSS LVSVVK V   S+GGQ WLAD
Sbjct  400  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSLLVSVVKSVMGGSNGGQGWLAD  459

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA-VEMETVMNGN--GEEKC  229
            NIN+GRLD FY LLA LGVINF +Y++ ++WFKPRK+K A ++M+T++NG+   E KC
Sbjct  460  NINHGRLDCFYGLLAVLGVINFALYIVSAVWFKPRKSKPATLQMDTIVNGSSTAENKC  517



>ref|XP_011093557.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Sesamum indicum]
Length=583

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 83/118 (70%), Gaps = 4/118 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  ++S+GGQ WLAD
Sbjct  467  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVSVIKKVTSSNGGQGWLAD  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKP---RKNKSAVEMETVMNGNGEEKC  229
            NINYGRLD FY LLA LG+IN V+YLIC++W+KP    K + A++ME   NG+GEE+C
Sbjct  526  NINYGRLDCFYGLLAVLGIINLVIYLICAVWYKPDQKPKPQPALQMEAKFNGSGEERC  583



>gb|KJB64774.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=541

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 100/118 (85%), Gaps = 3/118 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSS LVSVVK V   S+GGQ WLAD
Sbjct  424  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSLLVSVVKSVMGGSNGGQGWLAD  483

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA-VEMETVMNGN--GEEKC  229
            NIN+GRLD FY LLA LGVINF +Y++ ++WFKPRK+K A ++M+T++NG+   E KC
Sbjct  484  NINHGRLDCFYGLLAVLGVINFALYIVSAVWFKPRKSKPATLQMDTIVNGSSTAENKC  541



>ref|XP_009591624.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=576

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFF+SSFLVSV+KKVT  +   + WLAD
Sbjct  461  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFISSFLVSVIKKVTGGNGTDEGWLAD  520

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            NIN GRLDLFYWLLA LGVIN V+YLIC+ W+KPRK KSA++ME     N  EEKC
Sbjct  521  NINNGRLDLFYWLLAVLGVINIVIYLICATWYKPRKPKSAIQMENPHTKNAAEEKC  576



>ref|XP_009591623.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=583

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFF+SSFLVSV+KKVT  +   + WLAD
Sbjct  468  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFISSFLVSVIKKVTGGNGTDEGWLAD  527

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            NIN GRLDLFYWLLA LGVIN V+YLIC+ W+KPRK KSA++ME     N  EEKC
Sbjct  528  NINNGRLDLFYWLLAVLGVINIVIYLICATWYKPRKPKSAIQMENPHTKNAAEEKC  583



>gb|KJB64775.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=586

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 100/118 (85%), Gaps = 3/118 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSS LVSVVK V   S+GGQ WLAD
Sbjct  469  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSLLVSVVKSVMGGSNGGQGWLAD  528

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA-VEMETVMNGN--GEEKC  229
            NIN+GRLD FY LLA LGVINF +Y++ ++WFKPRK+K A ++M+T++NG+   E KC
Sbjct  529  NINHGRLDCFYGLLAVLGVINFALYIVSAVWFKPRKSKPATLQMDTIVNGSSTAENKC  586



>ref|XP_004230062.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=574

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 82/116 (71%), Gaps = 5/116 (4%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  + K  + S+GG DWLAD
Sbjct  463  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLALGFFVSSFLVSIIKKVTGSNGGHDWLAD  521

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            NINYGRLD FY LLA LGVINFV+Y+IC+ WFKPRK+K    MET+ NGN  E+KC
Sbjct  522  NINYGRLDCFYGLLAILGVINFVLYIICATWFKPRKDK---YMETINNGNVVEDKC  574



>ref|XP_010533169.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVSVVKKVT +S  GQ WLAD
Sbjct  468  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSVVKKVTGSSGNGQGWLAD  527

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
            NIN+GRLD FYWLLA L  IN VVY+IC+ WFKPRK K AVEM +    + EE C
Sbjct  528  NINHGRLDRFYWLLAVLSGINIVVYMICAFWFKPRKGKGAVEMASGKGFSVEENC  582



>ref|XP_007013426.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY31045.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=581

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  + S+ GQ WLAD
Sbjct  467  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVSVVKRLTGSNDGQGWLAD  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  229
            NIN+GRLD FY L+A L +INFVVYL+C+ W KPRK K A++MET++NG + E+KC
Sbjct  526  NINHGRLDCFYGLVAVLDIINFVVYLVCAAWHKPRKPKPALQMETIVNGSSAEDKC  581



>ref|XP_007013425.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31044.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=591

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  + S+ GQ WLAD
Sbjct  477  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVSVVKRLTGSNDGQGWLAD  535

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  229
            NIN+GRLD FY L+A L +INFVVYL+C+ W KPRK K A++MET++NG + E+KC
Sbjct  536  NINHGRLDCFYGLVAVLDIINFVVYLVCAAWHKPRKPKPALQMETIVNGSSAEDKC  591



>ref|XP_010541927.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFFLTQSPK MKTMSTGLFLTTLSLGFFVSSFLVSVVKKVT +S  GQ WLAD
Sbjct  468  FIYTGQLDFFLTQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSVVKKVTGSSGNGQGWLAD  527

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
            NIN+GRLD FYWLLA L  INFVVY++C++WFKPRK K A+EM      + E+ C
Sbjct  528  NINHGRLDCFYWLLAVLSGINFVVYMVCALWFKPRKGKGALEMADGKGFSVEDNC  582



>ref|XP_006475799.1| PREDICTED: nitrate transporter 1.4-like isoform X4 [Citrus sinensis]
 ref|XP_006475800.1| PREDICTED: nitrate transporter 1.4-like isoform X5 [Citrus sinensis]
Length=560

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 80/116 (69%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTM +     T     F  S  +  V K  + S GG  WLAD
Sbjct  446  FIYTGQLDFFITKSPKGMKTM-STGLFLTTLSLGFFVSSFLVAVVKKVTGSKGGGGWLAD  504

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  229
            NIN GRLDLFY LLA L +IN V+YLIC++W+KP+K K+ ++MET + G + EEKC
Sbjct  505  NINRGRLDLFYGLLAILSIINLVIYLICAVWYKPKKPKAGIQMETYVKGSSAEEKC  560



>ref|XP_006450986.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
 gb|ESR64226.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
Length=575

 Score =   117 bits (292),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 63/116 (54%), Positives = 80/116 (69%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTM +     T     F  S  +  V K  + S GG  WLAD
Sbjct  461  FIYTGQLDFFITKSPKGMKTM-STGLFLTTLSLGFFVSSFLVAVVKKVTGSKGGGGWLAD  519

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  229
            NIN GRLDLFY LLA L +IN V+YLIC++W+KP+K K+ ++MET + G + EEKC
Sbjct  520  NINRGRLDLFYGLLAILSIINLVIYLICAVWYKPKKPKAGIQMETYVKGSSAEEKC  575



>ref|XP_006475796.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
 ref|XP_006475797.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Citrus sinensis]
 gb|KDO80312.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=575

 Score =   116 bits (291),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 63/116 (54%), Positives = 80/116 (69%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTM +     T     F  S  +  V K  + S GG  WLAD
Sbjct  461  FIYTGQLDFFITKSPKGMKTM-STGLFLTTLSLGFFVSSFLVAVVKKVTGSKGGGGWLAD  519

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  229
            NIN GRLDLFY LLA L +IN V+YLIC++W+KP+K K+ ++MET + G + EEKC
Sbjct  520  NINRGRLDLFYGLLAILSIINLVIYLICAVWYKPKKPKAGIQMETYVKGSSAEEKC  575



>ref|XP_006475798.1| PREDICTED: nitrate transporter 1.4-like isoform X3 [Citrus sinensis]
 gb|KDO80313.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=565

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 80/116 (69%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTM +     T     F  S  +  V K  + S GG  WLAD
Sbjct  451  FIYTGQLDFFITKSPKGMKTM-STGLFLTTLSLGFFVSSFLVAVVKKVTGSKGGGGWLAD  509

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  229
            NIN GRLDLFY LLA L +IN V+YLIC++W+KP+K K+ ++MET + G + EEKC
Sbjct  510  NINRGRLDLFYGLLAILSIINLVIYLICAVWYKPKKPKAGIQMETYVKGSSAEEKC  565



>gb|KJB07736.1| hypothetical protein B456_001G041900 [Gossypium raimondii]
Length=581

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  + S+ GQ WLAD
Sbjct  467  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVSVVKKVTGSNDGQGWLAD  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  229
            NIN+GRLD FY LLA LGVINFV+YL+ ++W+KP+  K A++MET++NG + E KC
Sbjct  526  NINHGRLDCFYGLLAVLGVINFVLYLVFAVWYKPKNPKPALQMETIVNGSSAENKC  581



>ref|XP_008457678.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Cucumis melo]
Length=581

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  + S  GQ WLAD
Sbjct  467  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVAVVKRVTGSMDGQGWLAD  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMN-GNGEEKC  229
            NINY RLD FY LLA L  INFV +L+C++W+KP+K K  +EMET  N G+G EKC
Sbjct  526  NINYARLDCFYGLLAILSAINFVAFLVCAVWYKPQKPKQLLEMETSTNGGSGAEKC  581



>ref|XP_010656420.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 ref|XP_010656421.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 emb|CBI28187.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     +     F  S  +  V K  + S  GQ WLAD
Sbjct  462  FIYTGQLDFFITQSPKGMKTM-STGLFLSTLSLGFFVSSFLVSVVKRVTGSRDGQGWLAD  520

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            NINYGRLD FY LLA L  INF V+L+C++W+KP+K    ++MET+ NG+  EEKC
Sbjct  521  NINYGRLDCFYGLLAILSFINFAVFLVCAVWYKPQKPNDGMQMETMANGSCPEEKC  576



>ref|XP_002281975.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Vitis 
vinifera]
Length=580

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     +     F  S  +  V K  + S  GQ WLAD
Sbjct  466  FIYTGQLDFFITQSPKGMKTM-STGLFLSTLSLGFFVSSFLVSVVKRVTGSRDGQGWLAD  524

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            NINYGRLD FY LLA L  INF V+L+C++W+KP+K    ++MET+ NG+  EEKC
Sbjct  525  NINYGRLDCFYGLLAILSFINFAVFLVCAVWYKPQKPNDGMQMETMANGSCPEEKC  580



>gb|KGN60671.1| hypothetical protein Csa_2G006170 [Cucumis sativus]
Length=581

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 76/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  + S  GQ WLAD
Sbjct  467  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVAVVKSVTGSMDGQGWLAD  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMN-GNGEEKC  229
            NINY RLD FY LL  L  INFV +L+C+IW+KP+K K  +EMET  N G+G EKC
Sbjct  526  NINYARLDCFYGLLTILSTINFVAFLVCAIWYKPQKPKQLLEMETSTNGGSGAEKC  581



>gb|AFR11354.1| nitrate transporter [Cucumis sativus]
Length=581

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 76/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  + S  GQ WLAD
Sbjct  467  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVAVVKSVTGSMDGQGWLAD  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMN-GNGEEKC  229
            NINY RLD FY LL  L  INFV +L+C+IW+KP+K K  +EMET  N G+G EKC
Sbjct  526  NINYARLDCFYGLLTILSAINFVAFLVCAIWYKPQKPKQLLEMETSTNGGSGAEKC  581



>ref|XP_004139418.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=623

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 76/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  + S  GQ WLAD
Sbjct  509  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVAVVKSVTGSMDGQGWLAD  567

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMN-GNGEEKC  229
            NINY RLD FY LL  L  INFV +L+C+IW+KP+K K  +EMET  N G+G EKC
Sbjct  568  NINYARLDCFYGLLTILSTINFVAFLVCAIWYKPQKPKQLLEMETSTNGGSGAEKC  623



>ref|XP_004159415.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=623

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 76/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  + S  GQ WLAD
Sbjct  509  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVAVVKSVTGSMDGQGWLAD  567

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMN-GNGEEKC  229
            NINY RLD FY LL  L  INFV +L+C+IW+KP+K K  +EMET  N G+G EKC
Sbjct  568  NINYARLDCFYGLLTILSAINFVAFLVCAIWYKPQKPKQLLEMETSTNGGSGAEKC  623



>ref|XP_004243154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
 ref|XP_010323568.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=569

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 93/116 (80%), Gaps = 6/116 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFF+SSFLVSV+KK T  +   Q WLAD
Sbjct  459  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFISSFLVSVIKKATKTNATAQGWLAD  518

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  229
            NINYGRLDLFYWLLA LGVINF +YL  + W+KPRK KS +      NG G ++KC
Sbjct  519  NINYGRLDLFYWLLAALGVINFAIYLNSATWYKPRKPKSPIP-----NGYGAQDKC  569



>emb|CAD33927.1| nitrate transporter [Cicer arietinum]
Length=201

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 76/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  + +  GQ WLAD
Sbjct  87   FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFISSFLVSVVKKVTGTRDGQGWLAD  145

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  229
            NIN GRLDLF+ LL  L  INFV +L+C+ W+KP+K K +++M  + NG+  EEKC
Sbjct  146  NINKGRLDLFFALLTILSFINFVAFLVCAFWYKPKKAKPSMQMGAINNGSSVEEKC  201



>emb|CDY30787.1| BnaC07g16870D [Brassica napus]
Length=601

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVS+VKKVT+ S  G  WLAD
Sbjct  489  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSIVKKVTATSVNG-GWLAD  547

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEME  262
            NIN+GRLDLFYWLLA L  INFVVY+IC++WFKP K K + EME
Sbjct  548  NINHGRLDLFYWLLAILSGINFVVYVICALWFKPTKGKDSEEME  591



>emb|CDX71495.1| BnaC04g17300D [Brassica napus]
Length=600

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVS+VKKVT+ S  G  WLAD
Sbjct  488  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSIVKKVTATSVNG-GWLAD  546

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEME  262
            NIN+GRLDLFYWLL  L  INFVVYLIC++WFKP K K + EME
Sbjct  547  NINHGRLDLFYWLLVILSGINFVVYLICALWFKPTKGKDSEEME  590



>ref|XP_009103552.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brassica rapa]
Length=577

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVS+VKKVT+ S  G  WLAD
Sbjct  465  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSIVKKVTATSVNG-GWLAD  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEME  262
            NIN+GRLDLFYWLL  L  INFVVY+IC++WFKP K+K + EME
Sbjct  524  NINHGRLDLFYWLLVILSGINFVVYVICALWFKPTKSKDSEEME  567



>gb|KDP32393.1| hypothetical protein JCGZ_13318 [Jatropha curcas]
Length=586

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 99/123 (80%), Gaps = 8/123 (7%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFF SSFLV VVKKVT ++  GQ WL D
Sbjct  464  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFFSSFLVIVVKKVTGSNGTGQGWLGD  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK------NKSA-VEMETVMNGN-GE  238
            NIN GRLD FY LLA L VINF+VYL+C++W+KPRK      +KSA ++ME + NG+  E
Sbjct  524  NINNGRLDCFYGLLATLCVINFLVYLVCALWYKPRKKNTNNDHKSAGLQMENMGNGSLAE  583

Query  237  EKC  229
            EKC
Sbjct  584  EKC  586



>ref|XP_010049998.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Eucalyptus 
grandis]
Length=580

 Score =   107 bits (268),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFF+SS LVSVVKK T  S G Q WLAD
Sbjct  466  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFLSSLLVSVVKKAT-GSGGRQGWLAD  524

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEE  235
            +INYGRLD F+ LL  L ++NFVVYL+C+ W+KP+K K  ++ME + NG+  E
Sbjct  525  HINYGRLDWFFGLLTILSLVNFVVYLVCAAWYKPQKPKPTLQMEKIGNGSAME  577



>emb|CDY45207.1| BnaA07g12830D, partial [Brassica napus]
Length=587

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVS+VKKVT+ S  G  WLAD
Sbjct  475  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSIVKKVTATSVNG-GWLAD  533

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEME  262
            NIN+GRLDLFYWLL  L  INFVVY+IC++WFKP K+K + EME
Sbjct  534  NINHGRLDLFYWLLVILSGINFVVYVICALWFKPTKSKDSEEME  577



>ref|XP_010688014.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Beta vulgaris subsp. 
vulgaris]
Length=589

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 99/122 (81%), Gaps = 9/122 (7%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPKSMKTMSTGLFLTTLSLGFF+SSFLVS++K VT A    + WLAD
Sbjct  470  FIYTGQLDFFITQSPKSMKTMSTGLFLTTLSLGFFLSSFLVSLIKSVT-AKRNTEGWLAD  528

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFK-PRKNKSAVEMETVMNGNG------EE  235
            +INYG+LD FYWLL  L +INFV +++C+IWFK P+KN +++ M+ V NGNG      EE
Sbjct  529  DINYGKLDYFYWLLTLLSLINFVAFMVCAIWFKPPKKNNNSISMK-VSNGNGASYGGAEE  587

Query  234  KC  229
            KC
Sbjct  588  KC  589



>ref|XP_010050000.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW82844.1| hypothetical protein EUGRSUZ_C04215 [Eucalyptus grandis]
Length=535

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFF+SS LVSVVKK T  S G Q WLAD
Sbjct  421  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFLSSLLVSVVKKAT-GSGGRQGWLAD  479

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEE  235
            +INYGRLD F+ LL  L ++NFVVYL+C+ W+KP+K K  ++ME + NG+  E
Sbjct  480  HINYGRLDWFFGLLTILSLVNFVVYLVCAAWYKPQKPKPTLQMEKIGNGSAME  532



>ref|XP_004508509.1| PREDICTED: nitrate transporter 1.4-like [Cicer arietinum]
Length=581

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 76/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  + +  GQ WLAD
Sbjct  467  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFISSFLVSVVKKVTGTRDGQGWLAD  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  229
            NIN GRLDLF+ LL  L  INFV +L+C+ W+KP+K K +++M  + NG+  EEKC
Sbjct  526  NINKGRLDLFFALLTILSFINFVAFLVCAFWYKPKKAKPSMQMGAINNGSSVEEKC  581



>gb|KFK32490.1| hypothetical protein AALP_AA6G249500 [Arabis alpina]
Length=577

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVS+VKKVT+ S  G  WLAD
Sbjct  465  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSIVKKVTATSTDG-GWLAD  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
            NIN+GRLD FYWLL  L  +NFVVY+IC++WFKP K K + E ET  N    E C
Sbjct  524  NINHGRLDCFYWLLVILSGVNFVVYIICALWFKPTKGKDSAEKET-SNSFSVEDC  577



>gb|AAB95302.1| putative nitrate transporter [Arabidopsis thaliana]
Length=586

 Score =   105 bits (263),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 4/111 (4%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVS+VK+VTS S     WLAD
Sbjct  474  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSIVKRVTSTS-TDVGWLAD  532

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG  241
            NIN+GRLD FYWLL  L  INFVVY+IC++WFKP K K +VE E   NG G
Sbjct  533  NINHGRLDYFYWLLVILSGINFVVYIICALWFKPTKGKDSVEKE---NGKG  580



>ref|XP_010093242.1| Nitrate transporter 1.4 [Morus notabilis]
 gb|EXB53744.1| Nitrate transporter 1.4 [Morus notabilis]
Length=581

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 76/118 (64%), Gaps = 4/118 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  + S  GQ WLAD
Sbjct  465  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVSVVKKVTGSRDGQGWLAD  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETV-MNGNGE--EKC  229
            NIN GRLD FY LL  LGVINF  Y++C+ W+KP+K K AV+M  +  NGN +  ++C
Sbjct  524  NINEGRLDCFYGLLTVLGVINFAAYIVCAKWYKPKKAKPAVQMSGINANGNNDNYDRC  581



>ref|XP_002880817.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57076.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
Length=577

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 4/111 (4%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVS+VK+VTS S  G  WLAD
Sbjct  465  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSIVKRVTSTSTDG-GWLAD  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG  241
            NIN+GRLD FYWLL  L  INFVVY+IC++WFKP K K + E E   NG G
Sbjct  524  NINHGRLDYFYWLLVILSGINFVVYIICALWFKPTKGKDSAEKE---NGKG  571



>ref|XP_007154995.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
 gb|ESW26989.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
Length=581

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTM +     T     F  S  +  V K  + +  GQ WLAD
Sbjct  467  FIYTGQLDFFITRSPKGMKTM-STGLFLTTLSLGFFVSSFLVSVVKKVTGTRDGQGWLAD  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNK-SAVEMETVMNGNGEEKC  229
            NIN GRLDLFY LL  L  +NFV +L+C++WFKP+K K  A++M  +     EEKC
Sbjct  526  NINQGRLDLFYGLLTILSFVNFVAFLVCAVWFKPKKPKQPAMQMGAINGSTAEEKC  581



>ref|NP_850084.1| nitrate transporter 1.4 [Arabidopsis thaliana]
 sp|Q9SZY4.1|PTR27_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 6.2; Short=AtNPF6.2; AltName: 
Full=Nitrate transporter 1.4 [Arabidopsis thaliana]
 emb|CAB38705.1| nitrate transporter [Arabidopsis thaliana]
 gb|AEC07875.1| nitrate transporter 1.4 [Arabidopsis thaliana]
Length=577

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 4/111 (4%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVS+VK+VTS S     WLAD
Sbjct  465  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSIVKRVTSTSTD-VGWLAD  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG  241
            NIN+GRLD FYWLL  L  INFVVY+IC++WFKP K K +VE E   NG G
Sbjct  524  NINHGRLDYFYWLLVILSGINFVVYIICALWFKPTKGKDSVEKE---NGKG  571



>gb|AAM20651.1| putative nitrate transporter [Arabidopsis thaliana]
Length=577

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 4/111 (4%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVS+VK+VTS S     WLAD
Sbjct  465  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSIVKRVTSTSTD-VGWLAD  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG  241
            NIN+GRLD FYWLL  L  INFVVY+IC++WFKP K K +VE E   NG G
Sbjct  524  NINHGRLDYFYWLLVILSGINFVVYIICALWFKPTKGKDSVEKE---NGKG  571



>ref|XP_006293915.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
 gb|EOA26813.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
Length=570

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVSVVKKVTS S  G  WLAD
Sbjct  458  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSVVKKVTSTSTDG-GWLAD  516

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  229
            NIN+GRLD FYWLL  L  INFV Y IC++WFKP K K + E E   NG G   E C
Sbjct  517  NINHGRLDYFYWLLVILSGINFVAYFICALWFKPTKGKDSAEKE---NGKGFTAEDC  570



>ref|XP_010510873.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510875.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510876.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510877.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
Length=577

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 92/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVSV+KKVTS S  G  WLAD
Sbjct  465  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSVIKKVTSTSTDG-GWLAD  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  229
            NIN+GRLD FYWLL  L  INFVVY IC++WFKP K K + E +   NG G   E C
Sbjct  524  NINHGRLDYFYWLLVILSGINFVVYFICALWFKPTKGKDSAEKD---NGKGFSAEDC  577



>gb|KHN34550.1| Nitrate transporter 1.4, partial [Glycine soja]
Length=272

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 74/117 (63%), Gaps = 3/117 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTM +     T     F  S  +  V K  + +  GQ WLAD
Sbjct  157  FIYTGQLDFFITRSPKGMKTM-STGLFLTTLSLGFFFSSFLVSVVKKVTGTRDGQGWLAD  215

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNK--SAVEMETVMNGNGEEKC  229
            +IN GRLDLFY LL  L  +NFV + +C++WFKP+K K  +A++M  V     EEKC
Sbjct  216  SINKGRLDLFYALLTILSFVNFVAFAVCAVWFKPKKPKQPAAMQMGPVNGSTAEEKC  272



>ref|XP_010417814.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 92/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVSV+KKVTS+S  G  WLAD
Sbjct  465  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSVIKKVTSSSTDG-GWLAD  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  229
            NIN+GRLD FYWLL  L  INF VY IC++WFKP K K + E E   NG G   E C
Sbjct  524  NINHGRLDYFYWLLVILSGINFGVYFICALWFKPTKGKDSAEKE---NGKGFSAEDC  577



>ref|XP_006408723.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
 gb|ESQ50176.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
Length=533

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 89/105 (85%), Gaps = 2/105 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVSVVK+VT+ S  G  WLAD
Sbjct  420  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSVVKRVTATSMDG-GWLAD  478

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKS-AVEME  262
            NIN GRLD FYWLL  L  INFVVY+IC++WFKP K K  +VEME
Sbjct  479  NINQGRLDRFYWLLVILSGINFVVYVICALWFKPTKGKEDSVEME  523



>ref|XP_010049997.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Eucalyptus grandis]
Length=580

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 1/114 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  + K  + +  GQ WLAD
Sbjct  466  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVSIVKKATGTGAGQGWLAD  524

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  232
            NINYGRLD FY LL  L ++NFV YL+C+ W KP+K K  ++ E + NG+  E+
Sbjct  525  NINYGRLDCFYGLLTLLSLVNFVAYLVCAAWCKPQKLKPTMQKEKIGNGSSMEE  578



>gb|KCW82843.1| hypothetical protein EUGRSUZ_C04214 [Eucalyptus grandis]
Length=576

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 1/114 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  + K  + +  GQ WLAD
Sbjct  462  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVSIVKKATGTGAGQGWLAD  520

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  232
            NINYGRLD FY LL  L ++NFV YL+C+ W KP+K K  ++ E + NG+  E+
Sbjct  521  NINYGRLDCFYGLLTLLSLVNFVAYLVCAAWCKPQKLKPTMQKEKIGNGSSMEE  574



>ref|XP_010473052.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVSV+KKVTS S  G  WLAD
Sbjct  465  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSVIKKVTSTSTDG-GWLAD  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  229
            NIN+GRLD FYWLL  L  INF VY IC++WFKP K K + E E   NG G   E C
Sbjct  524  NINHGRLDYFYWLLVILSGINFGVYFICALWFKPTKGKDSAEKE---NGKGFAAEDC  577



>ref|XP_006408724.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
 dbj|BAJ33792.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50177.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
Length=578

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 89/105 (85%), Gaps = 2/105 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVSVVK+VT+ S  G  WLAD
Sbjct  465  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSVVKRVTATSMDG-GWLAD  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKS-AVEME  262
            NIN GRLD FYWLL  L  INFVVY+IC++WFKP K K  +VEME
Sbjct  524  NINQGRLDRFYWLLVILSGINFVVYVICALWFKPTKGKEDSVEME  568



>gb|EYU29790.1| hypothetical protein MIMGU_mgv1a003653mg [Erythranthe guttata]
Length=571

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  + S+GGQ WLAD
Sbjct  468  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVSVVKKVTTSNGGQGWLAD  526

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNK  280
            NIN+GRLD FY LLA LG +N ++YLIC+ W+KP K K
Sbjct  527  NINHGRLDCFYGLLAVLGFVNLIIYLICAAWYKPHKPK  564



>gb|KHN15097.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 74/117 (63%), Gaps = 3/117 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTM +     T     F  S  +  V K  + +  GQ WLAD
Sbjct  466  FIYTGQLDFFITRSPKGMKTM-STGLFLTTLSLGFFFSSFLVSVVKKVTGTRDGQGWLAD  524

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNK--SAVEMETVMNGNGEEKC  229
            +IN GRLDLFY LL  L  +NFV + +C++WFKP+K K  +A++M  V     EEKC
Sbjct  525  SINKGRLDLFYALLTILSFVNFVAFAVCAVWFKPKKPKQPAAMQMGPVNGSTAEEKC  581



>ref|XP_010510874.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Camelina 
sativa]
Length=577

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFFVSSFLVSV+KKVTS S  G  WLAD
Sbjct  465  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFVSSFLVSVIKKVTSTSTDG-GWLAD  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  229
            NIN+GRLD FYWLL  L  INF VY IC++WFKP K K + E +   NG G   E C
Sbjct  524  NINHGRLDYFYWLLVILSGINFGVYFICALWFKPTKGKDSAEKD---NGKGFSAEDC  577



>ref|XP_011458172.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Fragaria vesca subsp. 
vesca]
Length=579

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 70/115 (61%), Gaps = 6/115 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     +     F  S  +  + +  + S  GQ WLAD
Sbjct  471  FIYTGQLDFFITQSPKGMKTM-STGLFLSTIALGFFVSSFLVSIVRRFTGSKDGQGWLAD  529

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
            NINYGRLD FY LL+ L VINFV YL+C+ W+KPRK             + E+KC
Sbjct  530  NINYGRLDCFYGLLSVLSVINFVAYLVCARWYKPRKPTKPSN-----GSSAEDKC  579



>ref|XP_006837800.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
 gb|ERN00369.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
Length=576

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 85/110 (77%), Gaps = 1/110 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSP  MKTMSTGLFLTTLSLGFFVSS LVS+V ++T  S G   WLAD
Sbjct  462  FIYTGQLDFFITQSPAGMKTMSTGLFLTTLSLGFFVSSMLVSMVDRITGGS-GKGGWLAD  520

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN  244
            +IN GRLD FYWLL+GL ++NF VYL C+ WFKPR     +EME    GN
Sbjct  521  DINKGRLDCFYWLLSGLSLVNFAVYLWCAAWFKPRPPPQDMEMEVADKGN  570



>ref|XP_006600752.1| PREDICTED: nitrate transporter 1.4-like [Glycine max]
Length=585

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 73/117 (62%), Gaps = 3/117 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTM +     T     F  S  +  V K  + +  GQ WLAD
Sbjct  470  FIYTGQLDFFITRSPKGMKTM-STGLFLTTLSLGFFFSSFLVSVVKKVTGTRDGQGWLAD  528

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNK--SAVEMETVMNGNGEEKC  229
            +IN GRLDLFY LL  L  +NF  + +C++WFKP+K K  +A++M  V     EEKC
Sbjct  529  SINKGRLDLFYALLTILSFVNFAAFAVCAVWFKPKKPKQPAAMQMGPVNGSTAEEKC  585



>ref|XP_008444009.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Cucumis melo]
Length=580

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 92/116 (79%), Gaps = 4/116 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFF+SSFLVSVVK+V    + G+ WLAD
Sbjct  468  FIYTGQLDFFITKSPKGMKTMSTGLFLTTLSLGFFISSFLVSVVKRV--TGNDGEGWLAD  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            NINYGRLD FY LL  L +INFV +L+C IW+ P+K K   +   ++NGN  EEKC
Sbjct  526  NINYGRLDCFYGLLTILSIINFVAFLVCVIWYMPQKRKD-FQKNGIVNGNLAEEKC  580



>ref|XP_003609313.1| Nitrate transporter [Medicago truncatula]
 gb|AES91510.1| peptide/nitrate transporter [Medicago truncatula]
Length=577

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 75/117 (64%), Gaps = 7/117 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     T     F  S  +  V K  + +  GQ WLAD
Sbjct  466  FIYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFVSSFLVSVVKKVTGTRDGQGWLAD  524

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG--EEKC  229
            +IN GRLDLFY LL  L  INFV +L+C+ W+KP+K K +++    +NG+   EEKC
Sbjct  525  HINKGRLDLFYALLTILSFINFVAFLVCAFWYKPKKPKPSMQ----INGSSSVEEKC  577



>gb|AGA60121.1| nitrate transporter NRT1.4B [Cucumis sativus]
 gb|KGN65321.1| hypothetical protein Csa_1G324370 [Cucumis sativus]
Length=580

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 92/116 (79%), Gaps = 4/116 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFL+TLSLGFF+SSFLVSVVK+V    + G+ WLAD
Sbjct  468  FIYTGQLDFFITKSPKGMKTMSTGLFLSTLSLGFFISSFLVSVVKRV--TGNDGEGWLAD  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            N+NYGRLD FY LL  L +INFV +L+C IW+ P+K K   +   ++NGN  EEKC
Sbjct  526  NVNYGRLDCFYGLLTILSIINFVAFLVCVIWYMPQKRKD-FQKNGIVNGNLAEEKC  580



>ref|XP_004150978.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
 ref|XP_004168393.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=599

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 92/116 (79%), Gaps = 4/116 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFL+TLSLGFF+SSFLVSVVK+V    + G+ WLAD
Sbjct  487  FIYTGQLDFFITKSPKGMKTMSTGLFLSTLSLGFFISSFLVSVVKRV--TGNDGEGWLAD  544

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            N+NYGRLD FY LL  L +INFV +L+C IW+ P+K K   +   ++NGN  EEKC
Sbjct  545  NVNYGRLDCFYGLLTILSIINFVAFLVCVIWYMPQKRKD-FQKNGIVNGNLAEEKC  599



>ref|XP_010254380.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Nelumbo nucifera]
Length=578

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     +     F  S L+  V K  + S+ GQ WLAD
Sbjct  464  FIYTGQLDFFITQSPKGMKTM-STGLFLSTLSLGFFVSSLLVSVVKKVTGSNDGQGWLAD  522

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  229
            NIN GRLD FY LLA    INF+++L+C++W+K +K + ++++E   NG + EE C
Sbjct  523  NINDGRLDCFYGLLAVSSFINFLLFLLCTVWYKKQKPQRSLQIEIAANGSSAEEIC  578



>ref|XP_010254379.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Nelumbo nucifera]
Length=582

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTM +     +     F  S L+  V K  + S+ GQ WLAD
Sbjct  468  FIYTGQLDFFITQSPKGMKTM-STGLFLSTLSLGFFVSSLLVSVVKKVTGSNDGQGWLAD  526

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNG-NGEEKC  229
            NIN GRLD FY LLA    INF+++L+C++W+K +K + ++++E   NG + EE C
Sbjct  527  NINDGRLDCFYGLLAVSSFINFLLFLLCTVWYKKQKPQRSLQIEIAANGSSAEEIC  582



>ref|XP_006450457.1| hypothetical protein CICLE_v10008198mg [Citrus clementina]
 gb|ESR63697.1| hypothetical protein CICLE_v10008198mg [Citrus clementina]
Length=467

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 72/114 (63%), Gaps = 1/114 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMYTGQLDFF+TQSPK MKTM +     T     F  S L+  + K  + S+G   W+ +
Sbjct  353  FMYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFFSSLLVSIVKAATGSNGKHGWVGE  411

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  232
            NIN GRLD FY LLA L  INF ++L+C+ W+K +K K   EME ++ G+  E+
Sbjct  412  NINKGRLDCFYGLLAALSFINFGLFLLCASWYKRKKAKQVPEMEIIVKGSSVEE  465



>ref|XP_006483349.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Citrus sinensis]
Length=536

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 72/114 (63%), Gaps = 1/114 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMYTGQLDFF+TQSPK MKTM +     T     F  S L+  + K  + S+G   W+ +
Sbjct  422  FMYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFFSSLLVSIVKAATGSNGKHGWVGE  480

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  232
            NIN GRLD FY LLA L  INF ++L+C+ W+K +K K   EME ++ G+  E+
Sbjct  481  NINKGRLDCFYGLLAALSFINFGLFLLCASWYKRKKAKQVPEMEIIVKGSSVEE  534



>gb|KDO61703.1| hypothetical protein CISIN_1g008020mg [Citrus sinensis]
Length=581

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 72/114 (63%), Gaps = 1/114 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMYTGQLDFF+TQSPK MKTM +     T     F  S L+  + K  + S+G   W+ +
Sbjct  467  FMYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFFSSLLVSIVKAATGSNGKHGWVGE  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  232
            NIN GRLD FY LLA L  INF ++L+C+ W+K +K K   EME ++ G+  E+
Sbjct  526  NINKGRLDCFYGLLAALSFINFGLFLLCASWYKRKKAKQVPEMEIIVKGSSVEE  579



>ref|XP_006483348.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
Length=581

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 72/114 (63%), Gaps = 1/114 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMYTGQLDFF+TQSPK MKTM +     T     F  S L+  + K  + S+G   W+ +
Sbjct  467  FMYTGQLDFFITQSPKGMKTM-STGLFLTTLSLGFFFSSLLVSIVKAATGSNGKHGWVGE  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  232
            NIN GRLD FY LLA L  INF ++L+C+ W+K +K K   EME ++ G+  E+
Sbjct  526  NINKGRLDCFYGLLAALSFINFGLFLLCASWYKRKKAKQVPEMEIIVKGSSVEE  579



>emb|CCN27382.1| low affinity nitrate transporter, partial [Triticum aestivum]
Length=143

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 80/116 (69%), Gaps = 11/116 (9%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPKSMKTMSTGLFLTTLSLGFF+SS LVS+V        G   WL D
Sbjct  38   FIYTGQLDFFITRSPKSMKTMSTGLFLTTLSLGFFLSSALVSLV-------RGATTWLGD  90

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
             IN+ RLD FYWLLA LG IN   YL+C++W  P  +  A   E   +G   +EKC
Sbjct  91   TINHSRLDYFYWLLAVLGAINLAAYLLCAMWATPAASSKA---EQPHHGTAADEKC  143



>gb|KHN47160.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTM +     T     F  S  +  V K  + +  GQ WLAD
Sbjct  469  FIYTGQLDFFITRSPKGMKTM-STGLFLTTLSLGFFISSFLVSVVKKVTGTRDGQGWLAD  527

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNK  280
            NIN GRLDLFY LL  L  INFV + +C++WFKP+K K
Sbjct  528  NINKGRLDLFYALLTILSFINFVAFAVCALWFKPKKPK  565



>ref|XP_008792048.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Phoenix 
dactylifera]
Length=589

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 89/116 (77%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFF+SSFLVSVVK +T   HG   WLAD
Sbjct  475  FVYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFFLSSFLVSVVKSLTGGKHG-NGWLAD  533

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET-VMNGNGEEKC  229
            NINYGRLD FY LLA L  IN   +L+C+ W KP+  K  ++ E+ V + + +++C
Sbjct  534  NINYGRLDCFYGLLAVLSAINLGAFLVCAAWSKPQAAKPGLQTESAVKSSSADDEC  589



>ref|XP_008792049.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Phoenix 
dactylifera]
Length=585

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 89/116 (77%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFF+SSFLVSVVK +T   HG   WLAD
Sbjct  471  FVYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFFLSSFLVSVVKSLTGGKHG-NGWLAD  529

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET-VMNGNGEEKC  229
            NINYGRLD FY LLA L  IN   +L+C+ W KP+  K  ++ E+ V + + +++C
Sbjct  530  NINYGRLDCFYGLLAVLSAINLGAFLVCAAWSKPQAAKPGLQTESAVKSSSADDEC  585



>ref|XP_007204809.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
 gb|EMJ06008.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
Length=585

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 91/120 (76%), Gaps = 6/120 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFL+TLSLGFFVSSFLVS+VK VT  S   Q WL D
Sbjct  467  FIYTGQLDFFITKSPKGMKTMSTGLFLSTLSLGFFVSSFLVSIVKAVT-GSKDEQGWLTD  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK-NKSAVEM-ETVMNGNG---EEKC  229
            NINYGRLD FY LL  L VINFVVYL+C+ W+K  + +  A++M  T    NG   E++C
Sbjct  526  NINYGRLDCFYGLLTVLSVINFVVYLVCARWYKTHEPHPPALQMTSTTAKANGSSAEDRC  585



>ref|XP_007011887.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY29506.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=553

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 87/116 (75%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTL+LGFF+SS LVS+VK VT  S G Q W+ +
Sbjct  439  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLALGFFLSSLLVSIVKTVT-GSSGKQGWVGE  497

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  229
            NIN GRLD FY LLA L  INF ++L+C+ W++ +  K   E+E +   +  EEKC
Sbjct  498  NINEGRLDCFYGLLAALSFINFALFLVCAAWYRKKTVKRDPELEIIAKESTIEEKC  553



>ref|XP_007011886.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY29505.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=668

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 87/116 (75%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTL+LGFF+SS LVS+VK VT  S G Q W+ +
Sbjct  554  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLALGFFLSSLLVSIVKTVT-GSSGKQGWVGE  612

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  229
            NIN GRLD FY LLA L  INF ++L+C+ W++ +  K   E+E +   +  EEKC
Sbjct  613  NINEGRLDCFYGLLAALSFINFALFLVCAAWYRKKTVKRDPELEIIAKESTIEEKC  668



>ref|XP_008337300.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTM +     +     F  S L+  +    + +  GQ WLA+
Sbjct  472  FIYTGQLDFFITKSPKGMKTM-STGLFLSTLSLGFFVSSLLVSIVTAVTGNEDGQGWLAB  530

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG  241
            NINYGRLD FY LL  L VINFV YL+C+ W+     + A  ++T  + NG
Sbjct  531  NINYGRLDCFYGLLTVLSVINFVAYLVCARWYHKTHKQHAFVLQTA-SANG  580



>ref|XP_008352261.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTM +     +     F  S L+  +    + +  GQ WLA+
Sbjct  472  FIYTGQLDFFITKSPKGMKTM-STGLFLSTLSLGFFVSSLLVSIVTAVTGNEDGQGWLAB  530

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG  241
            NINYGRLD FY LL  L VINFV YL+C+ W+     + A  ++T  + NG
Sbjct  531  NINYGRLDCFYGLLTVLSVINFVAYLVCARWYHKTHKQHAFVLQTA-SANG  580



>ref|XP_004968920.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Setaria italica]
Length=590

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 66/115 (57%), Positives = 80/115 (70%), Gaps = 9/115 (8%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFF+SS LVS+V        G   WL D
Sbjct  485  FIYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFFLSSALVSLV-------KGCTTWLGD  537

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
             IN+ RLD FYWLLA L V+N V YL+C++W  P  +  A + +  M    +EKC
Sbjct  538  TINHSRLDYFYWLLAVLSVVNLVAYLVCAMWTTPPASSQAEQPQIAM--TADEKC  590



>gb|EMT23542.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=630

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 66/115 (57%), Positives = 78/115 (68%), Gaps = 9/115 (8%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPKSMKTMSTGLFLTTLSLGFF+SS LVS+V        G   WL D
Sbjct  525  FIYTGQLDFFITRSPKSMKTMSTGLFLTTLSLGFFLSSALVSLV-------RGATTWLGD  577

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
             IN+ RLD FYWLLA LG IN   YL+C++W  P  +  A +         +EKC
Sbjct  578  TINHSRLDYFYWLLAVLGAINLAAYLLCAMWATPAASSKAEQPHHA--AAADEKC  630



>ref|XP_008784904.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Phoenix dactylifera]
Length=589

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 50/105 (48%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTM +     T     F  S  +  + K  +A   G  WLAD
Sbjct  473  FVYTGQLDFFITRSPKGMKTM-STGLFLTTLSLGFFVSSFLVSIVKSLTAGREGNGWLAD  531

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET  259
            NINYGRLD FY LLA L  +N   +L+C+   KP+  K+ V+ME+
Sbjct  532  NINYGRLDCFYGLLAVLSAVNLGAFLLCAARTKPQTPKAGVQMES  576



>gb|KHG05036.1| Nitrate transporter 1.4 -like protein [Gossypium arboreum]
Length=579

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 87/116 (75%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFF SS LVS+VK  T +S   Q WL +
Sbjct  465  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFFSSLLVSIVKATTGSSDK-QGWLGE  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  229
            +IN GRLD FY LLA L  +NF ++L+ ++WF+ +  K A +ME V+  +  EEKC
Sbjct  524  HINKGRLDCFYGLLAALSFLNFGLFLLSAVWFRKKTVKQAPKMEIVVKESTIEEKC  579



>ref|XP_009368838.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Pyrus x bretschneideri]
Length=576

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTM +     +     F  S L+  + K  + +  GQ WLAD
Sbjct  467  FIYTGQLDFFITKSPKGMKTM-STGLFLSTLSLGFFVSSLLVSIVKSVTGNEDGQGWLAD  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIW-FKPRKNKSAVEMETVMNG  247
            NINYGRLD FY LL  L VINFV YL+C+ W  K  K  + V      NG
Sbjct  526  NINYGRLDCFYGLLTVLSVINFVAYLVCARWSHKTHKQHAFVLQMASANG  575



>ref|XP_003566777.2| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brachypodium distachyon]
Length=627

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 63/115 (55%), Positives = 75/115 (65%), Gaps = 10/115 (9%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFL TLSLGFF+SS LVS+V        G   WL D
Sbjct  523  FIYTGQLDFFITRSPKGMKTMSTGLFLATLSLGFFLSSALVSLV-------KGATTWLGD  575

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
             IN+ RLD FYWLLA LG +N   YL+C++W  P    S  +         +EKC
Sbjct  576  TINHSRLDYFYWLLAVLGAVNLAAYLLCAMWATPAAGSSKADPAATA---ADEKC  627



>ref|XP_010914872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=582

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFF+SSFLVS+VK +T   HG   WLAD
Sbjct  474  FIYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFFLSSFLVSIVKTLTGGKHG-NGWLAD  532

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETV  256
            +IN+GRLD FYWLLA L  IN   +++ + W KP+  KS  +  +V
Sbjct  533  DINHGRLDCFYWLLAVLSAINLGAFIVSAAWTKPQAAKSVAKSYSV  578



>ref|XP_010925226.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=588

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFFVSS LVS+V  +T   HG   WLAD
Sbjct  473  FVYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFFVSSLLVSIVNSLTGGKHG-NGWLAD  531

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET  259
            NIN GRLD FY LLA LG +N   +L+C+   KP+  ++ ++ME+
Sbjct  532  NINNGRLDCFYGLLAVLGAVNLGAFLLCAARTKPQTPQAGLQMES  576



>dbj|BAJ90833.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 64/115 (56%), Positives = 77/115 (67%), Gaps = 12/115 (10%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFF+SS LVS+V        G   WL D
Sbjct  472  FIYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFFLSSALVSLV-------RGATTWLGD  524

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
             IN+ RLD FYWLLA LG +N   YL+C++W  P     A +       + +EKC
Sbjct  525  TINHSRLDYFYWLLAVLGALNLAAYLLCAMWATPAAGSKAEQQP-----HPDEKC  574



>gb|EMS53820.1| Nitrate transporter 1.4 [Triticum urartu]
Length=542

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 78/115 (68%), Gaps = 9/115 (8%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPKSMKTMSTGLFLTTLSLGFF+SS LVS+V        G   WL D
Sbjct  437  FIYTGQLDFFITRSPKSMKTMSTGLFLTTLSLGFFLSSALVSLV-------RGATTWLGD  489

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
             IN+ RL+ FYWLLA LG +N   YL+C++W  P  +  A +         +EKC
Sbjct  490  TINHSRLNYFYWLLAVLGTLNLAAYLLCAMWATPAASSKAEQPHPAT--AADEKC  542



>ref|XP_008675518.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Zea mays]
 tpg|DAA59044.1| TPA: hypothetical protein ZEAMMB73_584071 [Zea mays]
Length=591

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 67/115 (58%), Positives = 81/115 (70%), Gaps = 9/115 (8%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPKSMKTMSTGLFLTTLSLGFF+SS LVS+VK  T        WL D
Sbjct  486  FIYTGQLDFFITRSPKSMKTMSTGLFLTTLSLGFFLSSALVSLVKSCTR-------WLGD  538

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
             IN+ RLD FYWLLA L V+N V YL+C++W     +  A + +  M    +EKC
Sbjct  539  TINHSRLDYFYWLLAVLSVVNLVAYLVCAMWATAPTSSQAEQPQPAM--VADEKC  591



>ref|XP_009397479.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (73%), Gaps = 3/117 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLS GFF+SSF+VSVV+ VT   +G Q WLAD
Sbjct  468  FLYTGQLDFFITRSPKGMKTMSTGLFLTTLSFGFFLSSFMVSVVRDVTGGKNG-QGWLAD  526

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEM--ETVMNGNGEEKC  229
            NINYGRLD FY LLA L  +N   +L+C++W K       ++M    + + + E+ C
Sbjct  527  NINYGRLDYFYGLLAALSTLNMGAFLVCAMWIKQENPNQGLQMGSAALKSSSMEDTC  583



>gb|EPS59108.1| hypothetical protein M569_15702, partial [Genlisea aurea]
Length=523

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 85/106 (80%), Gaps = 3/106 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMST LFLTTL+LGFF+SSFLV+VVK++T++S  G  WLA 
Sbjct  419  FIYTGQLDFFITQSPKGMKTMSTALFLTTLALGFFLSSFLVTVVKQITASSSRG-GWLAG  477

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNK--SAVEME  262
            NI+ GRLD FY LLA LG +NF VYL+C+  +K +K K    VE+E
Sbjct  478  NIDRGRLDCFYGLLAALGGLNFAVYLVCAAKYKYQKPKHEQVVELE  523



>gb|KJB82816.1| hypothetical protein B456_013G215400 [Gossypium raimondii]
Length=579

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 84/116 (72%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+TQSPK MKTMSTGLFLTTLSLGFF SS LVS+VK  T +S   Q WL +
Sbjct  465  FIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFFFSSLLVSIVKATTGSSDK-QGWLGE  523

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG-EEKC  229
            +IN GRLD FY LLA L   NF ++L+ + WF+ +  K A E E ++  +  EEKC
Sbjct  524  HINKGRLDCFYGLLAALSFFNFGLFLLSAAWFRKKTVKQAPETEIIVKESTIEEKC  579



>ref|XP_009407665.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=575

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 83/115 (72%), Gaps = 7/115 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFF+SSFLVS VK VT     GQ WLAD
Sbjct  468  FIYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFFLSSFLVSFVKGVTGGKG-GQGWLAD  526

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
            NINYGRLD FY LLAGL  +N   +L+C+ W KPR            +  GE+KC
Sbjct  527  NINYGRLDCFYGLLAGLSTMNLGAFLVCAGWSKPRVESPE------KDSCGEDKC  575



>ref|XP_010676154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Beta vulgaris subsp. 
vulgaris]
Length=599

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 80/111 (72%), Gaps = 3/111 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFLTTLSLGFFVSS LV+VV  +T   H    W+AD
Sbjct  488  FTYIGQLDFFLRECPKGMKTMSTGLFLTTLSLGFFVSSALVTVVHNITGDKH---PWIAD  544

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNG  241
            N+N GRLD FYWLLAGL V+NF+VYL+ + W+  ++ + A E   V   +G
Sbjct  545  NLNQGRLDYFYWLLAGLSVVNFLVYLVFAKWYIYKETRLAEEGYEVEEDDG  595



>gb|AFW80908.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=587

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 9/115 (8%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+ +SPKSMKTMSTGLFLTTLSLGFF+SS LVS+VK  T        WL D
Sbjct  482  FIYTGQLDFFIMRSPKSMKTMSTGLFLTTLSLGFFLSSALVSLVKSCTR-------WLGD  534

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
             IN+ RLD FYWLLA LGV+N V Y++ ++W     +  A + +  M    +EKC
Sbjct  535  TINHSRLDYFYWLLAVLGVVNLVAYIVYAMWAAAPASSQAEQPQHAM--AADEKC  587



>ref|NP_001169613.1| uncharacterized protein LOC100383494 [Zea mays]
 gb|ACN34269.1| unknown [Zea mays]
 gb|AFW80907.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=591

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 9/115 (8%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+ +SPKSMKTMSTGLFLTTLSLGFF+SS LVS+VK  T        WL D
Sbjct  486  FIYTGQLDFFIMRSPKSMKTMSTGLFLTTLSLGFFLSSALVSLVKSCTR-------WLGD  538

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
             IN+ RLD FYWLLA LGV+N V Y++ ++W     +  A + +  M    +EKC
Sbjct  539  TINHSRLDYFYWLLAVLGVVNLVAYIVYAMWAAAPASSQAEQPQHAM--AADEKC  591



>ref|XP_009388204.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=608

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 3/107 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSAS-HGGQDWLA  397
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVS+ LV+ V  +T  S HG   WLA
Sbjct  491  FTYVGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSTALVAAVDSITGQSGHGA--WLA  548

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETV  256
            DN+N+G+L+ FYWLLA L ++N +VYL+ + W+  +  + AV+ ++V
Sbjct  549  DNLNHGKLNNFYWLLAALCLVNLMVYLVAAKWYVYKDQRPAVDDDSV  595



>ref|XP_006645998.1| PREDICTED: nitrate transporter 1.4-like [Oryza brachyantha]
Length=593

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 58/91 (64%), Positives = 68/91 (75%), Gaps = 7/91 (8%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFF+SS LVS+V        G   WLAD
Sbjct  476  FIYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFFLSSALVSLV-------KGATAWLAD  528

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIW  301
             I+  RLD FYWLLA L  +N   YL+C++W
Sbjct  529  TIDRSRLDYFYWLLAVLSALNLAAYLVCAMW  559



>dbj|BAD87491.1| putative dicarboxylate transporter [Oryza sativa Japonica Group]
 dbj|BAD87642.1| putative dicarboxylate transporter [Oryza sativa Japonica Group]
Length=587

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 74/116 (64%), Gaps = 8/116 (7%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFF SS LVS+V        G   WL D
Sbjct  479  FIYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFFFSSVLVSLV-------KGATTWLGD  531

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET-VMNGNGEEKC  229
             I+  RLD FYWLLA L V+N   YL+C+ W       S  + +      + +EKC
Sbjct  532  TIDRSRLDYFYWLLAVLSVLNLAAYLVCAKWAATAAATSREQQQQHTAVADADEKC  587



>ref|XP_010093702.1| Nitrate transporter 1.1 [Morus notabilis]
 gb|EXB54482.1| Nitrate transporter 1.1 [Morus notabilis]
Length=222

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 6/109 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV++V K    +   + WL D
Sbjct  112  FIYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSLLVTIVHK---VTWNTKPWLPD  168

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWF---KPRKNKSAVEMETV  256
            N+N GRL  FYWLLA L  +NFV+YL+C+ W+     R   + +E+E V
Sbjct  169  NLNQGRLYDFYWLLAALSALNFVIYLVCAKWYVYKDKRLADAGIELEEV  217



>ref|XP_010670640.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=575

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F YTGQLDFF+T+SP+ MK +STGLFL T+SLGFF+SSFLV +V+KVT  S GG  W+ D
Sbjct  462  FTYTGQLDFFITESPRGMKGLSTGLFLVTISLGFFISSFLVLIVQKVTL-SFGGDGWIGD  520

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
            NIN GRLD FY LL+ L  INF +YL+ + W+K +         T   G+ EE+C
Sbjct  521  NINKGRLDCFYGLLSILSFINFGLYLVSARWYKRQMPAKPTLQVTCGKGSPEEEC  575



>ref|XP_010670639.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=599

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F YTGQLDFF+T+SP+ MK +STGLFL T+SLGFF+SSFLV +V+KVT  S GG  W+ D
Sbjct  486  FTYTGQLDFFITESPRGMKGLSTGLFLVTISLGFFISSFLVLIVQKVTL-SFGGDGWIGD  544

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
            NIN GRLD FY LL+ L  INF +YL+ + W+K +         T   G+ EE+C
Sbjct  545  NINKGRLDCFYGLLSILSFINFGLYLVSARWYKRQMPAKPTLQVTCGKGSPEEEC  599



>gb|EAY74514.1| hypothetical protein OsI_02405 [Oryza sativa Indica Group]
Length=566

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 74/116 (64%), Gaps = 8/116 (7%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFF SS LVS+V        G   WL D
Sbjct  458  FIYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFFFSSVLVSLV-------KGATTWLGD  510

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET-VMNGNGEEKC  229
             I+  RLD FYWLLA L V+N   YL+C+ W       S  + +      + +EKC
Sbjct  511  TIDRSRLDYFYWLLAVLSVLNLAAYLVCAKWAATAAATSREQQQQHTAVADADEKC  566



>gb|EAZ12317.1| hypothetical protein OsJ_02208 [Oryza sativa Japonica Group]
Length=566

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 74/116 (64%), Gaps = 8/116 (7%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFF SS LVS+V        G   WL D
Sbjct  458  FIYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFFFSSVLVSLV-------KGATTWLGD  510

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET-VMNGNGEEKC  229
             I+  RLD FYWLLA L V+N   YL+C+ W       S  + +      + +EKC
Sbjct  511  TIDRSRLDYFYWLLAVLSVLNLAAYLVCAKWAATAAATSREQQQQHTAVADADEKC  566



>ref|NP_001043326.1| Os01g0556700 [Oryza sativa Japonica Group]
 dbj|BAF05240.1| Os01g0556700 [Oryza sativa Japonica Group]
Length=566

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 74/116 (64%), Gaps = 8/116 (7%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFF SS LVS+V        G   WL D
Sbjct  458  FIYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFFFSSVLVSLV-------KGATTWLGD  510

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET-VMNGNGEEKC  229
             I+  RLD FYWLLA L V+N   YL+C+ W       S  + +      + +EKC
Sbjct  511  TIDRSRLDYFYWLLAVLSVLNLAAYLVCAKWAATAAATSREQQQQHTAVADADEKC  566



>ref|XP_003538742.1| PREDICTED: nitrate transporter 1.1 [Glycine max]
Length=586

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 77/102 (75%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMY GQLDFFL + PK MKTMSTGLFL+TLSLGFF S+ LVS+V K+   +HG + WLAD
Sbjct  473  FMYMGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFFSTLLVSIVNKM--TAHG-RPWLAD  529

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            N+N GRL  FYWLLA L  IN V+YL+C+ W+  ++ + A E
Sbjct  530  NLNQGRLYDFYWLLAILSAINVVLYLVCAKWYVYKEKRLAEE  571



>ref|XP_011033951.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like, partial [Populus 
euphratica]
Length=505

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 75/102 (74%), Gaps = 4/102 (4%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT      + WLAD
Sbjct  395  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSSLVAIVHKVTL----NKPWLAD  450

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            N+N GRL  FYWL+A L  +NFV+YLIC+ W+  +  + A E
Sbjct  451  NLNQGRLHDFYWLVAILSALNFVIYLICARWYVSKDERLAAE  492



>ref|XP_011033950.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Populus euphratica]
Length=583

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 74/102 (73%), Gaps = 4/102 (4%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT      + WLAD
Sbjct  473  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSSLVTIVHKVTR----NKPWLAD  528

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            N+N GRL  FYWL+A L  +NFV+YLIC+ W+  +    A E
Sbjct  529  NLNQGRLHDFYWLVAILSALNFVIYLICARWYVYKDKMLAAE  570



>ref|XP_009407160.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=601

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 63/103 (61%), Positives = 78/103 (76%), Gaps = 3/103 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSAS-HGGQDWLA  397
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV+VV KVT  S HG   WLA
Sbjct  483  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVTVVHKVTGESGHGA--WLA  540

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            DN+N G+L  FYWLLA L ++N V YL+ + W+  ++ ++AV+
Sbjct  541  DNLNRGKLYNFYWLLAVLCLVNLVAYLVVARWYAYKEQRAAVD  583



>ref|XP_007157339.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
 gb|ESW29333.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
Length=586

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 77/102 (75%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMY GQLDFFL + PK MKTMSTGLFL+TLSLGFF S+ LVSVV K+   +HG + WLAD
Sbjct  473  FMYMGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFFSTLLVSVVNKM--TAHG-RPWLAD  529

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            N+N GRL  FYWLLA L  IN ++YL+C+ W+  ++ + A E
Sbjct  530  NLNKGRLYDFYWLLAILSAINVMLYLVCAKWYVYKEKRLAEE  571



>ref|XP_002303512.2| nitrate transporter family protein [Populus trichocarpa]
 gb|EEE78491.2| nitrate transporter family protein [Populus trichocarpa]
Length=583

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 75/102 (74%), Gaps = 4/102 (4%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT      + WLAD
Sbjct  473  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSSLVTIVHKVTI----NKPWLAD  528

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            N+N GRL  FYWLLA L  +NFV+YLIC+ W+  +  + A E
Sbjct  529  NLNQGRLHDFYWLLAILSALNFVIYLICARWYVYKDKRLADE  570



>gb|KHN34951.1| Nitrate transporter 1.1 [Glycine soja]
Length=586

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 77/102 (75%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMY GQL+FFL + PK MKTMSTGLFL+TLSLGFF S+ LVS+V K+   +HG + WLAD
Sbjct  473  FMYMGQLNFFLRECPKGMKTMSTGLFLSTLSLGFFFSTLLVSIVNKM--TAHG-RPWLAD  529

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            N+N GRL  FYWLLA L  IN V+YL+C+ W+  ++ + A E
Sbjct  530  NLNQGRLYDFYWLLAILSAINVVLYLVCAKWYVYKEKRLAEE  571



>ref|XP_008794846.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=606

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 62/109 (57%), Positives = 82/109 (75%), Gaps = 4/109 (4%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvt-SASHGGQDWLA  397
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT    HG   WL 
Sbjct  487  FTYVGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSVLVTIVHKVTGEGGHGA--WLT  544

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNK-SAVEMETVM  253
            D++N G+L  FYWLLA L ++NF VYL+ + W+ P++ + +A E+E+++
Sbjct  545  DDLNRGKLYNFYWLLAVLSLVNFGVYLVSAWWYVPKEGQAAAAEVESMV  593



>gb|KHN42706.1| Nitrate transporter 1.1 [Glycine soja]
Length=575

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 77/102 (75%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMY GQL+FFL + PK MKTMSTGLFL+TLSLGFF S+ LVS+V K+   +HG + WLAD
Sbjct  462  FMYMGQLNFFLRECPKGMKTMSTGLFLSTLSLGFFFSTLLVSIVNKM--TAHG-RPWLAD  518

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            N+N GRL  FYWLLA L  IN V+YL+C+ W+  ++ + A E
Sbjct  519  NLNQGRLYDFYWLLAILSAINVVLYLVCAKWYVYKEKRLADE  560



>ref|XP_003517427.1| PREDICTED: nitrate transporter 1.1-like [Glycine max]
Length=586

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 77/102 (75%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMY GQL+FFL + PK MKTMSTGLFL+TLSLGFF S+ LVS+V K+   +HG + WLAD
Sbjct  473  FMYMGQLNFFLRECPKGMKTMSTGLFLSTLSLGFFFSTLLVSIVNKM--TAHG-RPWLAD  529

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            N+N GRL  FYWLLA L  IN V+YL+C+ W+  ++ + A E
Sbjct  530  NLNQGRLYDFYWLLAILSAINVVLYLVCAKWYVYKEKRLADE  571



>ref|XP_004972811.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Setaria italica]
Length=595

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV+ V KVT   H    W+AD
Sbjct  486  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVTCVHKVTGDRHA---WIAD  542

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            ++N GRLD FYWLLA + ++N +VYL+ + W+K +  +   +
Sbjct  543  DLNKGRLDNFYWLLAVICLVNLLVYLVAARWYKYKAGRPGAD  584



>ref|XP_004972812.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Setaria italica]
Length=582

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV+ V KVT   H    W+AD
Sbjct  473  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVTCVHKVTGDRHA---WIAD  529

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            ++N GRLD FYWLLA + ++N +VYL+ + W+K +  +   +
Sbjct  530  DLNKGRLDNFYWLLAVICLVNLLVYLVAARWYKYKAGRPGAD  571



>ref|XP_002282012.3| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Vitis vinifera]
Length=587

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMY+GQL FF++++PK MK +S  LFLTT+S G+FV++ LV ++KK+T    GG  WLA 
Sbjct  468  FMYSGQLAFFISEAPKGMKAISNSLFLTTISFGYFVTTILVDLIKKITPGKDGGHGWLAP  527

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  232
             IN  RLD FY L++ L  IN  +YL+C+ W+KP  +++A + + V   + EEK
Sbjct  528  KINDSRLDYFYALISVLSFINLGLYLVCARWYKPNSSENAKDSD-VNASHDEEK  580



>emb|CBI28188.3| unnamed protein product [Vitis vinifera]
Length=585

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMY+GQL FF++++PK MK +S  LFLTT+S G+FV++ LV ++KK+T    GG  WLA 
Sbjct  466  FMYSGQLAFFISEAPKGMKAISNSLFLTTISFGYFVTTILVDLIKKITPGKDGGHGWLAP  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  232
             IN  RLD FY L++ L  IN  +YL+C+ W+KP  +++A + + V   + EEK
Sbjct  526  KINDSRLDYFYALISVLSFINLGLYLVCARWYKPNSSENAKDSD-VNASHDEEK  578



>ref|XP_009403461.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 83/116 (72%), Gaps = 2/116 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
             +YTGQLDFF+T+SPK MKTMSTGLFLTTLSLGFF+SSF+VS+VK VT     GQ WLAD
Sbjct  469  LIYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFFLSSFIVSIVKSVT-GGESGQGWLAD  527

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVM-NGNGEEKC  229
            NIN+GRLD FY LLA L  +N   +L C+ W KP      +EM +   N   E+KC
Sbjct  528  NINHGRLDYFYGLLAALSALNLAAFLYCATWIKPENAGDGLEMASAAKNSPAEDKC  583



>ref|XP_007013427.1| Major facilitator superfamily protein, putative [Theobroma cacao]
 gb|EOY31046.1| Major facilitator superfamily protein, putative [Theobroma cacao]
Length=583

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 64/114 (56%), Gaps = 1/114 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+Y GQLDFF+T+SP+ MK +       T        S ++  + +  + ++GG DWLA 
Sbjct  467  FIYAGQLDFFITESPRGMKAI-GTGLFLTTIALGLFGSSILVEIVRNVTETNGGHDWLAH  525

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  232
             IN GRLD FY LLA L +IN  ++L+C+  +KP   + A+     +N +   K
Sbjct  526  RINDGRLDYFYGLLAVLSLINLGLFLVCAKRYKPNHGEVALRTNDKVNVDVPPK  579



>ref|XP_004511669.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Cicer arietinum]
 ref|XP_004511670.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Cicer arietinum]
Length=593

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 77/109 (71%), Gaps = 6/109 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMY GQLDFFL + PK MKTMSTGLFL+TLSLGFF SS LV++V      +   + W+A+
Sbjct  481  FMYMGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFFSSLLVTIVNN---VTGPNKPWIAN  537

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA---VEMETV  256
            N+N GRL  FYWLLA L  IN V+YL C+ W+  ++N+ A   +E+E +
Sbjct  538  NLNQGRLYDFYWLLAMLSAINVVIYLACAKWYVYKENRLAEEGIELEEI  586



>emb|CAD32549.1| dicarboxylate transporter [Alnus glutinosa]
Length=583

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 76/113 (67%), Gaps = 4/113 (4%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMYTGQLDFF+T+SPK MK +STGLFLTT +LGFF SS LV+++ KVT     G  WL  
Sbjct  474  FMYTGQLDFFITESPKGMKAISTGLFLTTNALGFFGSSILVTIITKVT-GEEVGHGWLLS  532

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEE  235
             IN  RLD FY LLA LG IN V YL+ + W+KP   + A +    +NG  E+
Sbjct  533  RINDSRLDFFYALLAVLGFINLVFYLVLASWYKPSPVEDAHQK---INGKEEK  582



>ref|XP_003611284.1| Nitrate transporter [Medicago truncatula]
 gb|AES94242.1| peptide/nitrate transporter [Medicago truncatula]
Length=583

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 71/102 (70%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMY GQLDFFL + P  MKTMS GLFL++ SLGFF SS LVS V K+T  S   + W+AD
Sbjct  481  FMYMGQLDFFLRECPDGMKTMSMGLFLSSRSLGFFFSSLLVSTVNKITGPS---KPWIAD  537

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            N+N GRL+ +YWLLA L  IN ++YL C+ W+  +  K A E
Sbjct  538  NLNQGRLNYYYWLLAMLSAINLMIYLACAKWYVYKDKKVAEE  579



>ref|XP_002972328.1| hypothetical protein SELMODRAFT_97590 [Selaginella moellendorffii]
 gb|EFJ26414.1| hypothetical protein SELMODRAFT_97590 [Selaginella moellendorffii]
Length=585

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 40/96 (42%), Positives = 63/96 (66%), Gaps = 7/96 (7%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+  GQ++FF  QSP+SM++M+T +F   +  G + S+ +VS       A H   +W+ D
Sbjct  479  FLSIGQIEFFYDQSPESMRSMATAVFWMVIGGGSYCSTAMVS-------AVHAMTNWVPD  531

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            NIN GRLDLFYW+LAG+  +N  VYL+ + W++ ++
Sbjct  532  NINRGRLDLFYWMLAGILTVNLGVYLVVARWYRYKR  567



>gb|EMT14752.1| Peptide transporter PTR2 [Aegilops tauschii]
Length=582

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  417  GGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
            GGQ+WLA ++N GRLDLFYW++AG+GV NFV ++IC+ W++ +  + A
Sbjct  535  GGQNWLAQDLNKGRLDLFYWMIAGIGVFNFVYFMICARWYRFKGTRDA  582



>ref|XP_010264234.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nelumbo nucifera]
Length=593

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 78/107 (73%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKT+STGLFL+T+SLG F SSFLVS+V K+   +  G+ WL+D
Sbjct  482  FTYIGQLDFFLRECPKGMKTISTGLFLSTISLGLFFSSFLVSLVHKL---TGNGRPWLSD  538

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWF---KPRKNKSAVEME  262
            N+N G+L  FYWLLAGL ++NF +YL+C+ W+     R  +  +E+E
Sbjct  539  NLNQGKLYNFYWLLAGLSLLNFGLYLVCARWYVYKDTRLAQEGIELE  585



>ref|XP_002443879.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
 gb|EES13374.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
Length=601

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 58/102 (57%), Positives = 73/102 (72%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV+ V KVT   H    W+AD
Sbjct  488  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHKVTGDRH---PWIAD  544

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            ++N GRLD FYWLLA + + N +VYL+ + W+K +  +   +
Sbjct  545  DLNKGRLDNFYWLLAVICLANLLVYLVAARWYKYKAGRPGAD  586



>ref|XP_009411045.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=605

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 4/117 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSAS-HGGQDWLA  397
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LVSVV KVT  S HGG  WL 
Sbjct  488  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSVLVSVVHKVTGESGHGG--WLT  545

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGN-GEEKC  229
            DN+N G+L  FYWL+A L  +N V+YL+ + W+  ++ ++ V+ +++      EE C
Sbjct  546  DNLNRGKLYNFYWLVAVLSSVNLVLYLVAAKWYVYKEQRAVVDDDSMAGVELTEEAC  602



>ref|XP_002972498.1| hypothetical protein SELMODRAFT_97655 [Selaginella moellendorffii]
 gb|EFJ26584.1| hypothetical protein SELMODRAFT_97655 [Selaginella moellendorffii]
Length=585

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 39/96 (41%), Positives = 63/96 (66%), Gaps = 7/96 (7%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+  GQ++FF  QSP+SM++M+T +F   +  G + S+ +VS       A H   +W+ D
Sbjct  479  FLSIGQIEFFYDQSPESMRSMATAVFWMVIGGGNYCSTAMVS-------AVHARTNWVPD  531

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            NIN GRLDLFYW+LAG+  +N  VY++ + W++ ++
Sbjct  532  NINRGRLDLFYWMLAGILTVNLGVYMVVARWYRYKR  567



>ref|XP_002984329.1| hypothetical protein SELMODRAFT_119835 [Selaginella moellendorffii]
 gb|EFJ14839.1| hypothetical protein SELMODRAFT_119835 [Selaginella moellendorffii]
Length=585

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 39/96 (41%), Positives = 63/96 (66%), Gaps = 7/96 (7%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+  GQ++FF  QSP+SM++M+T +F   +  G + S+ +VS       A H   +W+ D
Sbjct  479  FLSIGQIEFFYDQSPESMRSMATAVFWMVIGGGNYCSTAMVS-------AVHARTNWVPD  531

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            NIN GRLDLFYW+LAG+  +N  VY++ + W++ ++
Sbjct  532  NINRGRLDLFYWMLAGILTVNLGVYMVVARWYRYKR  567



>ref|XP_002459192.1| hypothetical protein SORBIDRAFT_02g000260 [Sorghum bicolor]
 gb|EER95713.1| hypothetical protein SORBIDRAFT_02g000260 [Sorghum bicolor]
Length=585

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQ++FF  Q+P +M++M T L LT+ +LG ++S+ LVSVV  +T   +GG  W+ D
Sbjct  481  FTFIGQIEFFYDQAPDAMRSMGTALSLTSSALGSYLSALLVSVVTAIT-TRNGGLGWIPD  539

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETV  256
            N+N G LD F+WLL+ L VINFVVYL  + W++ ++  ++ E+ +V
Sbjct  540  NLNRGHLDYFFWLLSVLSVINFVVYLWIAKWYRYKQATTSYELSSV  585



>ref|XP_004490642.1| PREDICTED: peptide transporter PTR1-like [Cicer arietinum]
Length=570

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 56/96 (58%), Gaps = 1/96 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M+++                S L+  V    +  +GG  WL D
Sbjct  470  FTFIGQLEFFYEQAPDAMRSL-CSALSLLTVALGQYLSSLLVTVVTKVTTLNGGPGWLPD  528

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            N+NYGRLD F+WLLAGL V+NFV +L+ S ++  +K
Sbjct  529  NLNYGRLDCFFWLLAGLSVVNFVAFLVVSRFYTYKK  564



>dbj|BAC99394.1| putative nitrate transporter [Oryza sativa Japonica Group]
 gb|EAZ05635.1| hypothetical protein OsI_27853 [Oryza sativa Indica Group]
Length=603

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV+ V K+T   H    WLAD
Sbjct  490  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHKLTGDRH---PWLAD  546

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFK  295
            ++N G+L  FYWLLAG+ + N +VYL+ + W+K
Sbjct  547  DLNKGQLHKFYWLLAGVCLANLLVYLVAARWYK  579



>ref|XP_003611286.1| Nitrate transporter [Medicago truncatula]
 gb|AES94244.1| peptide/nitrate transporter [Medicago truncatula]
Length=591

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 75/109 (69%), Gaps = 6/109 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMY GQLDFFL + PK MKTMSTGLFL+TLS+GFF SS LV++V      +   + W+AD
Sbjct  479  FMYMGQLDFFLRECPKGMKTMSTGLFLSTLSIGFFFSSLLVTLVNN---VTGPNKPWIAD  535

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWF---KPRKNKSAVEMETV  256
            N++ GRL  FYWLLA L  IN V+YL C+ W+     R  ++ +E+E +
Sbjct  536  NLDQGRLYDFYWLLAMLSAINVVIYLACAKWYVYKDKRLAEAGIELEEI  584



>ref|XP_007155636.1| hypothetical protein PHAVU_003G218500g [Phaseolus vulgaris]
 gb|ESW27630.1| hypothetical protein PHAVU_003G218500g [Phaseolus vulgaris]
Length=450

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 76/107 (71%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF+SS LV++V K   A+   + WLAD
Sbjct  339  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFLSSMLVTLVHK---ATRHSEPWLAD  395

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  262
            N+N G+L  FYWLLA L  +N VVYL C+   ++   R  ++ +E+E
Sbjct  396  NLNEGKLHHFYWLLAVLSGVNLVVYLFCAKGYVYKDKRLAEAGIELE  442



>ref|NP_001145735.1| uncharacterized protein LOC100279242 [Zea mays]
 gb|ACL52487.1| unknown [Zea mays]
Length=608

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 73/102 (72%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV+ V +VT   H    W+A+
Sbjct  495  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHRVTGDRH---PWIAN  551

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            ++N GRLD FYWLLA + + N +VYL+ + W+K +  +   +
Sbjct  552  DLNKGRLDNFYWLLAAVCLANLLVYLVAARWYKYKAGRPGAD  593



>ref|XP_007155635.1| hypothetical protein PHAVU_003G218500g, partial [Phaseolus vulgaris]
 gb|ESW27629.1| hypothetical protein PHAVU_003G218500g, partial [Phaseolus vulgaris]
Length=620

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 76/107 (71%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF+SS LV++V K   A+   + WLAD
Sbjct  509  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFLSSMLVTLVHK---ATRHSEPWLAD  565

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  262
            N+N G+L  FYWLLA L  +N VVYL C+   ++   R  ++ +E+E
Sbjct  566  NLNEGKLHHFYWLLAVLSGVNLVVYLFCAKGYVYKDKRLAEAGIELE  612



>gb|AFW57313.1| hypothetical protein ZEAMMB73_359381 [Zea mays]
Length=608

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 73/102 (72%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV+ V +VT   H    W+A+
Sbjct  495  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHRVTGDRH---PWIAN  551

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            ++N GRLD FYWLLA + + N +VYL+ + W+K +  +   +
Sbjct  552  DLNKGRLDNFYWLLAAVCLANLLVYLVAARWYKYKAGRPGAD  593



>ref|XP_008808741.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=604

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 79/107 (74%), Gaps = 3/107 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSAS-HGGQDWLA  397
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT  S HG   WLA
Sbjct  486  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVTIVHKVTGESGHGA--WLA  543

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETV  256
            DN+N G+L  FYWLLA L ++N  VYL+ + W+  +  ++A E E++
Sbjct  544  DNLNRGKLYNFYWLLAVLCLVNLGVYLVAARWYVYKDGRAAAEDESM  590



>dbj|BAJ86984.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=598

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 46/96 (48%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M++M + L LTT++LG ++S+ LV+VV KVT+   G Q W+ D
Sbjct  489  FTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTLLVTVVAKVTTRG-GKQGWIPD  547

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            N+N G LD F+WLLA L ++NF VYL+ + W+  +K
Sbjct  548  NLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTYKK  583



>ref|XP_002443661.1| hypothetical protein SORBIDRAFT_08g023060 [Sorghum bicolor]
 gb|EES17499.1| hypothetical protein SORBIDRAFT_08g023060 [Sorghum bicolor]
Length=566

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 67/114 (59%), Gaps = 0/114 (0%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F   GQ+DF+  Q P++M++++  L     ++  + S  +V+VV   T  S G  DWLA 
Sbjct  450  FAVIGQVDFYYKQFPENMRSVAGALLFLGFAIASYASGLMVTVVHHTTGGSDGRPDWLAQ  509

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  232
            ++N GR+DLFY L+A +  +N V +++C+ W++ +K  +A ++E  + G     
Sbjct  510  DLNKGRVDLFYLLIAAMAAVNLVYFVVCARWYRFKKPAAAADVELELEGKAAAP  563



>ref|XP_011093558.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Sesamum indicum]
Length=571

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 74/102 (73%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
             +YTGQLDFFL++SPK MK +ST LFLTT+SLGFFVSS LV+++++    + G Q+WL  
Sbjct  470  LVYTGQLDFFLSESPKGMKAVSTSLFLTTISLGFFVSSALVAIIRR---VTEGRQNWLPA  526

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            N+N+GRLDLFY L+A L  IN   YL+ + WF  +K +   +
Sbjct  527  NLNHGRLDLFYGLIALLSAINLGFYLLSAKWFLCKKTQRQTQ  568



>ref|XP_003549905.1| PREDICTED: nitrate transporter 1.1-like [Glycine max]
Length=594

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF+SS LV++V K   A+   + WLAD
Sbjct  483  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFLSSLLVTLVHK---ATRHREPWLAD  539

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  262
            N+N+G+L  FYWLLA L  +N V YL C+   ++   R  ++ +E+E
Sbjct  540  NLNHGKLHYFYWLLALLSGVNLVAYLFCAKGYVYKDKRLAEAGIELE  586



>dbj|BAK08097.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  417  GGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
             GQ+WLA ++N GRLDLFYW++AG+GV NFV ++IC+ W++ +  + A
Sbjct  554  AGQNWLAQDLNKGRLDLFYWMIAGIGVFNFVYFMICARWYRFKGTRDA  601



>dbj|BAJ91141.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  417  GGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
             GQ+WLA ++N GRLDLFYW++AG+GV NFV ++IC+ W++ +  + A
Sbjct  554  AGQNWLAQDLNKGRLDLFYWMIAGIGVFNFVYFMICARWYRFKGTRDA  601



>dbj|BAJ94405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  417  GGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
             GQ+WLA ++N GRLDLFYW++AG+GV NFV ++IC+ W++ +  + A
Sbjct  554  AGQNWLAQDLNKGRLDLFYWMIAGIGVFNFVYFMICARWYRFKGTRDA  601



>dbj|BAJ96711.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  417  GGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
             GQ+WLA ++N GRLDLFYW++AG+GV NFV ++IC+ W++ +  + A
Sbjct  554  AGQNWLAQDLNKGRLDLFYWMIAGIGVFNFVYFMICARWYRFKGTRDA  601



>ref|XP_002992556.1| hypothetical protein SELMODRAFT_135528, partial [Selaginella 
moellendorffii]
 gb|EFJ06362.1| hypothetical protein SELMODRAFT_135528, partial [Selaginella 
moellendorffii]
Length=465

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 63/96 (66%), Gaps = 7/96 (7%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+  GQ++FF  QSP+SM++M+T +F   +  G + S+ +VS       A H   +W+ D
Sbjct  359  FLSIGQIEFFYDQSPESMRSMATAVFWMVIGGGNYCSTAMVS-------AVHARTNWVPD  411

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            NIN GRLDLFYW+LAG+  +N  VYL+ + W++ ++
Sbjct  412  NINRGRLDLFYWMLAGILTVNLGVYLVVARWYRYKR  447



>ref|XP_010228489.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Brachypodium distachyon]
Length=559

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F++ GQ+DFF  Q+P +M+++   L LT+ +LG ++S+ LV +V  V+   +GG  W+ D
Sbjct  449  FVFVGQIDFFYDQAPDAMRSLGAALSLTSAALGNYLSTLLVVIVTAVS-TRNGGIGWIPD  507

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
            N+N G LD F+WLLA L V+NFVVYL  + W+K +  K+A
Sbjct  508  NLNKGHLDYFFWLLAALSVLNFVVYLWIAKWYKYKVYKTA  547



>dbj|BAK03852.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=629

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 46/96 (48%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M++M + L LTT++LG ++S+ LV+VV KVT+   G Q W+ D
Sbjct  520  FTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTLLVTVVAKVTTRG-GKQGWIPD  578

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            N+N G LD F+WLLA L ++NF VYL+ + W+  +K
Sbjct  579  NLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTYKK  614



>ref|XP_008437115.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 6.3-like 
[Cucumis melo]
Length=591

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 76/107 (71%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TL+LG F SS LV++V K    +  G+ W+ D
Sbjct  481  FTYMGQLDFFLRECPKGMKTMSTGLFLSTLALGXFFSSLLVTIVGK---VTEHGKPWIPD  537

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  262
            N+N G+L  FYWLLA L V+N +V+L+C+ W+  ++ + A   +E+E
Sbjct  538  NLNEGKLYDFYWLLAVLSVLNLMVFLVCAKWYVYKEKRLADEGIELE  584



>ref|XP_008448872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Cucumis melo]
Length=593

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 75/100 (75%), Gaps = 4/100 (4%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF+SSFLV++V K+T    G + WLAD
Sbjct  483  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFLSSFLVTIVHKIT----GNKPWLAD  538

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
            N+N G+L  FYWLLA L  +NF +YL+C+ W+  +  + A
Sbjct  539  NLNQGKLYNFYWLLAILSTLNFGIYLVCAKWYVYKDKRLA  578



>ref|NP_001275529.1| nitrate transporter 1.1-like [Cucumis sativus]
 ref|XP_004163647.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 gb|ADQ74763.1| nitrate transporter 1.1 [Cucumis sativus]
 gb|KGN55889.1| hypothetical protein Csa_3G027720 [Cucumis sativus]
Length=593

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 4/100 (4%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF SSFLV++V K+T    G + WLAD
Sbjct  483  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFFSSFLVTIVHKIT----GNKPWLAD  538

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
            N+N G+L  FYWLLA L  +NF +YL+C+ W+  +  + A
Sbjct  539  NLNQGKLYDFYWLLAILSALNFGIYLVCAKWYVYKDKRLA  578



>gb|KHG27943.1| Uncharacterized protein F383_15837 [Gossypium arboreum]
Length=586

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 60/102 (59%), Positives = 72/102 (71%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT   H    WL D
Sbjct  476  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSVLVTIVHKVTGTKH---PWLPD  532

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            N+N GRL  FYWLLA L  +N V+YL+ + W+  +  + A E
Sbjct  533  NLNQGRLYDFYWLLAILSCLNLVIYLVFARWYVYKDKRLADE  574



>ref|XP_003573480.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=595

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 58/102 (57%), Positives = 72/102 (71%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LVS V K+T+     + W+AD
Sbjct  486  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVSAVHKLTAHR---RPWIAD  542

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            ++N G L  FYWLLAGL + N VVYL  + W+K +  +   +
Sbjct  543  DLNQGELHKFYWLLAGLCLANLVVYLFAARWYKYKAGRPGAD  584



>ref|XP_004972110.1| PREDICTED: peptide transporter PTR1-like [Setaria italica]
Length=584

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 47/105 (45%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQ++FF  Q+P +M++M T L LT+ +LG ++S+ LVSVV  VT   +GG  W+ D
Sbjct  481  FTFIGQIEFFYDQAPDAMRSMGTALSLTSSALGSYLSALLVSVVTAVT-TRNGGLGWIPD  539

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMET  259
            N+N G LD F+WLL+ L VINF+VYL+ + W+K ++  +     T
Sbjct  540  NLNRGHLDYFFWLLSLLSVINFLVYLLIAKWYKYKQPSTTAATST  584



>ref|XP_004147617.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 ref|XP_004171170.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 gb|KGN50229.1| hypothetical protein Csa_5G161290 [Cucumis sativus]
Length=591

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 77/107 (72%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TL+LGFF SS LV++V K    +  G+ W+ D
Sbjct  481  FTYMGQLDFFLRECPKGMKTMSTGLFLSTLALGFFFSSLLVTIVGK---VTEHGRPWIPD  537

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  262
            N+N G+L  FYWLLA L V+N +V+L+C+ W+  ++ + A   +E+E
Sbjct  538  NLNEGKLYDFYWLLAILSVLNLMVFLVCAKWYVYKEKRLADEGIELE  584



>dbj|BAG91755.1| unnamed protein product [Oryza sativa Japonica Group]
Length=453

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 3/115 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV+ V K+T   H    WLAD
Sbjct  340  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHKLTGDRH---PWLAD  396

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
            ++N G+L  FYWLLAG+ + N +VYL+ + W+K +  ++A   +  +     E C
Sbjct  397  DLNKGQLHKFYWLLAGVCLANLLVYLVAARWYKYKAGRAAAAGDGGVEMADAEPC  451



>emb|CCN27389.1| low affinity nitrate transporter, partial [Triticum aestivum]
Length=139

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQD-WLA  397
            F + G L+FF  QSP +M+++ + L L T +LG ++S+F++++V      + GG+  W+ 
Sbjct  43   FTFIGALEFFYDQSPGAMRSLCSALQLITTALGNYLSAFILTMVAYF--TTRGGRPGWIP  100

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            DN+N GRLD F+WLLAGL  +NF+VY++C+  FK +K
Sbjct  101  DNLNEGRLDYFFWLLAGLSFLNFLVYVLCANRFKSKK  137



>gb|ACR34962.1| unknown [Zea mays]
Length=568

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 73/102 (72%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV+ V +VT   H    W+A+
Sbjct  455  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHRVTGDRH---PWIAN  511

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            ++N GRLD FYWLLA + + N +VYL+ + W+K +  +   +
Sbjct  512  DLNKGRLDNFYWLLAAVCLANLLVYLVAARWYKYKAGRPGAD  553



>gb|AAL16907.1|AF420016_1 putative low-affinity nitrate transporter [Narcissus pseudonarcissus]
Length=123

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTG+FL+TLSLGFF+SS LV++V KVT  S  G  WL D
Sbjct  21   FCYIGQLDFFLRECPKGMKTMSTGMFLSTLSLGFFLSSALVTIVHKVTGESGQGA-WLPD  79

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            ++N G+L  FYWLLA L  +N V +L+ + W+  ++N+ A +
Sbjct  80   DLNRGKLYDFYWLLAVLSAVNLVAFLVSARWYVYKENRMATD  121



>ref|XP_010941437.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Elaeis guineensis]
Length=589

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 55/92 (60%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TL+LGFFVSS LV++V  VT  S G   WLA+
Sbjct  467  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLALGFFVSSGLVAIVHLVTGESGGHGAWLAN  526

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWF  298
            ++N G+L  FYWLLA L ++NF VY++ + W+
Sbjct  527  DLNRGKLYNFYWLLAVLSLVNFGVYVLSARWY  558



>ref|NP_001061020.1| Os08g0155400 [Oryza sativa Japonica Group]
 dbj|BAF22934.1| Os08g0155400, partial [Oryza sativa Japonica Group]
Length=525

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 3/115 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV+ V K+T   H    WLAD
Sbjct  412  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVAAVHKLTGDRH---PWLAD  468

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEKC  229
            ++N G+L  FYWLLAG+ + N +VYL+ + W+K +  ++A   +  +     E C
Sbjct  469  DLNKGQLHKFYWLLAGVCLANLLVYLVAARWYKYKAGRAAAAGDGGVEMADAEPC  523



>ref|XP_006643742.1| PREDICTED: peptide transporter PTR1-like [Oryza brachyantha]
Length=582

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 45/100 (45%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M++M + L LTT++LG ++S+ LV++V  VT   +G   W+ D
Sbjct  472  FTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTLLVTIVTHVT-TKNGAVGWIPD  530

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
            N+N G LD F+WLLA L +INFVVYL+ + W+  +K   +
Sbjct  531  NLNRGHLDYFFWLLAVLSLINFVVYLVIASWYTYKKTADS  570



>emb|CCN27378.1| low affinity nitrate transporter, partial [Triticum aestivum]
Length=161

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 73/107 (68%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQD-WLA  397
            F Y GQLDFFL + PK MKTMSTGLFL+T +LGFF S+ +V++V KV    HG  D WLA
Sbjct  47   FTYMGQLDFFLRECPKGMKTMSTGLFLSTCALGFFFSTLIVTIVHKV--TGHGSNDGWLA  104

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEM  265
            +NI+ GRLD FYWLLA +  IN V + I +   ++ + R   + +E+
Sbjct  105  NNIDQGRLDYFYWLLAVMSAINIVFFTIAARGYVYKEKRMADAGIEL  151



>gb|ACF22756.1| nitrate transporter [Brachypodium distachyon]
Length=609

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + P  MKTMSTGLFLTTLSLGFF+S+ LV+ V   T +  GG+ WLAD
Sbjct  496  FAYVGQLDFFLRECPADMKTMSTGLFLTTLSLGFFLSTALVTAVHAATGS--GGRPWLAD  553

Query  393  NINYGRLDLFYWLLAGLGVINFVVYL  316
            +I+ GRLD FYWLLA L V+N  V++
Sbjct  554  DIDQGRLDYFYWLLAVLSVLNLAVFV  579



>ref|XP_010906610.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Elaeis 
guineensis]
Length=539

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSAS-HGGQDWLA  397
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT  S HG   WLA
Sbjct  422  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVTIVHKVTGKSGHGA--WLA  479

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            DN+N G+L  FYWLLA L ++N  +YL+ + W+  ++ ++A E
Sbjct  480  DNLNRGKLYNFYWLLAVLCLVNLGLYLVAAKWYVYKEGRTAAE  522



>ref|XP_011081220.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Sesamum indicum]
Length=594

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 58/100 (58%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT      + WLAD
Sbjct  484  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSILVAIVHKVTGEK---KPWLAD  540

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
            N+N GRL  FYWLL  L ++N  V+L+ + W+  ++N+ A
Sbjct  541  NLNEGRLYNFYWLLTILSILNLAVFLVSARWYVYKENRLA  580



>ref|XP_010906609.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Elaeis 
guineensis]
Length=603

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSAS-HGGQDWLA  397
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT  S HG   WLA
Sbjct  486  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVTIVHKVTGKSGHGA--WLA  543

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            DN+N G+L  FYWLLA L ++N  +YL+ + W+  ++ ++A E
Sbjct  544  DNLNRGKLYNFYWLLAVLCLVNLGLYLVAAKWYVYKEGRTAAE  586



>emb|CDM81075.1| unnamed protein product [Triticum aestivum]
Length=545

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M++M + L LTT++LG ++S+ LV+VV K+T+   G Q W+ D
Sbjct  434  FTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTLLVTVVAKLTTRG-GKQGWIPD  492

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEE  235
            N+N G LD F+WLLA L ++NF VYL+ + W+  +K       + +  G   +
Sbjct  493  NLNVGHLDYFFWLLAALSLLNFAVYLLIASWYTYKKTAGDDHPDAIAKGGAHD  545



>ref|XP_004149470.1| PREDICTED: peptide transporter PTR2-like [Cucumis sativus]
 ref|XP_004170470.1| PREDICTED: peptide transporter PTR2-like [Cucumis sativus]
 gb|KGN49752.1| hypothetical protein Csa_5G106020 [Cucumis sativus]
Length=586

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  QSP +M+++ + L L T +LG ++SSF++++V  +T   +G   W+ D
Sbjct  488  FTFIGQLEFFYDQSPDAMRSLCSALSLLTTALGNYLSSFILTIVTYLT-TRNGQSGWIPD  546

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            N+N G LDLF+WLLAGL  +N +VY +C+  ++P+K
Sbjct  547  NLNEGHLDLFFWLLAGLSFLNLLVYTVCAKRYRPKK  582



>gb|EAZ16929.1| hypothetical protein OsJ_32411 [Oryza sativa Japonica Group]
Length=574

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+T ++GFF S+ LV++V KVT     G  WLAD
Sbjct  459  FTYMGQLDFFLRECPKGMKTMSTGLFLSTCAIGFFFSTLLVTIVHKVTGHGARGGGWLAD  518

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEM---ETVMNGN  244
            N++ GRLD FYWLLA +  IN V++ + +   ++ + R   + +E+   ET+  G+
Sbjct  519  NLDDGRLDYFYWLLAVISAINLVLFTVAARGYVYKEKRLADAGIELADEETIAVGH  574



>ref|XP_010533775.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Tarenaya hassleriana]
Length=642

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
             +YTGQLDFFL + PK MKTMS GL L+TL+LGFF SS LV++V KVT  +H    W+AD
Sbjct  529  LLYTGQLDFFLRECPKGMKTMSAGLLLSTLALGFFFSSVLVTIVHKVTGTTHA---WIAD  585

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
            N+N GRL  FYWL++ L  +NF+V+L+ S W+  +  + A
Sbjct  586  NLNKGRLYNFYWLVSVLCALNFIVFLVFSKWYVYKDKRLA  625



>gb|ABB47972.1| Nitrate/chlorate transporter, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG90898.1| unnamed protein product [Oryza sativa Japonica Group]
Length=596

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+T ++GFF S+ LV++V KVT     G  WLAD
Sbjct  481  FTYMGQLDFFLRECPKGMKTMSTGLFLSTCAIGFFFSTLLVTIVHKVTGHGARGGGWLAD  540

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEM---ETVMNGN  244
            N++ GRLD FYWLLA +  IN V++ + +   ++ + R   + +E+   ET+  G+
Sbjct  541  NLDDGRLDYFYWLLAVISAINLVLFTVAARGYVYKEKRLADAGIELADEETIAVGH  596



>gb|AAK15441.1|AC037426_3 putative nitrate transporter [Oryza sativa Japonica Group]
Length=594

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+T ++GFF S+ LV++V KVT     G  WLAD
Sbjct  479  FTYMGQLDFFLRECPKGMKTMSTGLFLSTCAIGFFFSTLLVTIVHKVTGHGARGGGWLAD  538

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEM---ETVMNGN  244
            N++ GRLD FYWLLA +  IN V++ + +   ++ + R   + +E+   ET+  G+
Sbjct  539  NLDDGRLDYFYWLLAVISAINLVLFTVAARGYVYKEKRLADAGIELADEETIAVGH  594



>ref|XP_010053448.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Eucalyptus grandis]
 gb|KCW77743.1| hypothetical protein EUGRSUZ_D02037 [Eucalyptus grandis]
Length=593

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 76/107 (71%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF SS LV+VV K    +   + WLA+
Sbjct  482  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFFSSLLVTVVHK---VTGNKKPWLAN  538

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  262
            N+N G+L  FYWLLA L  +NF+++L+C+ W+  +  + A   +E+E
Sbjct  539  NLNQGKLHDFYWLLAILSALNFLIFLVCAKWYVYKDKRLADEGIELE  585



>gb|EAY88182.1| hypothetical protein OsI_09629 [Oryza sativa Indica Group]
Length=589

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF S+ LV+VV KVT+ S   + WLAD
Sbjct  484  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFFSTALVTVVHKVTAESR--RPWLAD  541

Query  393  NINYGRLDLFYWLLAGLGVINFVVYL  316
            N++ GRLD FYWLL G+ V+N  V++
Sbjct  542  NLDEGRLDNFYWLLGGISVVNLAVFV  567



>ref|XP_004968169.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Setaria 
italica]
 ref|XP_004968170.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Setaria 
italica]
 ref|XP_004968171.1| PREDICTED: peptide transporter PTR1-like isoform X3 [Setaria 
italica]
 ref|XP_004968172.1| PREDICTED: peptide transporter PTR1-like isoform X4 [Setaria 
italica]
Length=578

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M+++ + L LTT++LG ++S+ LV++V ++T   HG   W+ D
Sbjct  469  FTFVGQLEFFYDQAPDAMRSLCSALSLTTVALGNYLSTVLVTIVTRIT-TRHGKLGWIPD  527

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKN  283
            N+N G LD F+WLLA L ++NF+VYL+ + W+K +K 
Sbjct  528  NLNLGHLDYFFWLLAVLSLLNFLVYLVIASWYKYKKT  564



>dbj|BAJ91595.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91627.1| predicted protein, partial [Hordeum vulgare subsp. vulgare]
Length=402

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M++M + L LTT++LG ++S+ LV+VV KVT+   G Q W+ D
Sbjct  293  FTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTLLVTVVAKVTTRG-GKQGWIPD  351

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKN  283
            N+N G LD F+WLLA L ++NF VYL+ + W+  +K 
Sbjct  352  NLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTYKKT  388



>gb|KHN09796.1| Nitrate transporter 1.1 [Glycine soja]
Length=593

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 7/107 (7%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF+SS LV++V K T      + WLAD
Sbjct  483  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFLSSLLVTLVHKATRR----EPWLAD  538

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  262
            N+N+G+L  FYWLLA L  +N V YL C+   ++   R  ++ +E+E
Sbjct  539  NLNHGKLHYFYWLLALLSGVNLVAYLFCAKGYVYKDKRLAEAGIELE  585



>gb|ABF93501.1| Nitrate/chlorate transporter, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH01124.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64490.1| hypothetical protein OsJ_19340 [Oryza sativa Japonica Group]
Length=589

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF S+ LV+VV KVT+ S   + WLAD
Sbjct  484  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFFSTALVTVVHKVTAESR--RPWLAD  541

Query  393  NINYGRLDLFYWLLAGLGVINFVVYL  316
            N++ GRLD FYWLL G+ V+N  V++
Sbjct  542  NLDEGRLDNFYWLLGGISVVNLAVFV  567



>dbj|BAJ91042.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  417  GGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
             GQ+WLA ++N GRLDLFYW++AG+GV NFV ++IC+ W++ +  + A
Sbjct  419  AGQNWLAQDLNKGRLDLFYWMIAGIGVFNFVYFMICARWYRFKGTRDA  466



>gb|EEC67416.1| hypothetical protein OsI_34598 [Oryza sativa Indica Group]
Length=568

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+T ++GFF S+ LV++V KVT     G  WLAD
Sbjct  453  FTYMGQLDFFLRECPKGMKTMSTGLFLSTCAIGFFFSTLLVTIVHKVTGHGARGGGWLAD  512

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEM---ETVMNGN  244
            N++ GRLD FYWLLA +  IN V++ + +   ++ + R   + +E+   ET+  G+
Sbjct  513  NLDDGRLDYFYWLLAVISAINLVLFTVAARGYVYKEKRLADAGIELADEETIAVGH  568



>gb|EYU41851.1| hypothetical protein MIMGU_mgv1a020985mg [Erythranthe guttata]
Length=576

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M+++       T +      S L+  +    S  +GG  W+ D
Sbjct  476  FTFIGQLEFFYEQAPDAMRSL-CSALSLTTAAFGNYLSTLLVSIVVHVSTRNGGPGWIPD  534

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            N+NYGRLD F+WLLA L V N  VYL+ + W+  +K
Sbjct  535  NLNYGRLDYFFWLLAVLSVFNLGVYLLVAKWYTYKK  570



>ref|XP_009613364.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
Length=592

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 77/107 (72%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLF++T+SLGFF SS LV++V KVT  +   + WLAD
Sbjct  482  FTYIGQLDFFLRECPKGMKTMSTGLFISTISLGFFFSSILVTIVDKVTGKT---KPWLAD  538

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  262
            N+N G+L  FYWLLA L V+N +V+L CS   ++ + R  +  +EME
Sbjct  539  NLNKGKLYDFYWLLAILSVLNLMVFLFCSRRYVYKEKRLAEVGIEME  585



>ref|NP_001065341.2| Os10g0554200 [Oryza sativa Japonica Group]
 dbj|BAF27178.2| Os10g0554200, partial [Oryza sativa Japonica Group]
Length=465

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+T ++GFF S+ LV++V KVT     G  WLAD
Sbjct  350  FTYMGQLDFFLRECPKGMKTMSTGLFLSTCAIGFFFSTLLVTIVHKVTGHGARGGGWLAD  409

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEM---ETVMNGN  244
            N++ GRLD FYWLLA +  IN V++ + +   ++ + R   + +E+   ET+  G+
Sbjct  410  NLDDGRLDYFYWLLAVISAINLVLFTVAARGYVYKEKRLADAGIELADEETIAVGH  465



>ref|XP_003562233.2| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Brachypodium distachyon]
Length=551

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + P  MKTMSTGLFLTTLSLGFF+S+ LV+ V   T    GG+ WLAD
Sbjct  438  FAYVGQLDFFLRECPADMKTMSTGLFLTTLSLGFFLSTALVTAVHAAT--GSGGRPWLAD  495

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS  307
            +I+ GRLD FYWLLA L V+N  V++  +
Sbjct  496  DIDQGRLDYFYWLLAVLSVLNLAVFVAAA  524



>gb|AAC32034.1| peptide transporter [Hordeum vulgare subsp. vulgare]
Length=579

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M++M + L LTT++LG ++S+ LV+VV KVT+   G Q W+ D
Sbjct  470  FTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTLLVTVVAKVTTRG-GKQGWIPD  528

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKN  283
            N+N G LD F+WLLA L ++NF VYL+ + W+  +K 
Sbjct  529  NLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTYKKT  565



>dbj|BAJ95903.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89261.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=579

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M++M + L LTT++LG ++S+ LV+VV KVT    G Q W+ D
Sbjct  470  FTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTLLVTVVAKVT-TRGGKQGWIPD  528

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKN  283
            N+N G LD F+WLLA L ++NF VYL+ + W+  +K 
Sbjct  529  NLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTYKKT  565



>ref|XP_002970258.1| hypothetical protein SELMODRAFT_231570 [Selaginella moellendorffii]
 gb|EFJ28388.1| hypothetical protein SELMODRAFT_231570 [Selaginella moellendorffii]
Length=573

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 5/95 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F   G LDFF T+SP++M+ M   L   + S G+F+SS +VS+V      +    DWL +
Sbjct  467  FTVAGLLDFFYTESPENMRAMGISLVNVSFSFGYFLSSVIVSLVN-----ARTKPDWLPE  521

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPR  289
            N+N GRL  FYWLLA +G INFV YL  S W++PR
Sbjct  522  NMNRGRLHSFYWLLAAMGAINFVNYLFWSWWYRPR  556



>ref|XP_002978416.1| hypothetical protein SELMODRAFT_418286 [Selaginella moellendorffii]
 gb|EFJ20402.1| hypothetical protein SELMODRAFT_418286 [Selaginella moellendorffii]
Length=524

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 5/95 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F   G LDFF T+SP++M+ M   L   + S G+F+SS +VS+V      +    DWL +
Sbjct  418  FTVAGLLDFFYTESPENMRAMGISLVNVSFSFGYFLSSVIVSLVN-----ARTKPDWLPE  472

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPR  289
            N+N GRL  FYWLLA +G INFV YL  S W++PR
Sbjct  473  NMNRGRLHSFYWLLAAMGAINFVNYLFWSWWYRPR  507



>gb|EMT10378.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=603

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 72/102 (71%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV+VV K+   +   + W+AD
Sbjct  489  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVTVVHKI---TGDRRPWIAD  545

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            ++N G L  FYWLLAG+ + N VVYL  + W+K +  +   +
Sbjct  546  DLNKGELYKFYWLLAGVCLANLVVYLFAARWYKYKAGRPGAD  587



>ref|XP_009611019.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
 dbj|BAC56914.1| nitrate transporter [Nicotiana tabacum]
Length=590

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 78/118 (66%), Gaps = 12/118 (10%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF SS LV++V KVT    G   WLAD
Sbjct  481  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFFSSILVTIVHKVT----GKNPWLAD  536

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEMETVMNGNGEEKC  229
            N+N GRL  FYWLLA L V+N +++L  S   ++ + R  +  +EME     + E  C
Sbjct  537  NLNQGRLYDFYWLLATLSVLNLMIFLFISRRYVYKEKRLAECGIEME-----DSEPAC  589



>dbj|BAJ90348.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02884.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92452.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 72/102 (71%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV+VV K+   +   + W+AD
Sbjct  489  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSALVTVVHKI---TGDRRPWIAD  545

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            ++N G L  FYWLLAG+ + N VVYL  + W+K +  +   +
Sbjct  546  DLNKGELYKFYWLLAGVCLANLVVYLFAARWYKYKAGRPGAD  587



>ref|XP_008466783.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 isoform X2 [Cucumis melo]
Length=586

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  QSP +M+++ + L L T +LG ++SSF++++V  +T   +G   W+ D
Sbjct  488  FTFIGQLEFFYDQSPDAMRSLCSALSLLTTALGNYLSSFILTIVTYLT-TRNGQSGWIPD  546

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            N+N G LD F+WLLAGL  +N +VY +C+  ++P+K
Sbjct  547  NLNEGHLDFFFWLLAGLSFLNLLVYTVCAKRYRPKK  582



>ref|XP_008367055.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Malus domestica]
Length=154

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  QSP +M+++ + L L T SLG ++SS ++++V   +    G   W+ D
Sbjct  58   FTFIGQLEFFYDQSPDAMRSLCSALSLLTNSLGNYLSSLILTIVTYFS-TKDGKAGWIPD  116

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            N+N G LD F+WLLAGL ++N +VY++C+  +K +K
Sbjct  117  NLNEGHLDYFFWLLAGLSLLNMLVYVVCAKRYKKKK  152



>emb|CCN27377.1| low affinity nitrate transporter, partial [Triticum aestivum]
Length=161

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 63/107 (59%), Gaps = 4/107 (4%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglfltt-lslgffvssflvsvvkkvtSASHGGQDWLA  397
            F Y GQLDFFL + PK MKTMSTGLFL+T     FF +  +  V K       G   WLA
Sbjct  45   FTYMGQLDFFLRECPKGMKTMSTGLFLSTCALGFFFSTVIVTIVHKVTGHGPRGTGGWLA  104

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEM  265
            DN++ GRLD FYWLLA +  IN V + I +   ++ + R   + +E+
Sbjct  105  DNLDQGRLDYFYWLLAVMSAINIVFFTIAARGYVYKEKRLADAGIEL  151



>ref|XP_008466778.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3 isoform X1 [Cucumis melo]
Length=587

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  QSP +M+++ + L L T +LG ++SSF++++V  +T   +G   W+ D
Sbjct  489  FTFIGQLEFFYDQSPDAMRSLCSALSLLTTALGNYLSSFILTIVTYLT-TRNGQSGWIPD  547

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            N+N G LD F+WLLAGL  +N +VY +C+  ++P+K
Sbjct  548  NLNEGHLDFFFWLLAGLSFLNLLVYTVCAKRYRPKK  583



>gb|EMT28633.1| Peptide transporter PTR5 [Aegilops tauschii]
Length=488

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M++M + L LTT++LG ++S+ LV+VV K+T    G Q W+ D
Sbjct  374  FTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTLLVTVVAKLT-TRGGKQGWIPD  432

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKN  283
            N+N G LD F+WLLA L ++NF VYL+ + W+  +K 
Sbjct  433  NLNVGHLDYFFWLLAALSLLNFAVYLLIASWYTYKKT  469



>ref|XP_010937011.1| PREDICTED: protein NRT1/ PTR FAMILY 8.3-like [Elaeis guineensis]
Length=587

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 67/97 (69%), Gaps = 3/97 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQD-WLA  397
            F + GQL+FF  QSP +M+++ + L L T +LG ++SS ++++V  +   + GG+  W+ 
Sbjct  491  FTFIGQLEFFYDQSPDAMRSLCSALSLLTTALGNYLSSLILTIVTYI--TTRGGKTGWIP  548

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            DN+N G LD F+WLLAGL  +NF+VY  C+I +K +K
Sbjct  549  DNLNEGHLDYFFWLLAGLSFLNFLVYAFCAIKYKSKK  585



>gb|AAA80582.1| RCH2 protein [Brassica napus]
Length=589

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
             +YTGQLDFFL + PK MKTMSTGL L+TL+LGFF SS LV++V+KVT  +H    W+AD
Sbjct  477  LIYTGQLDFFLRECPKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKVTDKAH---PWIAD  533

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  262
            ++N GRL  FYWL+A +  +NF+V+L+ S W+  ++ + A   +E+E
Sbjct  534  DLNKGRLYNFYWLVAVIVALNFLVFLVFSKWYVYKEKRLADLGIELE  580



>ref|XP_004963332.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like 
[Setaria italica]
Length=597

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 68/112 (61%), Gaps = 1/112 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F   GQ+DF+  Q P++M++++  +     ++  + S  +V+VV + T    G  DWLA 
Sbjct  476  FAVIGQVDFYYKQFPENMRSVAGAVLSLGFAIASYASGLMVTVVNQRTGGRDGRPDWLAQ  535

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGE  238
            ++N GRLDL+Y L+A +  +N V ++ C+ W++ +K+ + + +  V+ GN +
Sbjct  536  DLNQGRLDLYYLLIAAMAAVNLVYFVACARWYRFKKSDAGIAV-VVLQGNND  586



>ref|XP_011028221.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X2 [Populus 
euphratica]
Length=594

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 75/114 (66%), Gaps = 7/114 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMY GQL+FF  Q+P  +K+  + L +T++SLG +VSS LV++V K+++  H    W+  
Sbjct  484  FMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVVKISTEDHM-PGWIPG  542

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  232
            N+N G LD FY+LLAGL  I+FVVY+ C+ W+K      ++++E     NG E+
Sbjct  543  NLNAGHLDRFYFLLAGLTTIDFVVYMACARWYK------SIKLEKKCEENGHEE  590



>gb|AEA35415.1| nitrate transporter [Brassica rapa subsp. chinensis]
Length=589

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
             +YTGQLDFFL + PK MKTMSTGL L+TL+LGFF SS LV++V+KVT  +H    W+AD
Sbjct  477  LIYTGQLDFFLRECPKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKVTDKAH---PWIAD  533

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  262
            ++N GRL  FYWL+A +  +NF+V+L+ S W+  ++ + A   +E+E
Sbjct  534  DLNKGRLYNFYWLVAVIVALNFLVFLVFSKWYVYKEKRLADLGIELE  580



>emb|CAC07206.1| nitrate transporter [Brassica napus]
Length=588

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
             +YTGQLDFFL + PK MKTMSTGL L+TL+LGFF SS LV++V+KVT  +H    W+AD
Sbjct  476  LIYTGQLDFFLRECPKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKVTDKAH---PWIAD  532

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  262
            ++N GRL  FYWL+A +  +NF+V+L+ S W+  ++ + A   +E+E
Sbjct  533  DLNKGRLYNFYWLVAVIVALNFLVFLVFSKWYVYKEKRLADLGIELE  579



>gb|EMS66817.1| Peptide transporter PTR5 [Triticum urartu]
Length=482

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M++M + L LTT++LG ++S+ LV+VV K+T    G Q W+ D
Sbjct  372  FTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTLLVTVVAKLT-TRGGKQGWIPD  430

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKN  283
            N+N G LD F+WLLA L ++NF VYL+ + W+  +K 
Sbjct  431  NLNVGHLDYFFWLLAALSLLNFAVYLLIASWYTYKKT  467



>emb|CDY26539.1| BnaA09g47380D [Brassica napus]
Length=574

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
             +YTGQLDFFL + PK MKTMSTGL L+TL+LGFF SS LV++V+KVT  +H    W+AD
Sbjct  462  LIYTGQLDFFLRECPKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKVTDKAH---PWIAD  518

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  262
            ++N GRL  FYWL+A +  +NF+V+L+ S W+  ++ + A   +E+E
Sbjct  519  DLNKGRLYNFYWLVAVIVALNFLVFLVFSKWYVYKEKRLADLGIELE  565



>ref|XP_011028220.1| PREDICTED: protein NRT1/ PTR FAMILY 7.3-like isoform X1 [Populus 
euphratica]
Length=598

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 75/114 (66%), Gaps = 7/114 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMY GQL+FF  Q+P  +K+  + L +T++SLG +VSS LV++V K+++  H    W+  
Sbjct  488  FMYVGQLEFFNAQTPDGLKSFGSALCMTSISLGNYVSSLLVTMVVKISTEDHM-PGWIPG  546

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVEMETVMNGNGEEK  232
            N+N G LD FY+LLAGL  I+FVVY+ C+ W+K      ++++E     NG E+
Sbjct  547  NLNAGHLDRFYFLLAGLTTIDFVVYMACARWYK------SIKLEKKCEENGHEE  594



>ref|XP_009118113.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brassica rapa]
Length=589

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
             +YTGQLDFFL + PK MKTMSTGL L+TL+LGFF SS LV++V+KVT  +H    W+AD
Sbjct  477  LIYTGQLDFFLRECPKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKVTDKAH---PWIAD  533

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  262
            ++N GRL  FYWL+A +  +NF+V+L+ S W+  ++ + A   +E+E
Sbjct  534  DLNKGRLYNFYWLVAVIVALNFLVFLVFSKWYVYKEKRLADLGIELE  580



>ref|XP_006440345.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
 gb|ESR53585.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
Length=448

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 71/100 (71%), Gaps = 3/100 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LVS+V K    +   + WLAD
Sbjct  338  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSLLVSLVHK---VTGDKKPWLAD  394

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
            N+N GRL  FYWLLA L  +NFV+YL  + W+  +  + A
Sbjct  395  NLNQGRLYDFYWLLAILSALNFVIYLAFARWYVYKDKRLA  434



>emb|CDY15967.1| BnaC08g41560D [Brassica napus]
Length=574

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
             +YTGQLDFFL + PK MKTMSTGL L+TL+LGFF SS LV++V+KVT  +H    W+AD
Sbjct  462  LIYTGQLDFFLRECPKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKVTDKAH---PWIAD  518

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  262
            ++N GRL  FYWL+A +  +NF+V+L+ S W+  ++ + A   +E+E
Sbjct  519  DLNKGRLYNFYWLVAIIVALNFLVFLVFSKWYVYKEKRLADLGIELE  565



>gb|KFK43476.1| hypothetical protein AALP_AA1G129900 [Arabis alpina]
Length=591

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 77/107 (72%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
             +YTGQLDFFL + PK MKTMSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD
Sbjct  478  LIYTGQLDFFLRECPKGMKTMSTGLLLSTLALGFFFSSVLVTIVEKFTGTTH---PWIAD  534

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  262
            ++N GRL  FYWL+A L  +NF+++L+ S W+  +  + A   +E+E
Sbjct  535  DLNKGRLYNFYWLVAVLVALNFLIFLVFSKWYVYKDKRLAEVGIELE  581



>ref|XP_003575234.1| PREDICTED: protein NRT1/ PTR FAMILY 6.4 [Brachypodium distachyon]
Length=598

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 55/101 (54%), Positives = 76/101 (75%), Gaps = 5/101 (5%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQL+FF+ ++P+ MK+MSTGLFL TLS+GFF+SSFLV VV  VT  +     WL +
Sbjct  473  FAYVGQLEFFIREAPERMKSMSTGLFLVTLSMGFFLSSFLVFVVDAVTRGA-----WLPN  527

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAV  271
            +++ GRLDLFYW+LA LGV+NFVV+L+ +   + + + SAV
Sbjct  528  DLDAGRLDLFYWMLALLGVVNFVVFLVIARGHEYKPSTSAV  568



>ref|XP_010476167.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Camelina sativa]
Length=589

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 77/107 (72%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
             +YTGQLDFFL + PK MK MSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD
Sbjct  477  LIYTGQLDFFLRECPKGMKGMSTGLLLSTLALGFFFSSVLVTIVEKFTGTAH---PWIAD  533

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWF---KPRKNKSAVEME  262
            ++N GRL  FYWL+A L  INF+++L+ S W+   + R  ++ +EM+
Sbjct  534  DLNKGRLYNFYWLVAVLVAINFLIFLVFSKWYVYKEKRLAEAGIEMD  580



>gb|KDO61483.1| hypothetical protein CISIN_1g007736mg [Citrus sinensis]
Length=591

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 71/100 (71%), Gaps = 3/100 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LVS+V K    +   + WLAD
Sbjct  481  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSLLVSLVHK---VTGDKKPWLAD  537

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
            N+N GRL  FYWLLA L  +NFV+YL  + W+  +  + A
Sbjct  538  NLNQGRLYDFYWLLAILSALNFVIYLAFARWYVYKDKRLA  577



>gb|EMS68423.1| Peptide transporter PTR2 [Triticum urartu]
Length=583

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQD-WLA  397
            F + G L+FF  QSP +M+++ + L L T +LG ++S+F++++V      + GG+  W+ 
Sbjct  487  FTFIGALEFFYDQSPDAMRSLCSALQLITTALGNYLSAFILTMVAYF--TTRGGRPGWIP  544

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            DN+N GRLD F+WLLAGL  +NF+VY++C+  FK +K
Sbjct  545  DNLNEGRLDYFFWLLAGLSFLNFLVYVLCANRFKSKK  581



>ref|XP_006440344.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
 gb|ESR53584.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
Length=591

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 71/100 (71%), Gaps = 3/100 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LVS+V K    +   + WLAD
Sbjct  481  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSLLVSLVHK---VTGDKKPWLAD  537

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
            N+N GRL  FYWLLA L  +NFV+YL  + W+  +  + A
Sbjct  538  NLNQGRLYDFYWLLAILSALNFVIYLAFARWYVYKDKRLA  577



>ref|XP_006477230.1| PREDICTED: nitrate transporter 1.1-like [Citrus sinensis]
Length=591

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LVS+V KVT      + WLAD
Sbjct  481  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSLLVSLVHKVTGVK---KPWLAD  537

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
            N+N GRL  FYWLLA L  +NFV+YL  + W+  +  + A
Sbjct  538  NLNQGRLYDFYWLLAILSALNFVIYLAFARWYVYKDKRLA  577



>ref|XP_010324989.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Solanum 
lycopersicum]
Length=544

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMYTGQLD F+TQSPK MKTMSTGLFLTT++LGFF SS L+S+VKKVT+A +    W+ +
Sbjct  448  FMYTGQLDLFITQSPKGMKTMSTGLFLTTMALGFFFSSLLISIVKKVTTA-NINNGWVGE  506

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWF  298
            +IN GRLD FY LLA L  I+F  Y++C+ W+
Sbjct  507  SINKGRLDCFYGLLAILIFIDFGFYVLCASWY  538



>ref|XP_003561175.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Brachypodium distachyon]
Length=588

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  417  GGQDWLADNINYGRLDLFYWLLAGLGVINFVVYLICSIWFK  295
             GQ+WLA ++N GRLDLFYW++AG+GV NFV ++IC+ W++
Sbjct  542  AGQNWLAQDLNKGRLDLFYWMIAGIGVFNFVYFMICARWYR  582



>gb|KDP24486.1| hypothetical protein JCGZ_25050 [Jatropha curcas]
Length=568

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M+++ + L LTT+++G ++S+ LV++V KVT A HG   W+ D
Sbjct  468  FTFIGQLEFFYDQAPDAMRSLCSALSLTTVAVGNYLSTLLVTIVTKVT-ARHGKLGWIPD  526

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            N+N G LD FYWLLA L V+NF VYL  + W+  +K
Sbjct  527  NLNRGHLDYFYWLLAILSVLNFFVYLWIAKWYTYKK  562



>ref|XP_004245323.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Solanum 
lycopersicum]
Length=564

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            FMYTGQLD F+TQSPK MKTMSTGLFLTT++LGFF SS L+S+VKKVT+A +    W+ +
Sbjct  468  FMYTGQLDLFITQSPKGMKTMSTGLFLTTMALGFFFSSLLISIVKKVTTA-NINNGWVGE  526

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWF  298
            +IN GRLD FY LLA L  I+F  Y++C+ W+
Sbjct  527  SINKGRLDCFYGLLAILIFIDFGFYVLCASWY  558



>ref|XP_002447891.1| hypothetical protein SORBIDRAFT_06g017470 [Sorghum bicolor]
 gb|EES12219.1| hypothetical protein SORBIDRAFT_06g017470 [Sorghum bicolor]
Length=589

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = -1

Query  426  ASHGGQDWLADN-INYGRLDLFYWLLAGLGVINFVVYLICSIWF  298
            A HGG  WL DN +N  RLDLFYW+LA L V+NF VYL+C+ W+
Sbjct  519  ARHGGGGWLGDNDLNKDRLDLFYWMLAALSVLNFFVYLLCARWY  562



>ref|XP_010933692.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Elaeis guineensis]
Length=600

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF SS LVS+V KVT  S  G  WLAD
Sbjct  483  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFFSSALVSIVHKVTGESGRGA-WLAD  541

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS  307
            N+N GRL  FYWLLA L V+N  V+L+ +
Sbjct  542  NLNEGRLYNFYWLLAVLSVVNLGVFLVSA  570



>ref|XP_009801608.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
Length=592

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 77/107 (72%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLF++T+SLGFF SS LV++V KVT  +   + WLAD
Sbjct  482  FTYIGQLDFFLRECPKGMKTMSTGLFISTISLGFFFSSILVTIVDKVTGKT---RPWLAD  538

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  262
            N+N G+L  FYWLLA L V+N +++L CS   ++ + R  +  +EME
Sbjct  539  NLNKGKLYDFYWLLAILSVLNLMLFLFCSSRYVYKEKRLAEVGIEME  585



>emb|CDP09929.1| unnamed protein product [Coffea canephora]
Length=607

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 76/107 (71%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F+Y GQLDFFL + PK MKT+STGLFL+TLSLGFF SS LV++V K    +   + WLAD
Sbjct  474  FIYVGQLDFFLRECPKGMKTISTGLFLSTLSLGFFFSSVLVTIVHK---VTGNRKPWLAD  530

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA---VEME  262
            N+N G+L+ FYWLL  L  +N + +LIC+ W+  ++ + A   +E+E
Sbjct  531  NLNQGKLNDFYWLLGILSALNLMFFLICAKWYVYKERRLADVGIELE  577



>dbj|BAJ95092.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQD-WLA  397
            F + G L+FF  QSP +M+++ + L L T +LG ++S+F++++V      + GG+  W+ 
Sbjct  489  FTFIGALEFFYDQSPDAMRSLCSALQLITTALGNYLSAFILTMVAYF--TTRGGRPGWIP  546

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            DN+N GRLD F+WLLAGL  +NF+VY++C+  FK +K
Sbjct  547  DNLNEGRLDNFFWLLAGLSFLNFLVYVVCANRFKSKK  583



>ref|XP_010458634.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Camelina sativa]
Length=589

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 77/107 (72%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
             +YTGQLDFFL + PK MK MSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD
Sbjct  477  LIYTGQLDFFLRECPKGMKGMSTGLLLSTLALGFFFSSVLVTIVEKFTGKAH---PWIAD  533

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWF---KPRKNKSAVEME  262
            ++N GRL  FYWL+A L  INF+++L+ S W+   + R  ++ +EM+
Sbjct  534  DLNKGRLYNFYWLVAVLVAINFLIFLVFSKWYVYKEKRLAEAGIEMD  580



>dbj|BAJ97468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=486

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQD-WLA  397
            F + G L+FF  QSP +M+++ + L L T +LG ++S+F++++V      + GG+  W+ 
Sbjct  390  FTFIGALEFFYDQSPDAMRSLCSALQLITTALGNYLSAFILTMVAYF--TTRGGRPGWIP  447

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            DN+N GRLD F+WLLAGL  +NF+VY++C+  FK +K
Sbjct  448  DNLNEGRLDNFFWLLAGLSFLNFLVYVVCANRFKSKK  484



>dbj|BAJ97409.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 67/97 (69%), Gaps = 3/97 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQD-WLA  397
            F + G L+FF  QSP +M+++ + L   T +LG ++S+F++++V      + GG+  W+ 
Sbjct  489  FTFIGALEFFYDQSPDAMRSLCSALQPITTALGNYLSAFILTMVAYF--TTRGGRPGWIP  546

Query  396  DNINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            DN+N GRLD F+WLLAGL  +NF+VY++C+  FK +K
Sbjct  547  DNLNEGRLDNFFWLLAGLSFLNFLVYVVCANRFKSKK  583



>gb|EAZ02298.1| hypothetical protein OsI_24399 [Oryza sativa Indica Group]
Length=573

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = -1

Query  561  GQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLADNINY  382
            GQLDFF +Q+P +MKT+ T L   +++ G ++SS +V+ V   T A+ G   W+ D++N 
Sbjct  481  GQLDFFYSQAPPAMKTVCTALGFISVAAGEYLSSLVVTAVSWAT-ATGGRPGWIPDDLNE  539

Query  381  GRLDLFYWLLAGLGVINFVVYLICSIWFKPRK  286
            G LD F+W++AGLG +N VV+  C++ +K RK
Sbjct  540  GHLDRFFWMMAGLGCLNLVVFTSCAMRYKSRK  571



>ref|XP_010493752.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Camelina sativa]
Length=589

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 77/107 (72%), Gaps = 6/107 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
             +YTGQLDFFL + PK MK MSTGL L+TL+LGFF SS LV++V+K T  +H    W+AD
Sbjct  477  LIYTGQLDFFLRECPKGMKGMSTGLLLSTLALGFFFSSVLVTIVEKFTGKAH---PWIAD  533

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWF---KPRKNKSAVEME  262
            ++N GRL  FYWL+A L  INF+++L+ S W+   + R  ++ +EM+
Sbjct  534  DLNKGRLYNFYWLVAVLVAINFLIFLVFSKWYVYKEKRLAEAGIEMD  580



>ref|XP_008796822.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=600

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF+SS LVS+V KVT  S G   WLAD
Sbjct  482  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFLSSALVSIVHKVTGES-GKGPWLAD  540

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS  307
            N+N GRL  FYWLLA L V N V++L+ +
Sbjct  541  NLNDGRLYNFYWLLAVLSVANLVLFLVSA  569



>emb|CAC00544.1| putative low-affinity nitrate transporter [Nicotiana plumbaginifolia]
Length=590

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 79/118 (67%), Gaps = 12/118 (10%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT  +     WLAD
Sbjct  481  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSILVTIVHKVTVKN----PWLAD  536

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEMETVMNGNGEEKC  229
            N+N GRL  FYWLLA L V+N +V+L  S   ++ + R  +  +EME     + E  C
Sbjct  537  NLNQGRLYDFYWLLATLSVLNLMVFLFISRRYVYKEKRLAECGIEME-----DSEPAC  589



>ref|XP_004516839.1| PREDICTED: nitrate transporter 1.1-like [Cicer arietinum]
Length=592

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 70/102 (69%), Gaps = 3/102 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF SS LV+VV +    +   + WLAD
Sbjct  481  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFFSSLLVTVVHR---VTGHHKPWLAD  537

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSAVE  268
            N+N G+L  FYWLLA L   N V+YL C+ W+  +  + A E
Sbjct  538  NLNQGKLYDFYWLLALLSGFNLVIYLFCAKWYVYKDKRLADE  579



>ref|NP_001041994.1| Os01g0142800 [Oryza sativa Japonica Group]
 dbj|BAB16458.1| putative peptide transport protein [Oryza sativa Japonica Group]
 dbj|BAB40113.1| putative peptide transport protein [Oryza sativa Japonica Group]
 dbj|BAF03908.1| Os01g0142800 [Oryza sativa Japonica Group]
 gb|EAY72488.1| hypothetical protein OsI_00345 [Oryza sativa Indica Group]
 gb|EAZ10494.1| hypothetical protein OsJ_00327 [Oryza sativa Japonica Group]
 dbj|BAG86793.1| unnamed protein product [Oryza sativa Japonica Group]
Length=580

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 44/100 (44%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M++M + L LTT++LG ++S+ LV++V  VT   +G   W+ D
Sbjct  471  FTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTLLVTIVTHVT-TRNGAVGWIPD  529

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
            N+N G LD F+WLLA L +INF VYL+ + W+  +K   +
Sbjct  530  NLNRGHLDYFFWLLAVLSLINFGVYLVIASWYTYKKTADS  569



>dbj|BAG91734.1| unnamed protein product [Oryza sativa Japonica Group]
Length=581

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 44/100 (44%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M++M + L LTT++LG ++S+ LV++V  VT   +G   W+ D
Sbjct  471  FTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTLLVTIVTHVT-TRNGAVGWIPD  529

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKNKSA  274
            N+N G LD F+WLLA L +INF VYL+ + W+  +K   +
Sbjct  530  NLNRGHLDYFFWLLAVLSLINFGVYLVIASWYTYKKTADS  569



>ref|XP_004245746.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=590

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 76/107 (71%), Gaps = 7/107 (7%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFFVSS LV++V KVT    G + WLAD
Sbjct  481  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFVSSILVTIVHKVT----GDKPWLAD  536

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICS---IWFKPRKNKSAVEME  262
            N+N GRL  FYWLLA L V+N +++L  S   ++ + R     +EME
Sbjct  537  NLNQGRLYDFYWLLAILSVLNLMIFLFFSRRYVYKEKRLADVGIEME  583



>gb|ACN26865.1| unknown [Zea mays]
 gb|AFW80032.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
Length=549

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M++M + L LTT++LG ++S+ LV++V  +T   HG   W+ +
Sbjct  439  FTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTVLVTIVTHIT-TRHGRIGWIPE  497

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKN  283
            N+N G LD F+WLLA L ++NF+ YL+ + W+K +K 
Sbjct  498  NLNRGHLDYFFWLLAVLSLLNFLAYLVIASWYKYKKT  534



>ref|XP_009589428.1| PREDICTED: protein NRT1/ PTR FAMILY 6.4-like [Nicotiana tomentosiformis]
Length=590

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 72/90 (80%), Gaps = 5/90 (6%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQL+FF+ ++P+ MK+MSTGLFL+TLS+G+FVSS LVS+V KVT  S     WL  
Sbjct  464  FAYVGQLEFFIREAPEGMKSMSTGLFLSTLSMGYFVSSLLVSLVTKVTKGS-----WLKS  518

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSI  304
            N+N G+LDLFYWLLA LGVINF+V+++ S+
Sbjct  519  NLNKGKLDLFYWLLAVLGVINFLVFIVFSM  548



>ref|XP_011463731.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=530

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 67/92 (73%), Gaps = 3/92 (3%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F Y GQLDFFL + PK MKTMSTGLFL+TLSLGFF SS LV++V K    +   + WLAD
Sbjct  420  FTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFFSSLLVTIVHK---VTGDRKPWLAD  476

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWF  298
            N+N G+L  FYWLLA L  +N ++YL C+ W+
Sbjct  477  NLNQGKLYDFYWLLAILSALNLLIYLACAKWY  508



>ref|XP_009374278.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Pyrus x bretschneideri]
 ref|XP_009374279.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Pyrus x bretschneideri]
Length=582

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M+++ + L L+T++LG + +S LVS+V K T    G   W+ D
Sbjct  482  FTFIGQLEFFYDQAPDAMRSLCSALSLSTVALGNYFNSILVSIVTKTT-TKDGNPGWIPD  540

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKN  283
            N+NYG LD F+WLLA L V+N VVYL  S W+  +K 
Sbjct  541  NLNYGHLDYFFWLLAMLSVLNLVVYLFISKWYTYKKT  577



>ref|NP_001131161.1| uncharacterized protein LOC100192469 [Zea mays]
 ref|XP_008654285.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654286.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654287.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654289.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654290.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654291.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654292.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654293.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 ref|XP_008654294.1| PREDICTED: uncharacterized protein LOC100192469 isoform X1 [Zea 
mays]
 gb|ACF79457.1| unknown [Zea mays]
 gb|ACL52512.1| unknown [Zea mays]
 gb|ACL52938.1| unknown [Zea mays]
 gb|ACN28114.1| unknown [Zea mays]
 gb|ACN28705.1| unknown [Zea mays]
 gb|ACN28818.1| unknown [Zea mays]
 gb|ACN28892.1| unknown [Zea mays]
 gb|AFW80023.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80024.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80025.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80026.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80027.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80028.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80029.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80030.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
 gb|AFW80031.1| hypothetical protein ZEAMMB73_328254 [Zea mays]
Length=580

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = -1

Query  573  FMYTGQLDFFLTQSPKSMKTMstglflttlslgffvssflvsvvkkvtSASHGGQDWLAD  394
            F + GQL+FF  Q+P +M++M + L LTT++LG ++S+ LV++V  +T   HG   W+ +
Sbjct  470  FTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGNYLSTVLVTIVTHIT-TRHGRIGWIPE  528

Query  393  NINYGRLDLFYWLLAGLGVINFVVYLICSIWFKPRKN  283
            N+N G LD F+WLLA L ++NF+ YL+ + W+K +K 
Sbjct  529  NLNRGHLDYFFWLLAVLSLLNFLAYLVIASWYKYKKT  565



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750