BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF044N02

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    167   5e-44   Solanum tuberosum [potatoes]
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    167   9e-44   Solanum lycopersicum
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...    163   2e-42   Nicotiana sylvestris
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    162   5e-42   Nicotiana tomentosiformis
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...    161   1e-41   Solanum peruvianum [Peruvian tomato]
gb|KHN13035.1|  Leucine-rich repeat receptor-like serine/threonin...    159   2e-41   Glycine soja [wild soybean]
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    160   2e-41   Nicotiana sylvestris
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...    160   2e-41   Solanum pennellii
ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...    160   2e-41   Solanum lycopersicum
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    159   4e-41   Tarenaya hassleriana [spider flower]
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor           159   6e-41   Glycine max [soybeans]
ref|XP_010518800.1|  PREDICTED: leucine-rich repeat receptor-like...    158   9e-41   Tarenaya hassleriana [spider flower]
gb|KHN42601.1|  Leucine-rich repeat receptor-like serine/threonin...    156   1e-40   Glycine soja [wild soybean]
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...    157   2e-40   Morus notabilis
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...    157   3e-40   Solanum tuberosum [potatoes]
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...    156   4e-40   Pyrus x bretschneideri [bai li]
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor           156   4e-40   
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    156   4e-40   
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...    156   5e-40   Pyrus x bretschneideri [bai li]
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...    156   5e-40   
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...    156   6e-40   
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...    155   8e-40   Gossypium arboreum [tree cotton]
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...    155   1e-39   Sesamum indicum [beniseed]
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    154   2e-39   
ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    154   2e-39   Nicotiana tomentosiformis
gb|KDP32143.1|  hypothetical protein JCGZ_12604                         154   3e-39   Jatropha curcas
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g             154   3e-39   Phaseolus vulgaris [French bean]
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    154   3e-39   Sesamum indicum [beniseed]
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...    153   6e-39   Ricinus communis
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    152   9e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    152   9e-39   Fragaria vesca subsp. vesca
emb|CDP02660.1|  unnamed protein product                                152   1e-38   Coffea canephora [robusta coffee]
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...    152   1e-38   Vitis vinifera
gb|KJB18115.1|  hypothetical protein B456_003G034500                    152   2e-38   Gossypium raimondii
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...    152   2e-38   Cicer arietinum [garbanzo]
gb|KJB43996.1|  hypothetical protein B456_007G228700                    151   2e-38   Gossypium raimondii
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg             151   2e-38   Prunus persica
emb|CBI35733.3|  unnamed protein product                                151   3e-38   Vitis vinifera
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...    151   3e-38   Citrus sinensis [apfelsine]
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                   151   3e-38   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg             151   3e-38   Citrus clementina [clementine]
ref|XP_008237309.1|  PREDICTED: leucine-rich repeat receptor-like...    150   5e-38   
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...    150   6e-38   
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor           150   8e-38   Glycine max [soybeans]
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    150   1e-37   Populus euphratica
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             149   1e-37   Populus trichocarpa [western balsam poplar]
gb|KHN47566.1|  Leucine-rich repeat receptor-like serine/threonin...    148   2e-37   Glycine soja [wild soybean]
gb|KJB48795.1|  hypothetical protein B456_008G087500                    149   2e-37   Gossypium raimondii
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    149   2e-37   Nelumbo nucifera [Indian lotus]
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    149   2e-37   Gossypium arboreum [tree cotton]
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    149   2e-37   Dimocarpus longan [longan]
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    148   5e-37   Nelumbo nucifera [Indian lotus]
gb|AES94465.2|  LRR receptor-like kinase family protein                 147   5e-37   Medicago truncatula
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             147   6e-37   Capsella rubella
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...    147   1e-36   Cucumis sativus [cucumbers]
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g             147   1e-36   Phaseolus vulgaris [French bean]
ref|XP_006852730.1|  hypothetical protein AMTR_s00033p00083200          146   1e-36   
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...    146   1e-36   Cucumis melo [Oriental melon]
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                    146   2e-36   Arabis alpina [alpine rockcress]
ref|XP_008790445.1|  PREDICTED: leucine-rich repeat receptor-like...    146   2e-36   Phoenix dactylifera
ref|NP_001237688.1|  receptor-like protein kinase precursor             146   2e-36   Glycine max [soybeans]
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...    145   3e-36   Camelina sativa [gold-of-pleasure]
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...    145   4e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg             145   5e-36   
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807             145   6e-36   
gb|KHN01704.1|  Leucine-rich repeat receptor-like serine/threonin...    144   6e-36   Glycine soja [wild soybean]
dbj|BAF01968.1|  receptor protein kinase like protein                   137   6e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KJB18113.1|  hypothetical protein B456_003G034400                    145   6e-36   Gossypium raimondii
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...    144   6e-36   Phoenix dactylifera
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...    144   9e-36   Camelina sativa [gold-of-pleasure]
ref|XP_003611507.1|  Receptor-like protein kinase                       144   1e-35   
ref|XP_003608587.1|  Receptor-like protein kinase                       143   2e-35   Medicago truncatula
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...    143   2e-35   
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...    142   3e-35   Camelina sativa [gold-of-pleasure]
emb|CDY45620.1|  BnaCnng13280D                                          142   4e-35   Brassica napus [oilseed rape]
ref|XP_010936307.1|  PREDICTED: leucine-rich repeat receptor-like...    142   6e-35   
emb|CDY08759.1|  BnaA06g24650D                                          141   7e-35   Brassica napus [oilseed rape]
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...    142   7e-35   Brassica rapa
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg                141   8e-35   Erythranthe guttata [common monkey flower]
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...    141   8e-35   Oryza brachyantha
gb|AAO26313.1|  receptor-like protein kinase                            138   8e-35   Elaeis guineensis
ref|XP_008785758.1|  PREDICTED: leucine-rich repeat receptor-like...    140   2e-34   
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450          140   2e-34   Sorghum bicolor [broomcorn]
gb|EAY92008.1|  hypothetical protein OsI_13698                          140   2e-34   Oryza sativa Indica Group [Indian rice]
gb|AAP68887.1|  putative receptor-like protein kinase 1                 140   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...    140   2e-34   Elaeis guineensis
gb|EEE60014.1|  hypothetical protein OsJ_12761                          140   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010023395.1|  PREDICTED: leucine-rich repeat receptor-like...    140   2e-34   
ref|NP_001051418.1|  Os03g0773700                                       139   3e-34   
gb|KCW59634.1|  hypothetical protein EUGRSUZ_H023832                    139   4e-34   Eucalyptus grandis [rose gum]
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein         139   4e-34   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ02682.1|  hypothetical protein OsI_24796                          139   5e-34   Oryza sativa Indica Group [Indian rice]
emb|CDY23037.1|  BnaC07g31500D                                          139   5e-34   Brassica napus [oilseed rape]
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg             139   6e-34   Capsella rubella
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                    139   7e-34   Arabis alpina [alpine rockcress]
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)          139   8e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010943209.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    138   1e-33   
dbj|BAJ84911.1|  predicted protein                                      138   1e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    137   2e-33   
emb|CDY02112.1|  BnaA03g40550D                                          137   2e-33   
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265             137   2e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_004981595.1|  PREDICTED: leucine-rich repeat receptor-like...    137   2e-33   Setaria italica
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...    137   3e-33   Brassica rapa
ref|XP_009399076.1|  PREDICTED: leucine-rich repeat receptor-like...    137   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006657429.1|  PREDICTED: leucine-rich repeat receptor-like...    136   3e-33   Oryza brachyantha
gb|EMS57320.1|  Leucine-rich repeat receptor-like serine/threonin...    135   5e-33   Triticum urartu
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...    135   9e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg             135   1e-32   
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...    135   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...    135   1e-32   Elaeis guineensis
gb|ADB85328.1|  putative receptor protein kinase                        134   1e-32   Phyllostachys edulis [kikko-chiku]
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...    135   2e-32   Eucalyptus grandis [rose gum]
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...    134   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_003558681.1|  PREDICTED: leucine-rich repeat receptor-like...    134   3e-32   Brachypodium distachyon [annual false brome]
gb|AAY32333.1|  RLK1                                                    133   4e-32   Phyllostachys praecox [zaozhu]
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...    133   5e-32   Camelina sativa [gold-of-pleasure]
gb|EMT14290.1|  Receptor protein kinase CLAVATA1                        133   6e-32   
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...    133   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...    132   1e-31   
gb|EPS74129.1|  hypothetical protein M569_00625                         132   2e-31   Genlisea aurea
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...    132   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...    132   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...    131   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS67650.1|  Leucine-rich repeat receptor-like serine/threonin...    130   4e-31   Triticum urartu
ref|XP_009395647.1|  PREDICTED: leucine-rich repeat receptor-like...    130   5e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690          130   5e-31   Sorghum bicolor [broomcorn]
dbj|BAJ89729.1|  predicted protein                                      130   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT20446.1|  Receptor protein kinase CLAVATA1                        129   2e-30   
ref|XP_008665503.1|  PREDICTED: leucine-rich repeat receptor-like...    128   3e-30   Zea mays [maize]
ref|XP_006649672.1|  PREDICTED: leucine-rich repeat receptor-like...    127   1e-29   Oryza brachyantha
ref|XP_009787949.1|  PREDICTED: leucine-rich repeat receptor-like...    126   2e-29   Nicotiana sylvestris
gb|AAM27467.1|AC099732_4  Putative receptor-like protein kinase         124   8e-29   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049453.1|  Os03g0228800                                       124   8e-29   
dbj|BAJ99137.1|  predicted protein                                      123   1e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC74807.1|  hypothetical protein OsI_10619                          123   2e-28   Oryza sativa Indica Group [Indian rice]
gb|AAX94895.1|  Similar to receptor-like protein kinase                 114   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010228930.1|  PREDICTED: leucine-rich repeat receptor-like...    123   2e-28   
gb|ACN35202.1|  unknown                                                 118   3e-28   Zea mays [maize]
gb|ABE79572.2|  Protein kinase                                          122   4e-28   Medicago truncatula
ref|XP_003592924.1|  Receptor-like protein kinase                       122   4e-28   Medicago truncatula
gb|EMT15500.1|  hypothetical protein F775_52402                         122   4e-28   
ref|NP_001169902.1|  uncharacterized protein LOC100383797               119   4e-28   
ref|XP_009403711.1|  PREDICTED: leucine-rich repeat receptor-like...    122   5e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004985112.1|  PREDICTED: leucine-rich repeat receptor-like...    121   7e-28   Setaria italica
ref|XP_004230451.1|  PREDICTED: leucine-rich repeat receptor-like...    121   8e-28   Solanum lycopersicum
ref|XP_009603651.1|  PREDICTED: leucine-rich repeat receptor-like...    121   9e-28   Nicotiana tomentosiformis
emb|CDY68180.1|  BnaAnng26370D                                          111   9e-28   Brassica napus [oilseed rape]
gb|ACL54651.1|  unknown                                                 118   1e-27   Zea mays [maize]
emb|CDX91053.1|  BnaC02g05440D                                          111   1e-27   
gb|AAX96206.1|  Similar to receptor-like protein kinase 3               120   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006431638.1|  hypothetical protein CICLE_v10000148mg             120   2e-27   
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...    120   3e-27   
ref|XP_006349327.1|  PREDICTED: leucine-rich repeat receptor-like...    120   3e-27   Solanum tuberosum [potatoes]
gb|EEC67924.1|  hypothetical protein OsI_35629                          119   4e-27   Oryza sativa Indica Group [Indian rice]
tpg|DAA44225.1|  TPA: putative leucine-rich repeat receptor-like ...    119   5e-27   
ref|NP_001145765.1|  uncharacterized protein LOC100279272               118   5e-27   
gb|EMT21762.1|  Receptor protein kinase CLAVATA1                        114   6e-27   
gb|KDO44093.1|  hypothetical protein CISIN_1g001922mg                   117   1e-26   Citrus sinensis [apfelsine]
ref|XP_006492589.1|  PREDICTED: leucine-rich repeat receptor-like...    117   1e-26   Citrus sinensis [apfelsine]
dbj|BAJ90459.1|  predicted protein                                      117   1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006858565.1|  hypothetical protein AMTR_s00071p00176900          117   2e-26   
ref|XP_010912647.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-26   Elaeis guineensis
gb|EEE51888.1|  hypothetical protein OsJ_33462                          117   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003576141.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-26   Brachypodium distachyon [annual false brome]
emb|CDO97616.1|  unnamed protein product                                116   4e-26   Coffea canephora [robusta coffee]
ref|XP_010930574.1|  PREDICTED: leucine-rich repeat receptor-like...    116   5e-26   Elaeis guineensis
ref|XP_009355307.1|  PREDICTED: leucine-rich repeat receptor-like...    115   8e-26   Pyrus x bretschneideri [bai li]
gb|KDP42443.1|  hypothetical protein JCGZ_00240                         115   1e-25   Jatropha curcas
ref|XP_010520784.1|  PREDICTED: leucine-rich repeat receptor-like...    115   1e-25   Tarenaya hassleriana [spider flower]
ref|XP_010520783.1|  PREDICTED: leucine-rich repeat receptor-like...    115   1e-25   Tarenaya hassleriana [spider flower]
emb|CBI29704.3|  unnamed protein product                                115   1e-25   Vitis vinifera
ref|XP_002263291.2|  PREDICTED: leucine-rich repeat receptor-like...    115   1e-25   Vitis vinifera
ref|XP_007041221.1|  Leucine-rich receptor-like protein kinase fa...    115   2e-25   
ref|XP_007224667.1|  hypothetical protein PRUPE_ppa026134mg             114   2e-25   Prunus persica
gb|EYU26470.1|  hypothetical protein MIMGU_mgv1a019834mg                114   2e-25   Erythranthe guttata [common monkey flower]
ref|XP_009411355.1|  PREDICTED: leucine-rich repeat receptor-like...    114   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006859064.1|  hypothetical protein AMTR_s00068p00198250          114   2e-25   
gb|KJB32855.1|  hypothetical protein B456_005G265400                    114   3e-25   Gossypium raimondii
ref|XP_011092305.1|  PREDICTED: leucine-rich repeat receptor-like...    114   3e-25   Sesamum indicum [beniseed]
ref|XP_011087678.1|  PREDICTED: leucine-rich repeat receptor-like...    114   4e-25   
emb|CAN71863.1|  hypothetical protein VITISV_023530                     113   4e-25   Vitis vinifera
gb|EYU33270.1|  hypothetical protein MIMGU_mgv1a0010742mg               106   4e-25   Erythranthe guttata [common monkey flower]
ref|XP_004485432.1|  PREDICTED: leucine-rich repeat receptor-like...    113   4e-25   Cicer arietinum [garbanzo]
ref|XP_009401113.1|  PREDICTED: leucine-rich repeat receptor-like...    113   5e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008218726.1|  PREDICTED: leucine-rich repeat receptor-like...    113   6e-25   Prunus mume [ume]
ref|XP_008786484.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    112   1e-24   
ref|XP_006385034.1|  hypothetical protein POPTR_0004s23260g             112   1e-24   Populus trichocarpa [western balsam poplar]
ref|XP_008795253.1|  PREDICTED: leucine-rich repeat receptor-like...    112   1e-24   Phoenix dactylifera
ref|XP_008347921.1|  PREDICTED: leucine-rich repeat receptor-like...    112   2e-24   
ref|XP_011028346.1|  PREDICTED: leucine-rich repeat receptor-like...    112   2e-24   Populus euphratica
ref|XP_008339390.1|  PREDICTED: leucine-rich repeat receptor-like...    112   2e-24   
ref|XP_002526451.1|  Receptor protein kinase CLAVATA1 precursor, ...    112   2e-24   Ricinus communis
ref|XP_010687839.1|  PREDICTED: leucine-rich repeat receptor-like...    112   2e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW57119.1|  hypothetical protein EUGRSUZ_I02765                     111   2e-24   Eucalyptus grandis [rose gum]
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...    111   2e-24   
gb|KHG14208.1|  Leucine-rich repeat receptor-like serine/threonin...    111   3e-24   Gossypium arboreum [tree cotton]
ref|XP_009392568.1|  PREDICTED: leucine-rich repeat receptor-like...    111   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010030176.1|  PREDICTED: leucine-rich repeat receptor-like...    111   3e-24   Eucalyptus grandis [rose gum]
ref|XP_008356104.1|  PREDICTED: leucine-rich repeat receptor-like...    110   3e-24   
gb|KCW62729.1|  hypothetical protein EUGRSUZ_G00319                     110   5e-24   Eucalyptus grandis [rose gum]
ref|XP_010065309.1|  PREDICTED: leucine-rich repeat receptor-like...    110   5e-24   Eucalyptus grandis [rose gum]
ref|XP_010243895.1|  PREDICTED: leucine-rich repeat receptor-like...    110   5e-24   Nelumbo nucifera [Indian lotus]
ref|XP_009363288.1|  PREDICTED: leucine-rich repeat receptor-like...    110   6e-24   Pyrus x bretschneideri [bai li]
ref|XP_009353760.1|  PREDICTED: leucine-rich repeat receptor-like...    110   6e-24   Pyrus x bretschneideri [bai li]
ref|XP_004295533.1|  PREDICTED: leucine-rich repeat receptor-like...    110   7e-24   Fragaria vesca subsp. vesca
ref|XP_002304615.1|  leucine-rich repeat transmembrane protein ki...    110   7e-24   Populus trichocarpa [western balsam poplar]
gb|AHJ14779.1|  CLAVATA1                                                110   7e-24   Rhododendron ovatum
gb|KJB16198.1|  hypothetical protein B456_002G217000                    108   1e-23   Gossypium raimondii
gb|KHG17337.1|  Leucine-rich repeat receptor-like serine/threonin...    108   2e-23   Gossypium arboreum [tree cotton]
gb|KJB16199.1|  hypothetical protein B456_002G217000                    108   2e-23   Gossypium raimondii
ref|XP_009368577.1|  PREDICTED: leucine-rich repeat receptor-like...    108   2e-23   Pyrus x bretschneideri [bai li]
ref|XP_008349109.1|  PREDICTED: leucine-rich repeat receptor-like...    108   2e-23   Malus domestica [apple tree]
ref|XP_006468612.1|  PREDICTED: leucine-rich repeat receptor-like...    108   2e-23   Citrus sinensis [apfelsine]
ref|XP_007163887.1|  hypothetical protein PHAVU_L008000g                100   2e-23   Phaseolus vulgaris [French bean]
ref|XP_011022287.1|  PREDICTED: leucine-rich repeat receptor-like...    108   2e-23   Populus euphratica
gb|KDO77158.1|  hypothetical protein CISIN_1g012213mg                   106   2e-23   Citrus sinensis [apfelsine]
ref|XP_008799579.1|  PREDICTED: leucine-rich repeat receptor-like...    108   3e-23   Phoenix dactylifera
ref|XP_011004294.1|  PREDICTED: leucine-rich repeat receptor-like...    108   3e-23   Populus euphratica
ref|XP_002297907.2|  leucine-rich repeat transmembrane protein ki...    108   3e-23   Populus trichocarpa [western balsam poplar]
gb|KDP23869.1|  hypothetical protein JCGZ_27138                         107   5e-23   Jatropha curcas
ref|XP_004491265.1|  PREDICTED: leucine-rich repeat receptor-like...    107   5e-23   Cicer arietinum [garbanzo]
ref|XP_006448558.1|  hypothetical protein CICLE_v10014145mg             107   6e-23   Citrus clementina [clementine]
ref|XP_010087435.1|  Leucine-rich repeat receptor-like serine/thr...    107   8e-23   Morus notabilis
ref|XP_008793129.1|  PREDICTED: leucine-rich repeat receptor-like...    107   8e-23   
ref|XP_007214567.1|  hypothetical protein PRUPE_ppa000837mg             107   9e-23   Prunus persica
ref|XP_009600411.1|  PREDICTED: leucine-rich repeat receptor-like...    106   1e-22   Nicotiana tomentosiformis
emb|CDP04113.1|  unnamed protein product                                106   1e-22   Coffea canephora [robusta coffee]
ref|XP_008793131.1|  PREDICTED: leucine-rich repeat receptor-like...    106   1e-22   
ref|XP_004301907.1|  PREDICTED: leucine-rich repeat receptor-like...    106   2e-22   Fragaria vesca subsp. vesca
ref|XP_010918071.1|  PREDICTED: leucine-rich repeat receptor-like...    106   2e-22   Elaeis guineensis
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...    105   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...    105   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY54567.1|  BnaA08g30460D                                          105   3e-22   Brassica napus [oilseed rape]
ref|XP_009763204.1|  PREDICTED: leucine-rich repeat receptor-like...    105   3e-22   Nicotiana sylvestris
ref|XP_009108464.1|  PREDICTED: leucine-rich repeat receptor-like...    105   3e-22   Brassica rapa
gb|EPS62062.1|  protein kinase                                          104   4e-22   Genlisea aurea
gb|KHG23359.1|  Leucine-rich repeat receptor-like serine/threonin...    104   5e-22   Gossypium arboreum [tree cotton]
ref|XP_008781646.1|  PREDICTED: probable LRR receptor-like serine...  99.8    5e-22   Phoenix dactylifera
gb|KJB32927.1|  hypothetical protein B456_005G268400                    104   6e-22   Gossypium raimondii
emb|CDX93999.1|  BnaC07g36330D                                          104   6e-22   
emb|CDX98665.1|  BnaA03g44500D                                          104   6e-22   
ref|XP_009137141.1|  PREDICTED: leucine-rich repeat receptor-like...    104   7e-22   Brassica rapa
ref|XP_006413888.1|  hypothetical protein EUTSA_v10024310mg             104   7e-22   Eutrema salsugineum [saltwater cress]
emb|CDY31445.1|  BnaC03g63790D                                          103   8e-22   Brassica napus [oilseed rape]
ref|XP_004229499.1|  PREDICTED: leucine-rich repeat receptor-like...    103   8e-22   Solanum lycopersicum
ref|XP_010924539.1|  PREDICTED: leucine-rich repeat receptor-like...    103   8e-22   Elaeis guineensis
ref|XP_002869943.1|  hypothetical protein ARALYDRAFT_492844             103   8e-22   
ref|NP_001170600.1|  uncharacterized protein LOC100384637             99.0    9e-22   
ref|XP_010439602.1|  PREDICTED: leucine-rich repeat receptor-like...    103   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010449207.1|  PREDICTED: leucine-rich repeat receptor-like...    103   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006283067.1|  hypothetical protein CARUB_v10004060mg             103   1e-21   Capsella rubella
gb|ACN59341.1|  leucine-rich repeat receptor-like protein kinase        103   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193760.1|  leucine-rich receptor-like protein kinase BAM3        103   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225951.1|  PREDICTED: leucine-rich repeat receptor-like...    103   2e-21   Prunus mume [ume]
ref|XP_003617299.1|  Receptor-like protein kinase                       102   2e-21   Medicago truncatula
gb|KFK28659.1|  hypothetical protein AALP_AA7G028700                    102   3e-21   Arabis alpina [alpine rockcress]
ref|XP_010094628.1|  Leucine-rich repeat receptor-like serine/thr...    102   4e-21   Morus notabilis
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...    101   5e-21   
ref|XP_010529317.1|  PREDICTED: leucine-rich repeat receptor-like...    101   5e-21   Tarenaya hassleriana [spider flower]
ref|XP_006356981.1|  PREDICTED: leucine-rich repeat receptor-like...    101   5e-21   Solanum tuberosum [potatoes]
ref|XP_006856744.1|  hypothetical protein AMTR_s00055p00012250          101   5e-21   
ref|XP_007146301.1|  hypothetical protein PHAVU_006G029000g             101   7e-21   Phaseolus vulgaris [French bean]
ref|XP_002264952.1|  PREDICTED: leucine-rich repeat receptor-like...    100   9e-21   Vitis vinifera
ref|XP_004150938.1|  PREDICTED: leucine-rich repeat receptor-like...    100   9e-21   Cucumis sativus [cucumbers]
tpg|DAA41870.1|  TPA: putative leucine-rich repeat receptor-like ...    100   9e-21   
gb|KHN28525.1|  Leucine-rich repeat receptor-like serine/threonin...    100   1e-20   Glycine soja [wild soybean]
ref|XP_009415217.1|  PREDICTED: leucine-rich repeat receptor-like...    100   1e-20   
ref|XP_009415213.1|  PREDICTED: leucine-rich repeat receptor-like...    100   1e-20   
ref|XP_006602289.1|  PREDICTED: leucine-rich repeat receptor-like...    100   1e-20   Glycine max [soybeans]
ref|XP_009133589.1|  PREDICTED: leucine-rich repeat receptor-like...    100   2e-20   Brassica rapa
gb|KHM99687.1|  Leucine-rich repeat receptor-like serine/threonin...  99.8    2e-20   Glycine soja [wild soybean]
ref|XP_003530709.1|  PREDICTED: leucine-rich repeat receptor-like...    100   2e-20   Glycine max [soybeans]
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...  99.4    3e-20   Cucumis melo [Oriental melon]
ref|XP_004155230.1|  PREDICTED: leucine-rich repeat receptor-like...  99.4    3e-20   
gb|KHN12015.1|  Leucine-rich repeat receptor-like serine/threonin...  98.6    4e-20   Glycine soja [wild soybean]
ref|XP_004979026.1|  PREDICTED: leucine-rich repeat receptor-like...  99.0    4e-20   Setaria italica
ref|XP_002532709.1|  Receptor protein kinase CLAVATA1 precursor, ...  99.0    5e-20   Ricinus communis
ref|XP_004143533.1|  PREDICTED: leucine-rich repeat receptor-like...  99.0    5e-20   Cucumis sativus [cucumbers]
ref|XP_003545159.1|  PREDICTED: leucine-rich repeat receptor-like...  99.0    5e-20   Glycine max [soybeans]
ref|XP_004160944.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  98.6    6e-20   
gb|KHN15622.1|  Leucine-rich repeat receptor-like serine/threonin...  91.3    6e-20   
gb|KHN07526.1|  Leucine-rich repeat receptor-like serine/threonin...  90.9    9e-20   
gb|KJB47871.1|  hypothetical protein B456_008G045400                  97.8    1e-19   
gb|KHG13927.1|  Leucine-rich repeat receptor-like serine/threonin...  97.8    1e-19   
gb|KJB29653.1|  hypothetical protein B456_005G112100                  96.7    3e-19   
gb|KHG24572.1|  Receptor protein kinase CLAVATA1                      96.3    3e-19   
gb|KEH33614.1|  LRR receptor-like kinase family protein               95.9    5e-19   
emb|CDY62258.1|  BnaCnng39750D                                        95.9    5e-19   
gb|KHN38370.1|  Leucine-rich repeat receptor-like serine/threonin...  94.7    1e-18   
ref|XP_003518489.2|  PREDICTED: leucine-rich repeat receptor-like...  94.7    1e-18   
ref|XP_004499483.1|  PREDICTED: leucine-rich repeat receptor-like...  94.7    1e-18   
ref|XP_008678021.1|  PREDICTED: leucine-rich repeat receptor-like...  93.6    3e-18   
ref|XP_006435205.1|  hypothetical protein CICLE_v10000156mg           93.2    4e-18   
ref|XP_008452253.1|  PREDICTED: leucine-rich repeat receptor-like...  93.2    4e-18   
gb|KDO84901.1|  hypothetical protein CISIN_1g002010mg                 93.2    4e-18   
ref|XP_008221401.1|  PREDICTED: receptor protein kinase CLAVATA1      92.8    5e-18   
gb|KDP36903.1|  hypothetical protein JCGZ_08194                       93.2    5e-18   
gb|KJB58082.1|  hypothetical protein B456_009G193600                  92.8    5e-18   
ref|XP_006300675.1|  hypothetical protein CARUB_v10019714mg           92.8    5e-18   
ref|XP_011035001.1|  PREDICTED: receptor protein kinase CLAVATA1-...  92.8    5e-18   
ref|XP_007225356.1|  hypothetical protein PRUPE_ppa000916mg           92.8    6e-18   
ref|XP_010471715.1|  PREDICTED: receptor protein kinase CLAVATA1 ...  92.4    8e-18   
ref|XP_010416487.1|  PREDICTED: receptor protein kinase CLAVATA1-...  92.4    8e-18   
emb|CBI19895.3|  unnamed protein product                              92.0    9e-18   
ref|XP_002307734.1|  receptor protein kinase                          92.0    9e-18   
ref|XP_002300697.2|  receptor protein kinase                          92.0    1e-17   
ref|XP_004291349.1|  PREDICTED: receptor protein kinase CLAVATA1      92.0    1e-17   
ref|XP_009415664.1|  PREDICTED: leucine-rich repeat receptor-like...  91.7    1e-17   
ref|XP_002279563.1|  PREDICTED: receptor protein kinase CLAVATA1      91.7    1e-17   
ref|XP_006589895.1|  PREDICTED: leucine-rich repeat receptor-like...  86.3    2e-17   
ref|XP_009106236.1|  PREDICTED: receptor protein kinase CLAVATA1      91.3    2e-17   
emb|CDX73202.1|  BnaC06g36500D                                        91.3    2e-17   
gb|ADD64789.1|  CLAVATA1                                              91.3    2e-17   
emb|CDX87661.1|  BnaA07g32120D                                        90.9    2e-17   
gb|AAB58929.1|  CLV1 receptor kinase                                  90.9    2e-17   
gb|AAD02501.1|  receptor kinase                                       90.9    2e-17   
pir||E96787  protein T4O12.5 [imported] - Arabidopsis thaliana        90.9    3e-17
ref|NP_177710.1|  receptor protein kinase CLAVATA1                    90.9    3e-17   
ref|XP_007017845.1|  Leucine-rich receptor-like protein kinase fa...  90.5    3e-17   
ref|XP_006473681.1|  PREDICTED: receptor protein kinase CLAVATA1-...  90.5    3e-17   
ref|XP_002450588.1|  hypothetical protein SORBIDRAFT_05g007480        90.1    4e-17   
emb|CBI27382.3|  unnamed protein product                              89.0    5e-17   
ref|XP_006390268.1|  hypothetical protein EUTSA_v10018069mg           89.7    6e-17   
ref|XP_008466473.1|  PREDICTED: receptor protein kinase CLAVATA1      89.4    7e-17   
ref|XP_004136488.1|  PREDICTED: receptor protein kinase CLAVATA1-...  89.4    7e-17   
ref|XP_010539846.1|  PREDICTED: receptor protein kinase CLAVATA1      89.4    8e-17   
gb|AAP49010.1|  CLV1-like receptor kinase                             89.4    8e-17   
ref|XP_002889046.1|  hypothetical protein ARALYDRAFT_476729           89.4    9e-17   
ref|XP_006342066.1|  PREDICTED: receptor protein kinase CLAVATA1-...  89.0    1e-16   
ref|XP_011074693.1|  PREDICTED: receptor protein kinase CLAVATA1-...  89.0    1e-16   
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...  88.6    1e-16   
ref|XP_004238370.1|  PREDICTED: receptor protein kinase CLAVATA1      88.6    2e-16   
gb|KHG26020.1|  Receptor protein kinase CLAVATA1                      88.6    2e-16   
ref|XP_010428620.1|  PREDICTED: receptor protein kinase CLAVATA1-...  88.2    2e-16   
ref|XP_009334873.1|  PREDICTED: receptor protein kinase CLAVATA1      88.2    2e-16   
ref|XP_008357152.1|  PREDICTED: receptor protein kinase CLAVATA1-...  87.4    3e-16   
gb|EYU38789.1|  hypothetical protein MIMGU_mgv1a000850mg              87.4    3e-16   
ref|XP_006655663.1|  PREDICTED: leucine-rich repeat receptor-like...  87.4    4e-16   
ref|XP_008364929.1|  PREDICTED: receptor protein kinase CLAVATA1-...  87.4    4e-16   
ref|XP_006579172.1|  PREDICTED: leucine-rich repeat receptor-like...  83.6    4e-16   
ref|XP_009592786.1|  PREDICTED: receptor protein kinase CLAVATA1      87.0    5e-16   
gb|AFY06667.1|  receptor protein kinase CLAVATA1                      87.0    5e-16   
ref|XP_010536408.1|  PREDICTED: receptor protein kinase CLAVATA1-...  86.3    8e-16   
ref|XP_002510557.1|  Receptor protein kinase CLAVATA1 precursor, ...  86.3    8e-16   
gb|KCW58271.1|  hypothetical protein EUGRSUZ_H00963                   86.3    8e-16   
ref|XP_010069807.1|  PREDICTED: receptor protein kinase CLAVATA1-...  86.3    9e-16   
ref|XP_010671767.1|  PREDICTED: receptor protein kinase CLAVATA1      86.3    1e-15   
ref|XP_009766393.1|  PREDICTED: receptor protein kinase CLAVATA1      85.5    1e-15   
gb|EYU36796.1|  hypothetical protein MIMGU_mgv1a020841mg              85.5    1e-15   
gb|EEC79804.1|  hypothetical protein OsI_21242                        84.7    3e-15   
ref|NP_001174552.1|  Os05g0595950                                     84.7    3e-15   
dbj|BAI82122.1|  CLV1-like LRR receptor kinase                        84.3    4e-15   
emb|CAD42335.1|  hypernodulation aberrant root formation protein      84.0    5e-15   
ref|XP_004507478.1|  PREDICTED: LOW QUALITY PROTEIN: receptor pro...  84.0    5e-15   
ref|NP_001140626.1|  uncharacterized LOC100272700                     80.9    6e-15   
ref|XP_010110004.1|  Receptor protein kinase CLAVATA1                 84.0    6e-15   
ref|XP_011083584.1|  PREDICTED: receptor protein kinase CLAVATA1      83.6    6e-15   
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...  83.2    9e-15   
ref|XP_002441645.1|  hypothetical protein SORBIDRAFT_09g030870        83.2    1e-14   
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1      82.8    1e-14   
ref|XP_006853709.1|  hypothetical protein AMTR_s00056p00150470        82.4    2e-14   
gb|AGP76288.1|  floral organ number 1                                 77.0    2e-14   
ref|XP_002965214.1|  hypothetical protein SELMODRAFT_83051            82.4    2e-14   
ref|XP_002962293.1|  hypothetical protein SELMODRAFT_77558            82.4    2e-14   
ref|XP_008387933.1|  PREDICTED: receptor protein kinase CLAVATA1      82.4    2e-14   
ref|XP_008647500.1|  PREDICTED: uncharacterized LOC100272700 isof...  81.6    3e-14   
ref|XP_008647502.1|  PREDICTED: uncharacterized LOC100272700 isof...  81.6    3e-14   
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                   81.6    3e-14   
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1      81.6    3e-14   
gb|AGP76279.1|  floral organ number 1                                 76.3    4e-14   
gb|AGP76284.1|  floral organ number 1                                 75.9    4e-14   
gb|AGP76283.1|  floral organ number 1                                 75.9    4e-14   
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                  80.9    6e-14   
ref|XP_009418700.1|  PREDICTED: leucine-rich repeat receptor-like...  80.1    8e-14   
emb|CAD42181.1|  serine-threonine protein kinase                      80.1    1e-13   
ref|XP_002971751.1|  hypothetical protein SELMODRAFT_172284           80.1    1e-13   
ref|XP_002991545.1|  hypothetical protein SELMODRAFT_186143           80.1    1e-13   
ref|NP_001238004.1|  receptor protein kinase-like protein precursor   79.7    1e-13   
dbj|BAC41332.1|  LRR receptor-like kinase                             79.7    1e-13   
gb|KHN25406.1|  Receptor protein kinase CLAVATA1                      79.3    2e-13   
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...  79.0    2e-13   
gb|EPS70741.1|  hypothetical protein M569_04011                       79.0    2e-13   
gb|AAW71475.1|  CLV1-like receptor kinase                             79.0    2e-13   
ref|XP_003606988.1|  Receptor protein kinase CLAVATA1                 78.2    3e-13   
ref|XP_006656496.1|  PREDICTED: leucine-rich repeat receptor-like...  78.2    5e-13   
ref|NP_001238576.1|  receptor protein kinase-like protein precursor   77.8    5e-13   
gb|KHN39812.1|  Receptor protein kinase CLAVATA1                      77.4    6e-13   
ref|XP_010935096.1|  PREDICTED: leucine-rich repeat receptor-like...  77.4    7e-13   
gb|AIT55304.1|  nodulation autoregulation receptor kinase             77.0    9e-13   
ref|XP_007131793.1|  hypothetical protein PHAVU_011G042000g           76.6    1e-12   
ref|XP_004960969.1|  PREDICTED: leucine-rich repeat receptor-like...  76.6    1e-12   
ref|NP_001058593.1|  Os06g0717200                                     75.9    2e-12   
ref|XP_008645089.1|  PREDICTED: leucine-rich repeat receptor-like...  75.9    3e-12   
ref|XP_002985227.1|  hypothetical protein SELMODRAFT_121783           75.1    4e-12   
emb|CAA61510.1|  leucine-rich repeat/receptor protein kinase          74.7    5e-12   
ref|XP_002970036.1|  hypothetical protein SELMODRAFT_146738           74.7    5e-12   
gb|EAZ38296.1|  hypothetical protein OsJ_22674                        74.7    5e-12   
gb|EAZ02372.1|  hypothetical protein OsI_24476                        74.3    7e-12   
ref|XP_010246813.1|  PREDICTED: receptor protein kinase CLAVATA1-...  73.9    8e-12   
ref|XP_010941307.1|  PREDICTED: leucine-rich repeat receptor-like...  72.4    2e-11   
gb|EMT07441.1|  Receptor protein kinase CLAVATA1                      72.0    3e-11   
ref|XP_008808621.1|  PREDICTED: leucine-rich repeat receptor-like...  72.4    3e-11   
ref|XP_003560328.2|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  71.6    5e-11   
ref|XP_002439033.1|  hypothetical protein SORBIDRAFT_10g030270        71.2    7e-11   
gb|EMS49990.1|  Leucine-rich repeat receptor-like serine/threonin...  69.3    8e-11   
ref|XP_001754727.1|  CLL1A clavata1-like receptor S/T protein kin...  70.1    2e-10   
dbj|BAJ98758.1|  predicted protein                                    68.2    7e-10   
ref|XP_004966471.1|  PREDICTED: leucine-rich repeat receptor-like...  66.2    3e-09   
ref|XP_008233100.1|  PREDICTED: receptor protein kinase CLAVATA1-...  65.1    7e-09   
ref|XP_010943231.1|  PREDICTED: receptor-like protein kinase HAIKU2   64.7    9e-09   
gb|KJB60035.1|  hypothetical protein B456_009G286600                  64.3    1e-08   
ref|XP_007036373.1|  Receptor protein kinase, putative                63.9    1e-08   
ref|XP_009335176.1|  PREDICTED: probable LRR receptor-like serine...  63.9    1e-08   
ref|XP_002961203.1|  hypothetical protein SELMODRAFT_164315           63.9    1e-08   
ref|XP_002966807.1|  hypothetical protein SELMODRAFT_168561           63.9    1e-08   
ref|XP_009333803.1|  PREDICTED: receptor protein kinase CLAVATA1-...  63.5    2e-08   
ref|XP_008381896.1|  PREDICTED: probable LRR receptor-like serine...  63.5    2e-08   
ref|XP_008237456.1|  PREDICTED: probable LRR receptor-like serine...  63.5    2e-08   
ref|XP_007200794.1|  hypothetical protein PRUPE_ppa024591mg           63.5    2e-08   
ref|XP_009342709.1|  PREDICTED: probable LRR receptor-like serine...  63.5    2e-08   
ref|XP_002527087.1|  Leucine-rich repeat receptor protein kinase ...  63.5    2e-08   
gb|KCW69145.1|  hypothetical protein EUGRSUZ_F02681                   63.2    2e-08   
ref|XP_004253264.1|  PREDICTED: probable LRR receptor-like serine...  63.2    3e-08   
gb|KEH43634.1|  LRR receptor-like kinase                              62.8    3e-08   
ref|XP_010062076.1|  PREDICTED: probable LRR receptor-like serine...  62.8    3e-08   
gb|ACM89593.1|  leucine-rich repeat transmembrane protein kinase      62.8    4e-08   
gb|KDP26177.1|  hypothetical protein JCGZ_22271                       62.8    4e-08   
ref|XP_006383645.1|  leucine-rich repeat transmembrane protein ki...  62.4    5e-08   
ref|XP_006359059.1|  PREDICTED: probable LRR receptor-like serine...  62.0    6e-08   
ref|XP_009627806.1|  PREDICTED: probable LRR receptor-like serine...  62.0    6e-08   
ref|XP_011042912.1|  PREDICTED: probable LRR receptor-like serine...  62.0    6e-08   
ref|XP_009606121.1|  PREDICTED: probable LRR receptor-like serine...  62.0    6e-08   
ref|XP_009801201.1|  PREDICTED: probable LRR receptor-like serine...  62.0    7e-08   
ref|XP_009801200.1|  PREDICTED: probable LRR receptor-like serine...  62.0    7e-08   
ref|XP_003535558.1|  PREDICTED: probable LRR receptor-like serine...  61.6    8e-08   
emb|CDY28391.1|  BnaA05g18490D                                        61.6    8e-08   
ref|XP_010099105.1|  putative LRR receptor-like serine/threonine-...  61.6    8e-08   
gb|KHN03695.1|  Putative LRR receptor-like serine/threonine-prote...  61.6    8e-08   
ref|XP_011026324.1|  PREDICTED: probable LRR receptor-like serine...  61.6    8e-08   
emb|CAN61920.1|  hypothetical protein VITISV_038730                   61.6    9e-08   
ref|XP_011044836.1|  PREDICTED: probable LRR receptor-like serine...  61.6    9e-08   
ref|XP_003555414.1|  PREDICTED: probable LRR receptor-like serine...  61.6    1e-07   
ref|XP_007213482.1|  hypothetical protein PRUPE_ppa023389mg           61.2    1e-07   
ref|XP_009145155.1|  PREDICTED: probable LRR receptor-like serine...  61.2    1e-07   
ref|XP_002302156.2|  hypothetical protein POPTR_0002s06380g           61.2    1e-07   
ref|XP_007019650.1|  Leucine-rich receptor-like protein kinase fa...  61.2    1e-07   
ref|XP_007019651.1|  Leucine-rich receptor-like protein kinase fa...  61.2    1e-07   
ref|XP_004496421.1|  PREDICTED: probable LRR receptor-like serine...  60.8    1e-07   
ref|XP_006434540.1|  hypothetical protein CICLE_v10000119mg           60.8    1e-07   
ref|XP_006473875.1|  PREDICTED: probable LRR receptor-like serine...  60.8    1e-07   
ref|XP_007143588.1|  hypothetical protein PHAVU_007G084400g           60.8    2e-07   
ref|XP_010261052.1|  PREDICTED: probable LRR receptor-like serine...  60.8    2e-07   
gb|KDO69534.1|  hypothetical protein CISIN_1g001238mg                 60.8    2e-07   
ref|XP_006476839.1|  PREDICTED: probable LRR receptor-like serine...  60.8    2e-07   
ref|XP_004290506.2|  PREDICTED: probable LRR receptor-like serine...  60.5    2e-07   
ref|XP_006439880.1|  hypothetical protein CICLE_v10018599mg           60.5    2e-07   
emb|CBI14984.3|  unnamed protein product                              60.5    2e-07   
ref|XP_003634262.1|  PREDICTED: probable LRR receptor-like serine...  60.5    2e-07   
ref|XP_008337234.1|  PREDICTED: probable LRR receptor-like serine...  60.1    2e-07   
ref|XP_004163697.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  60.1    2e-07   
ref|XP_008378674.1|  PREDICTED: receptor-like protein kinase HSL1     60.1    2e-07   
ref|XP_004141006.1|  PREDICTED: probable LRR receptor-like serine...  60.1    3e-07   
gb|KGN46107.1|  hypothetical protein Csa_6G052820                     60.1    3e-07   
ref|XP_004149404.1|  PREDICTED: leucine-rich repeat receptor-like...  60.1    3e-07   
ref|XP_010941444.1|  PREDICTED: leucine-rich repeat receptor-like...  60.1    3e-07   
ref|XP_004159472.1|  PREDICTED: probable LRR receptor-like serine...  60.1    3e-07   
ref|XP_011074110.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  60.1    3e-07   
ref|XP_002263569.3|  PREDICTED: probable LRR receptor-like serine...  60.1    3e-07   
gb|KHN17047.1|  Putative LRR receptor-like serine/threonine-prote...  59.7    3e-07   
ref|XP_011000314.1|  PREDICTED: probable LRR receptor-like serine...  59.7    3e-07   
ref|XP_004299842.1|  PREDICTED: receptor-like protein kinase HSL1     59.7    3e-07   
emb|CAN69090.1|  hypothetical protein VITISV_009158                   59.7    3e-07   
ref|XP_002278051.2|  PREDICTED: leucine-rich repeat receptor-like...  59.7    3e-07   
ref|XP_008786583.1|  PREDICTED: probable LRR receptor-like serine...  59.7    3e-07   
ref|XP_008244993.1|  PREDICTED: probable LRR receptor-like serine...  59.7    4e-07   
ref|XP_010915077.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  59.7    4e-07   
emb|CBI29847.3|  unnamed protein product                              59.7    4e-07   
ref|XP_004298973.1|  PREDICTED: probable LRR receptor-like serine...  59.7    4e-07   
ref|XP_010478828.1|  PREDICTED: probable LRR receptor-like serine...  59.7    4e-07   
ref|XP_010499950.1|  PREDICTED: probable LRR receptor-like serine...  59.3    4e-07   
ref|XP_004252636.1|  PREDICTED: probable LRR receptor-like serine...  59.3    4e-07   
ref|XP_007028772.1|  Leucine-rich repeat protein kinase family pr...  59.3    4e-07   
ref|XP_010461237.1|  PREDICTED: probable LRR receptor-like serine...  59.3    4e-07   
ref|XP_011461954.1|  PREDICTED: cysteine-rich receptor-like prote...  57.0    4e-07   
emb|CBI29365.3|  unnamed protein product                              59.3    4e-07   
ref|XP_006411451.1|  hypothetical protein EUTSA_v10016216mg           59.3    5e-07   
gb|KJB29385.1|  hypothetical protein B456_005G097600                  59.3    5e-07   
ref|XP_008378672.1|  PREDICTED: receptor-like protein kinase HAIKU2   59.3    5e-07   
ref|XP_010923415.1|  PREDICTED: leucine-rich repeat receptor-like...  59.3    5e-07   
ref|XP_008804371.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  59.3    5e-07   
ref|XP_002445434.1|  hypothetical protein SORBIDRAFT_07g019130        59.3    5e-07   
ref|XP_002323316.2|  leucine-rich repeat transmembrane protein ki...  59.3    5e-07   
ref|XP_011015844.1|  PREDICTED: leucine-rich repeat receptor-like...  58.9    5e-07   
ref|XP_011033329.1|  PREDICTED: leucine-rich repeat receptor-like...  58.9    5e-07   
ref|XP_002993327.1|  hypothetical protein SELMODRAFT_187390           58.9    5e-07   
ref|XP_008460767.1|  PREDICTED: leucine-rich repeat receptor-like...  58.9    6e-07   
ref|XP_010554836.1|  PREDICTED: leucine-rich repeat receptor-like...  58.9    6e-07   
ref|XP_008456724.1|  PREDICTED: probable LRR receptor-like serine...  58.9    6e-07   
ref|XP_008466102.1|  PREDICTED: receptor-like protein kinase HAIKU2   58.9    6e-07   
ref|XP_009374467.1|  PREDICTED: leucine-rich repeat receptor-like...  58.9    6e-07   



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score =   167 bits (424),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 87/116 (75%), Positives = 93/116 (80%), Gaps = 8/116 (7%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SGKKPVGE GDGVDIVQWVR+MTDGKKEGV+KILD RLSTVP+HE MH+FYVA+LCVEEQ
Sbjct  892   SGKKPVGEFGDGVDIVQWVRRMTDGKKEGVLKILDPRLSTVPLHEVMHVFYVAMLCVEEQ  951

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACES-----SALEPPPSTGTSDDAKD  278
             AVERPKMREVVQMLTELPK P G K E +T  ES      ALE P  T T  D KD
Sbjct  952   AVERPKMREVVQMLTELPK-PSGPKTEDSTITESPPSSGPALESP--TSTPGDTKD  1004



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score =   167 bits (423),  Expect = 9e-44, Method: Composition-based stats.
 Identities = 79/109 (72%), Positives = 92/109 (84%), Gaps = 6/109 (6%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SGKKPVGE GDGVDIVQWVR+MTDGKKEGV+KILD+RLSTVP+HE MH+FYVA+LCVEEQ
Sbjct  892  SGKKPVGEFGDGVDIVQWVRRMTDGKKEGVLKILDARLSTVPLHEVMHVFYVAMLCVEEQ  951

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDA  284
            AVERPKMREVVQMLTELP      KP G  + +S+  E PPS+G + ++
Sbjct  952  AVERPKMREVVQMLTELP------KPSGPKSGDSTITESPPSSGPASES  994



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score =   163 bits (413),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 87/133 (65%), Positives = 98/133 (74%), Gaps = 17/133 (13%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SG+KPVGE GDGVDIVQWVRKMT+GKKEGV+KILD RLSTVP+HE MH+FYVA+LCVEEQ
Sbjct  889   SGRKPVGEFGDGVDIVQWVRKMTEGKKEGVLKILDPRLSTVPLHEVMHVFYVAMLCVEEQ  948

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-----------GTSDDA  284
             AVERPKMREVVQ+LTELP       P GT + ES+  E PPS+           G + D 
Sbjct  949   AVERPKMREVVQILTELP------NPSGTKSGESTITESPPSSAPASELPTSAPGNTKDN  1002

Query  283   KDqqqppPDLLSI  245
                  PPPDLLSI
Sbjct  1003  HQPPSPPPDLLSI  1015



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score =   162 bits (409),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 93/132 (70%), Positives = 102/132 (77%), Gaps = 13/132 (10%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SGKKPVGE GDGVDIVQWVRKMTDGKK+GV+KILD RLSTVP++E MH+FYVA+LCVEEQ
Sbjct  889   SGKKPVGEFGDGVDIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVAMLCVEEQ  948

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACES-----SALEPPPSTGTSDDAKD----  278
             AVERP MREVVQ+LTELPK PPG+K   +T  ES     SALE P  T    D KD    
Sbjct  949   AVERPTMREVVQILTELPK-PPGSKSGDSTVTESPSPSASALESP--TSAPGDTKDHHQP  1005

Query  277   -qqqppPDLLSI  245
               Q PPPDLLSI
Sbjct  1006  TPQSPPPDLLSI  1017



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score =   161 bits (407),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 92/132 (70%), Positives = 102/132 (77%), Gaps = 13/132 (10%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SGKKPVGE GDGVDIVQWVRKMTDGKK+GV+KILD RLSTVP++E MH+FYVALLCVEEQ
Sbjct  887   SGKKPVGEFGDGVDIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQ  946

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACE-----SSALEPPPSTGTSDDAKD----  278
             AVERP MREVVQ+LTELPK PPG K + +T  +     +SALE P  T    D KD    
Sbjct  947   AVERPTMREVVQILTELPK-PPGAKSDDSTGTDHSPPSASALESP--TSIPGDTKDHHQP  1003

Query  277   -qqqppPDLLSI  245
               Q PPPDLLSI
Sbjct  1004  TPQSPPPDLLSI  1015



>gb|KHN13035.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=724

 Score =   159 bits (401),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 86/127 (68%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  600  TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQ  659

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqp  266
            AVERP MREVVQ+LTELPK PPG+K    T  ESS     ALE  PS+ + +D    Q P
Sbjct  660  AVERPTMREVVQILTELPK-PPGSKEGDLTITESSLSSSNALE-SPSSASKEDQNPPQSP  717

Query  265  pPDLLSI  245
            PPDLLSI
Sbjct  718  PPDLLSI  724



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score =   160 bits (406),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 88/131 (67%), Positives = 101/131 (77%), Gaps = 10/131 (8%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SGKKPVGE GDGVDIVQWVRKMTDGKK+GV+KILD RLSTVP++E MH+FYVA+LCVEEQ
Sbjct  890   SGKKPVGEFGDGVDIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVAMLCVEEQ  949

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACE------SSALEPPPS-TGTSDDAKDqq  272
             AVERP MREVVQ+LTELPK PPG+K   +T  E      +SALE P S +G ++D     
Sbjct  950   AVERPTMREVVQILTELPK-PPGSKSGDSTVTELPPPSVASALESPASASGDTNDHHQPT  1008

Query  271   qpp--PDLLSI  245
                  PDLLSI
Sbjct  1009  PQSPPPDLLSI  1019



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score =   160 bits (406),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 92/132 (70%), Positives = 102/132 (77%), Gaps = 13/132 (10%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SGKKPVGE GDGVDIVQWVRKMTDGKK+GV+KILD RLSTVP++E MH+FYVALLCVEEQ
Sbjct  888   SGKKPVGEFGDGVDIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQ  947

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACE-----SSALEPPPSTGTSDDAKD----  278
             AVERP MREVVQ+LTELPK PPG K + +T  +     +SALE P  T    D KD    
Sbjct  948   AVERPTMREVVQILTELPK-PPGAKSDDSTVTDQSPPSASALESP--TSIPGDTKDHHQP  1004

Query  277   -qqqppPDLLSI  245
               Q PPPDLLSI
Sbjct  1005  TPQSPPPDLLSI  1016



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score =   160 bits (405),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 92/132 (70%), Positives = 102/132 (77%), Gaps = 13/132 (10%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SGKKPVGE GDGVDIVQWVRKMTDGKK+GV+KILD RLSTVP++E MH+FYVALLCVEEQ
Sbjct  888   SGKKPVGEFGDGVDIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQ  947

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACE-----SSALEPPPSTGTSDDAKD----  278
             AVERP MREVVQ+LTELPK PPG K + +T  +     +SALE P  T    D KD    
Sbjct  948   AVERPTMREVVQILTELPK-PPGAKSDDSTVTDQSPPSASALESP--TSIPGDTKDHHQP  1004

Query  277   -qqqppPDLLSI  245
               Q PPPDLLSI
Sbjct  1005  TPQSPPPDLLSI  1016



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score =   159 bits (403),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KE VVK++D RLS+VPI E  H+FYVA+LCVEEQ
Sbjct  895   TGRKPVGEFGDGVDIVQWVRKMTDSNKESVVKVIDPRLSSVPIQEVTHVFYVAMLCVEEQ  954

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLL  251
             AVERP MREVVQ+L E+PK PP +KP+ T   +S A E  P  G  DD  D  + PPDLL
Sbjct  955   AVERPTMREVVQILAEIPKMPP-SKPDPTAGEKSPAHESSPKGGRGDDGNDPGRVPPDLL  1013

Query  250   SI  245
             SI
Sbjct  1014  SI  1015



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score =   159 bits (402),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 86/127 (68%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  888   TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQ  947

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqp  266
             AVERP MREVVQ+LTELPK PPG+K    T  ESS     ALE  PS+ + +D    Q P
Sbjct  948   AVERPTMREVVQILTELPK-PPGSKEGDLTITESSLSSSNALE-SPSSASKEDQNPPQSP  1005

Query  265   pPDLLSI  245
             PPDLLSI
Sbjct  1006  PPDLLSI  1012



>ref|XP_010518800.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1011

 Score =   158 bits (400),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KE VVK+LD RLS+VPI+E MH+FYVA+LCVEE 
Sbjct  891   TGRKPVGEFGDGVDIVQWVRKMTDSNKESVVKVLDPRLSSVPINEVMHVFYVAMLCVEEL  950

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLL  251
             AVERP MREVVQ+LTE+PK  P  KPE   A +S A +  P  G+  D  D  + PPDLL
Sbjct  951   AVERPTMREVVQILTEIPKMRP-PKPEPNAAEDSPAYQSSPMAGSGKDGNDVSRDPPDLL  1009

Query  250   SI  245
             SI
Sbjct  1010  SI  1011



>gb|KHN42601.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=724

 Score =   156 bits (395),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 85/127 (67%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  600  TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQ  659

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqp  266
            AVERP MREVVQ+LTELPK PP +K    T  ESS     ALE  PS+ + +D    Q P
Sbjct  660  AVERPTMREVVQILTELPK-PPDSKEGNLTITESSLSSSNALE-SPSSASKEDQNPPQSP  717

Query  265  pPDLLSI  245
            PPDLLSI
Sbjct  718  PPDLLSI  724



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score =   157 bits (398),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 79/105 (75%), Positives = 87/105 (83%), Gaps = 5/105 (5%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQWVRKMTD  KEGV+KILD RL +VPIHE MH+FYVA+LCVEEQ
Sbjct  891  SGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPIHEVMHVFYVAMLCVEEQ  950

Query  430  AVERPKMREVVQMLTELPKQPPGTKP-EGTTACESSALEPPPSTG  299
            AVERP MREVVQ+LTELPK PPG+K  + TT  ESS   PPP  G
Sbjct  951  AVERPTMREVVQILTELPK-PPGSKQGDSTTITESS---PPPVGG  991



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score =   157 bits (397),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 90/134 (67%), Positives = 101/134 (75%), Gaps = 16/134 (12%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SGKKPVGE GDGVDIVQWVRKMTDGKK+GV+KILD RLSTVP++E MH+FYVALLCVEEQ
Sbjct  888   SGKKPVGEFGDGVDIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQ  947

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS-------TGTSDDAKD--  278
             AVERP MREVVQ+LTELPK  PG K + +T  + S   PPPS       T   ++ KD  
Sbjct  948   AVERPTMREVVQILTELPKS-PGAKSDDSTVTDQS---PPPSDSALESPTSIPEETKDHH  1003

Query  277   ---qqqppPDLLSI  245
                 Q PPPDLLSI
Sbjct  1004  QPTPQSPPPDLLSI  1017



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score =   156 bits (395),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 88/132 (67%), Positives = 97/132 (73%), Gaps = 13/132 (10%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SG+KPVGE GDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  887   SGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQ  946

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-------GTSDDAKDq-  275
             AVERP MREVVQ+LTELPK P     E +   ESS   PPP+T        TS D KDQ 
Sbjct  947   AVERPTMREVVQILTELPKAPGSKLVEDSAITESS---PPPATTASESPGTTSKDTKDQP  1003

Query  274   --qqppPDLLSI  245
               Q P PDLLSI
Sbjct  1004  PLQSPQPDLLSI  1015



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score =   156 bits (395),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 85/127 (67%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  888   TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQ  947

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqp  266
             AVERP MREVVQ+LTELPK PP +K    T  ESS     ALE  PS+ + +D    Q P
Sbjct  948   AVERPTMREVVQILTELPK-PPDSKEGNLTITESSLSSSNALE-SPSSASKEDQNPPQSP  1005

Query  265   pPDLLSI  245
             PPDLLSI
Sbjct  1006  PPDLLSI  1012



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score =   156 bits (395),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 89/132 (67%), Positives = 98/132 (74%), Gaps = 13/132 (10%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SG+KPVGE GDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  887   SGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQ  946

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-------GTSDDAKDq-  275
             AVERP MREVVQ+LTELPK P     E +   ESS   PPP+T        TS D KDQ 
Sbjct  947   AVERPTMREVVQILTELPKAPGSKLVEDSAITESS---PPPATTASESPGTTSKDTKDQP  1003

Query  274   --qqppPDLLSI  245
               Q PPPDLLSI
Sbjct  1004  PLQSPPPDLLSI  1015



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score =   156 bits (395),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 88/132 (67%), Positives = 97/132 (73%), Gaps = 13/132 (10%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SG+KPVGE GDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  886   SGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHLFYVAMLCVEEQ  945

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-------GTSDDAKD--  278
             AVERP MREVVQ+LTELPK P     E +   ESS   PPP+T        TS D KD  
Sbjct  946   AVERPTMREVVQILTELPKGPGSKLVEESAITESS---PPPATTASESQGTTSKDMKDQP  1002

Query  277   -qqqppPDLLSI  245
               Q PPPDLLSI
Sbjct  1003  PPQSPPPDLLSI  1014



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score =   156 bits (395),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 89/132 (67%), Positives = 98/132 (74%), Gaps = 13/132 (10%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SG+KPVGE GDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  887   SGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQ  946

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-------GTSDDAKDq-  275
             AVERP MREVVQ+LTELPK P     E +   ESS   PPP+T        TS D KDQ 
Sbjct  947   AVERPTMREVVQILTELPKAPGSKLVEDSAITESS---PPPATTASESPGTTSKDTKDQP  1003

Query  274   --qqppPDLLSI  245
               Q PPPDLLSI
Sbjct  1004  PLQSPPPDLLSI  1015



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score =   156 bits (394),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 86/132 (65%), Positives = 95/132 (72%), Gaps = 13/132 (10%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SG+KPVGE GDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  886   SGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLXSVPLHEVMHVFYVAMLCVEEQ  945

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTG-------TSDDAKDqq  272
             AVERP MREVVQ+LTELPK P     E +   ESS   PPP+T        TS D KDQ 
Sbjct  946   AVERPTMREVVQILTELPKGPGSKLVEESAITESS---PPPATXASESPGTTSKDTKDQP  1002

Query  271   qppP---DLLSI  245
              P     DLLSI
Sbjct  1003  PPQSLPPDLLSI  1014



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score =   155 bits (393),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 77/123 (63%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = -2

Query  607   GKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQA  428
             G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQA
Sbjct  894   GRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQA  953

Query  427   VERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppP--DL  254
             VERP MREVVQ+LTELPK P    P     C  + L+PP +T T D  +         DL
Sbjct  954   VERPTMREVVQILTELPKPPNSESPTSPAPC--TTLDPPTTTITKDQQQPPAPKSTPPDL  1011

Query  253   LSI  245
             LSI
Sbjct  1012  LSI  1014



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score =   155 bits (392),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 95/122 (78%), Gaps = 2/122 (2%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTDG KEGV+K+LD RL TVP+HE MH+FYVA+LCVEEQ
Sbjct  889   TGRKPVGEFGDGVDIVQWVRKMTDGNKEGVLKVLDPRLPTVPLHEVMHVFYVAMLCVEEQ  948

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLL  251
             AVERP MREV+Q+LTELPK P   KP  +T  +SS   P   T T  + +  Q PPPDLL
Sbjct  949   AVERPTMREVIQILTELPK-PTAAKPGDSTITDSSVDSPATETKTH-NRQASQSPPPDLL  1006

Query  250   SI  245
             SI
Sbjct  1007  SI  1008



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score =   154 bits (390),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 77/111 (69%), Positives = 88/111 (79%), Gaps = 6/111 (5%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  889  SGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQ  948

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKD  278
            AVERP MREVVQ+LTELPK PP +K   +T  ES      PS GTS D+ +
Sbjct  949  AVERPTMREVVQILTELPK-PPNSKQGDSTVTESL-----PSPGTSLDSPN  993



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score =   154 bits (390),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 85/130 (65%), Positives = 96/130 (74%), Gaps = 9/130 (7%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SG+KPVGE GDG+DIVQWVRKMT+GKKEGV+KILD RLSTVP+HE +H+FYVA+LCVEEQ
Sbjct  891   SGRKPVGEFGDGIDIVQWVRKMTEGKKEGVLKILDPRLSTVPLHEVIHVFYVAMLCVEEQ  950

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS---TGTSDDAKD-----q  275
             AVERPKMREVVQ+LTELP  P  TK   +T  ES     P S   T    + KD      
Sbjct  951   AVERPKMREVVQILTELP-TPSNTKSGDSTITESLPSSAPASESPTSAPGNTKDNHQPPP  1009

Query  274   qqppPDLLSI  245
             Q P PDLLSI
Sbjct  1010  QSPQPDLLSI  1019



>gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score =   154 bits (389),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 82/128 (64%), Positives = 95/128 (74%), Gaps = 7/128 (5%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  887   TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQ  946

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESS----ALEPPPSTGTSDDAKDqqqpp  263
             A+ERP MREVVQ+LTELPK PP +K    T  ESS    A    P+  T+ D KD Q P 
Sbjct  947   AIERPTMREVVQILTELPK-PPNSKQGDLTVTESSPQSAATLDSPNAATTRDQKDHQSPQ  1005

Query  262   P--DLLSI  245
                DLLSI
Sbjct  1006  SPPDLLSI  1013



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score =   154 bits (389),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 83/125 (66%), Positives = 97/125 (78%), Gaps = 5/125 (4%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQW RKMTD  KE V+K+LD RLS+VP+H+ MH+FYVA+LCVEEQ
Sbjct  883   TGRKPVGEFGDGVDIVQWARKMTDSNKEEVLKVLDPRLSSVPLHDVMHVFYVAMLCVEEQ  942

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTA---CESSALEPPPSTGTSDDAKDqqqppP  260
             AVERP MREVVQ+LTELP+ PPG+K E  T      S+ALE  PST + D     Q PPP
Sbjct  943   AVERPTMREVVQILTELPR-PPGSKQEDLTESSLSSSNALE-SPSTASKDRQNPSQSPPP  1000

Query  259   DLLSI  245
             DLLSI
Sbjct  1001  DLLSI  1005



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score =   154 bits (389),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 84/126 (67%), Positives = 94/126 (75%), Gaps = 5/126 (4%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTDG KEGV+K+LD RL TVP+HE MH+FYVA+LCVEEQ
Sbjct  891   TGRKPVGEFGDGVDIVQWVRKMTDGNKEGVLKVLDPRLPTVPLHEVMHVFYVAMLCVEEQ  950

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACES----SALEPPPSTGTSDDAKDqqqpp  263
             AVERP MREVVQ+L+ELPK P G KP      ES    S LE P +   S      Q PP
Sbjct  951   AVERPTMREVVQILSELPK-PHGAKPGDPAPTESPPPASILESPATDPESHHPNPPQSPP  1009

Query  262   PDLLSI  245
             PDLLSI
Sbjct  1010  PDLLSI  1015



>ref|XP_002531999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30398.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=1021

 Score =   153 bits (387),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 85/133 (64%), Positives = 100/133 (75%), Gaps = 14/133 (11%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  892   TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQ  951

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqp  266
             A+ERP MREVVQ+LTELPK PP +K   +T  ESS     +L+ P +  TS D KD QQP
Sbjct  952   AIERPTMREVVQILTELPK-PPNSKQGDSTVTESSPQSATSLDSPKA--TSKDPKDNQQP  1008

Query  265   p------PDLLSI  245
                    PDLLSI
Sbjct  1009  ALPQSPPPDLLSI  1021



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   152 bits (385),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 93/122 (76%), Gaps = 4/122 (3%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTDG KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  892   AGRKPVGEFGDGVDIVQWVRKMTDGNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQ  951

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLL  251
             AVERP MREVVQ+L E+PK PPGT P+   A   S LE P     +      + PPPDLL
Sbjct  952   AVERPTMREVVQILLEIPK-PPGTTPKQGDA---SPLESPQRPTDAIVGSPTKSPPPDLL  1007

Query  250   SI  245
             SI
Sbjct  1008  SI  1009



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score =   152 bits (385),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 78/111 (70%), Positives = 89/111 (80%), Gaps = 9/111 (8%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SGKKPVGE GDGVDIVQWVRKMTD  KEGV+KILDSRL +VP+HE MH+FYVA+LCVEEQ
Sbjct  896   SGKKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDSRLPSVPLHEVMHVFYVAMLCVEEQ  955

Query  430   AVERPKMREVVQMLTELPKQPPGTKP--EGTTACES------SALEPPPST  302
             AVERP MREVVQ+LTELP  PPG+K   E TT  +S      +A+E P +T
Sbjct  956   AVERPTMREVVQILTELPI-PPGSKQVGETTTVTDSPQQSAITAIESPTTT  1005



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   152 bits (385),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 79/117 (68%), Positives = 89/117 (76%), Gaps = 11/117 (9%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQWVRKMTDG KEGV+KILD RL TVP+HE MH+FYVA+LCVEEQ
Sbjct  889  SGRKPVGEFGDGVDIVQWVRKMTDGNKEGVLKILDPRLPTVPLHEVMHVFYVAMLCVEEQ  948

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS------TGTSDDAKD  278
            AVERP MREVVQ+LTELPK P   K   +T  ES    PPP+      + T  D+KD
Sbjct  949  AVERPTMREVVQILTELPK-PANGKQGDSTDTES----PPPASTVESPSTTPVDSKD  1000



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score =   152 bits (385),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 86/107 (80%), Gaps = 5/107 (5%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQWVRKMTD  KEGV+KILD+RL TVP+HE MH+FYVA+LCVEEQ
Sbjct  890  SGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDTRLPTVPLHEVMHVFYVAMLCVEEQ  949

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESS----ALEPPPST  302
            AVERP MREVVQ+LTELPK PP +K   +   ESS     LE P +T
Sbjct  950  AVERPTMREVVQILTELPK-PPSSKQGDSIVTESSPPSCTLESPTTT  995



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score =   152 bits (384),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 76/123 (62%), Positives = 88/123 (72%), Gaps = 4/123 (3%)
 Frame = -2

Query  607   GKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQA  428
             G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQA
Sbjct  894   GRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQA  953

Query  427   VERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppP--DL  254
             VERP MREVVQ+LTELPK P          C  + L+PP +T T D  +         DL
Sbjct  954   VERPTMREVVQILTELPKPPNSESTTSPAPC--TTLDPPTTTITKDQQQPPAPKSTPPDL  1011

Query  253   LSI  245
             LSI
Sbjct  1012  LSI  1014



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score =   152 bits (383),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 76/122 (62%), Positives = 89/122 (73%), Gaps = 4/122 (3%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  888   AGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQ  947

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLL  251
             AVERP MREVVQMLTELPK P     E  T      +   PS  +S+  +   + P DLL
Sbjct  948   AVERPTMREVVQMLTELPKPPTSKHVEDLTL----TITESPSLASSNSLESPSKEPKDLL  1003

Query  250   SI  245
             SI
Sbjct  1004  SI  1005



>gb|KJB43996.1| hypothetical protein B456_007G228700 [Gossypium raimondii]
Length=866

 Score =   151 bits (382),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 81/128 (63%), Positives = 97/128 (76%), Gaps = 6/128 (5%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQWVRK T+  KEGV+KILD RLS+VP++E MH+FYVA+LCVEEQ
Sbjct  739  SGRKPVGEFGDGVDIVQWVRKTTNSNKEGVLKILDPRLSSVPLYEVMHVFYVAMLCVEEQ  798

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEG-TTACESSALEPP-----PSTGTSDDAKDqqq  269
            AVERP MREVVQ+LTE+PK P   + +G +T  ESS +  P     P    + + KDQ  
Sbjct  799  AVERPTMREVVQILTEVPKPPSSKQQQGDSTITESSPISQPTTLESPRDARTKEPKDQHT  858

Query  268  ppPDLLSI  245
            PPPDLLSI
Sbjct  859  PPPDLLSI  866



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score =   151 bits (382),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 83/107 (78%), Gaps = 2/107 (2%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  886  SGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQ  945

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  290
            AVERP MREVVQ+LTELPK P   +  G +A   S   PP  T  S+
Sbjct  946  AVERPTMREVVQILTELPKAPGSKQGGGDSAITESF--PPSGTSASE  990



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score =   151 bits (381),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 86/107 (80%), Gaps = 5/107 (5%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQWVRKMTD  KEGV+KILD+RL TVP+HE MH+FYVA+LCVEEQ
Sbjct  821  SGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDTRLPTVPLHEVMHVFYVAMLCVEEQ  880

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESS----ALEPPPST  302
            AVERP MREVVQ+LTELPK PP +K   +   ESS     LE P +T
Sbjct  881  AVERPTMREVVQILTELPK-PPSSKQGDSIVTESSPPSCTLESPTTT  926



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score =   151 bits (382),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 73/101 (72%), Positives = 84/101 (83%), Gaps = 8/101 (8%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  884  TGRKPVGEFGDGVDIVQWVRKMTDSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQ  943

Query  430  AVERPKMREVVQMLTELPKQPPGTK-------PEGTTACES  329
            AVERP MREVVQ+LTELPK PP +K       P GTT+ +S
Sbjct  944  AVERPTMREVVQILTELPK-PPTSKQGEESLPPSGTTSLDS  983



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score =   151 bits (381),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 73/101 (72%), Positives = 84/101 (83%), Gaps = 8/101 (8%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  884  TGRKPVGEFGDGVDIVQWVRKMTDSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQ  943

Query  430  AVERPKMREVVQMLTELPKQPPGTK-------PEGTTACES  329
            AVERP MREVVQ+LTELPK PP +K       P GTT+ +S
Sbjct  944  AVERPTMREVVQILTELPK-PPTSKQGEESLPPSGTTSLDS  983



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score =   151 bits (381),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 73/101 (72%), Positives = 84/101 (83%), Gaps = 8/101 (8%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  886  TGRKPVGEFGDGVDIVQWVRKMTDSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQ  945

Query  430  AVERPKMREVVQMLTELPKQPPGTK-------PEGTTACES  329
            AVERP MREVVQ+LTELPK PP +K       P GTT+ +S
Sbjct  946  AVERPTMREVVQILTELPK-PPTSKQGEESLPPSGTTSLDS  985



>ref|XP_008237309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Prunus mume]
Length=968

 Score =   150 bits (379),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 83/107 (78%), Gaps = 2/107 (2%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  837  SGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQ  896

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  290
            AVERP MREVVQ+LTELPK P   +  G +A   S   PP  T  S+
Sbjct  897  AVERPTMREVVQILTELPKAPGSKQGGGDSAITESF--PPSGTSASE  941



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score =   150 bits (380),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 79/124 (64%), Positives = 92/124 (74%), Gaps = 3/124 (2%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RLS+VP+HE  H+FYVA+LCVEEQ
Sbjct  887   TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLSSVPLHEVTHVFYVAILCVEEQ  946

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS--TGTSDDAKDqqqppPD  257
             AVERP MREVVQ+LTELP  PP +K   +T  ESS      S    + D+      PPPD
Sbjct  947   AVERPTMREVVQILTELP-MPPESKQGDSTITESSLSNASESLTAASKDNQHPPPSPPPD  1005

Query  256   LLSI  245
             LLSI
Sbjct  1006  LLSI  1009



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score =   150 bits (378),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 83/126 (66%), Positives = 96/126 (76%), Gaps = 5/126 (4%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LDSRL +VP+HE MH+FYVA+LCVEEQ
Sbjct  884   TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDSRLPSVPLHEVMHVFYVAMLCVEEQ  943

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKD----qqqpp  263
             AVERP MREVVQ+LTELPK PP +K   T +  SS+      T  S + KD     Q PP
Sbjct  944   AVERPTMREVVQILTELPK-PPSSKHAITESSLSSSNSLGSPTTASKEPKDNQHPPQSPP  1002

Query  262   PDLLSI  245
             PDLLSI
Sbjct  1003  PDLLSI  1008



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score =   150 bits (378),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 81/129 (63%), Positives = 95/129 (74%), Gaps = 8/129 (6%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  893   TGRKPVGEFGDGVDIVQWVRKMTDSIKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQ  952

Query  430   AVERPKMREVVQMLTELPKQPPG-------TKPEGTTACESSALEPPPSTGTSDDAKDqq  272
             AVERP MREVVQ+LTELPK P         T+P   +A  ++AL+ P ST        QQ
Sbjct  953   AVERPTMREVVQILTELPKSPSSKQGDSIITEPSPHSAA-TAALDSPSSTAKDVPKDHQQ  1011

Query  271   qppPDLLSI  245
              PP DLLSI
Sbjct  1012  PPPADLLSI  1020



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score =   149 bits (377),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 81/129 (63%), Positives = 95/129 (74%), Gaps = 8/129 (6%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  893   TGRKPVGEFGDGVDIVQWVRKMTDSIKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQ  952

Query  430   AVERPKMREVVQMLTELPKQPPG-------TKPEGTTACESSALEPPPSTGTSDDAKDqq  272
             AVERP MREVVQ+LTELPK P         T+P   +A  ++AL+ P ST        QQ
Sbjct  953   AVERPTMREVVQILTELPKSPSSKQGDSVITEPSPHSAA-TAALDSPSSTAKDVPKDHQQ  1011

Query  271   qppPDLLSI  245
              PP DLLSI
Sbjct  1012  PPPADLLSI  1020



>gb|KHN47566.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=725

 Score =   148 bits (373),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 83/126 (66%), Positives = 96/126 (76%), Gaps = 5/126 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LDSRL +VP+HE MH+FYVA+LCVEEQ
Sbjct  601  TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDSRLPSVPLHEVMHVFYVAMLCVEEQ  660

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKD----qqqpp  263
            AVERP MREVVQ+LTELPK PP +K   T +  SS+      T  S + KD     Q PP
Sbjct  661  AVERPTMREVVQILTELPK-PPSSKHAITESSLSSSNSLGSPTTASKEPKDNQHPPQSPP  719

Query  262  PDLLSI  245
            PDLLSI
Sbjct  720  PDLLSI  725



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score =   149 bits (376),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 82/127 (65%), Positives = 92/127 (72%), Gaps = 8/127 (6%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SG+KPVGE GDGVDIVQWVRKMT+ KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  890   SGRKPVGEFGDGVDIVQWVRKMTNSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQ  949

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACES-----SALEPPPSTGTSDDAKDqqqp  266
             AVERP MREVVQ+LTELPK    +K    T  ES     S LE P +  T D       P
Sbjct  950   AVERPTMREVVQILTELPK-ASDSKQRDPTVTESSHSPTSTLESPNNATTKDPMPQ--SP  1006

Query  265   pPDLLSI  245
              PDLLSI
Sbjct  1007  TPDLLSI  1013



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score =   149 bits (376),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 72/102 (71%), Positives = 83/102 (81%), Gaps = 4/102 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  893  SGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQ  952

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS  305
            AVERP MREVVQ+LTELPK PP +K   +T    + +E  PS
Sbjct  953  AVERPTMREVVQILTELPK-PPNSKQGDSTI---TTMESSPS  990



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score =   149 bits (376),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 80/126 (63%), Positives = 91/126 (72%), Gaps = 6/126 (5%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SG+KPVGE GDGVDIVQWVRKMT+ KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  890   SGRKPVGEFGDGVDIVQWVRKMTNSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQ  949

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACES----SALEPPPSTGTSDDAKDqqqpp  263
             AVERP MREVVQ+LTELPK     + + T    S    S LE P +  T D       P 
Sbjct  950   AVERPTMREVVQILTELPKASDSKQGDPTVTESSHSPTSTLESPNNATTKDPMPQ--SPT  1007

Query  262   PDLLSI  245
             PDLLSI
Sbjct  1008  PDLLSI  1013



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score =   149 bits (376),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 74/105 (70%), Positives = 85/105 (81%), Gaps = 4/105 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD   +GV+KILD RL TVP++E MH+FYVALLCVEEQ
Sbjct  885  TGRKPVGEFGDGVDIVQWVRKMTDSNVDGVLKILDPRLPTVPLNEVMHVFYVALLCVEEQ  944

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGT  296
            AVERP MREVVQ+LTELPK PP +KP  +   ESS   P P+T T
Sbjct  945  AVERPTMREVVQILTELPK-PPSSKPADSAIPESS---PSPATTT  985



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score =   148 bits (373),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 70/106 (66%), Positives = 83/106 (78%), Gaps = 2/106 (2%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  890  SGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQ  949

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTS  293
            AVERP MREVVQ+LTELPK P     +G++A   S+     + G +
Sbjct  950  AVERPTMREVVQILTELPKAP--ISKQGSSAMTESSPSAAATAGET  993



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score =   147 bits (372),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 82/127 (65%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RLS+VP+ E MH+FYVA+LCVEEQ
Sbjct  890   TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLSSVPLQEVMHVFYVAILCVEEQ  949

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqp  266
             AVERP MREVVQ+LTELPK    +K   +T  ESS     ALE  P+  + D     Q P
Sbjct  950   AVERPTMREVVQILTELPKSTE-SKLGDSTITESSLSSSNALE-SPTAASKDHQHPPQSP  1007

Query  265   pPDLLSI  245
             PPDLLSI
Sbjct  1008  PPDLLSI  1014



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score =   147 bits (372),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQ
Sbjct  893  TGRKPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQ  952

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP  314
            AVERP MREVVQ+LTE+PK PP      T +   S L P
Sbjct  953  AVERPTMREVVQILTEIPKLPPSKDQTTTESTPESELSP  991



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 ref|XP_004163335.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score =   147 bits (371),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 83/131 (63%), Positives = 99/131 (76%), Gaps = 10/131 (8%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SG+KPVGE GDGVDIVQWVRKMTD  KE VVKILD RLS+VP+HE MH+FYVA+LCVEEQ
Sbjct  890   SGRKPVGEFGDGVDIVQWVRKMTDSNKEEVVKILDPRLSSVPLHEVMHVFYVAMLCVEEQ  949

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTAC--------ESSALEPPPSTGTSDDAK-D  278
             AVERP MREV+Q+L+E+P QPP +K  G +           ++A    P+TGT +  +  
Sbjct  950   AVERPTMREVIQILSEIP-QPPSSKQGGDSTLPNSSPPPPPTAADLDLPTTGTKNKKEHQ  1008

Query  277   qqqppPDLLSI  245
             QQQPPPDLLSI
Sbjct  1009  QQQPPPDLLSI  1019



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score =   147 bits (370),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 80/129 (62%), Positives = 93/129 (72%), Gaps = 8/129 (6%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  891   TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQ  950

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTS--DDAKDqq  272
             AVERP MREVVQ+LTELPK    +K    T  ESS     +LE P +      D+    Q
Sbjct  951   AVERPTMREVVQILTELPKS-ASSKQGDLTITESSLPSSNSLESPTTASMEPKDNQHLPQ  1009

Query  271   qppPDLLSI  245
               PPDLLSI
Sbjct  1010  SSPPDLLSI  1018



>ref|XP_006852730.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score =   146 bits (369),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 81/129 (63%), Positives = 95/129 (74%), Gaps = 7/129 (5%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD KKEGV+ ILD RL TVP+HEAMH+FYVA+LCVEEQ
Sbjct  889   TGRKPVGEFGDGVDIVQWVRKMTDSKKEGVLNILDPRLPTVPLHEAMHVFYVAMLCVEEQ  948

Query  430   AVERPKMREVVQMLTELPKQP----PGTKPEGTTACESSALEPP-PSTGTSDDAKD--qq  272
             +VERP MREVVQ+LT+LPK P    P T+  G      ++ EP  P+ G  +       Q
Sbjct  949   SVERPTMREVVQILTDLPKPPEQPSPTTQKHGGIGGGDASPEPNGPNVGVKEQQGQLPPQ  1008

Query  271   qppPDLLSI  245
              PPPDLLSI
Sbjct  1009  SPPPDLLSI  1017



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score =   146 bits (369),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 83/131 (63%), Positives = 99/131 (76%), Gaps = 10/131 (8%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQWVRKMTD  KE VVKILD RLS+VP+HE MH+FYVA+LCVEEQ
Sbjct  848  SGRKPVGEFGDGVDIVQWVRKMTDSNKEEVVKILDPRLSSVPLHEVMHVFYVAMLCVEEQ  907

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTAC--------ESSALEPPPSTGTSDDAK-D  278
            AVERP MREV+Q+L+E+P QPP +K  G +           ++A    P+TGT +  +  
Sbjct  908  AVERPTMREVIQILSEIP-QPPSSKQGGDSTLPNSSPPPPPTAADLDLPTTGTKNKKEHQ  966

Query  277  qqqppPDLLSI  245
            QQQPPPDLLSI
Sbjct  967  QQQPPPDLLSI  977



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score =   146 bits (368),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 68/107 (64%), Positives = 82/107 (77%), Gaps = 1/107 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  KE V+K+LD R+S++PIHE  H+FYVA+LCVEEQ
Sbjct  893  TGRKPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRMSSIPIHEVTHVFYVAMLCVEEQ  952

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  290
            AVERP MREVVQ+LTE+PK PP +K + TT         P + G  D
Sbjct  953  AVERPTMREVVQILTEIPKMPP-SKEQSTTELTGVEKSTPENEGPPD  998



>ref|XP_008790445.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=1019

 Score =   146 bits (368),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 96/122 (79%), Gaps = 5/122 (4%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD KKEGVV +LD RL +VP+HEAMH+FYVA+LCVEEQ
Sbjct  903   TGRKPVGEFGDGVDIVQWVRKMTDSKKEGVVIVLDPRLPSVPLHEAMHVFYVAMLCVEEQ  962

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLL  251
             ++ERP MREVVQ+LTELP+ PP  + EG    E S   PPP+ G +   + + QP PDLL
Sbjct  963   SIERPTMREVVQILTELPRPPP-NQGEG----EDSPPPPPPAGGETPMKESKPQPQPDLL  1017

Query  250   SI  245
             SI
Sbjct  1018  SI  1019



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score =   146 bits (368),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 78/128 (61%), Positives = 91/128 (71%), Gaps = 7/128 (5%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  884   TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQ  943

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTAC------ESSALEPPPSTGTSDDAKDqqq  269
             AVERP MREVVQ+LTELPK PP +K    T         +S   P  ++    D    Q 
Sbjct  944   AVERPTMREVVQILTELPK-PPSSKQGDLTITESSLSSSNSLESPTTASKEPKDQHPPQS  1002

Query  268   ppPDLLSI  245
             PP DLLSI
Sbjct  1003  PPTDLLSI  1010



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   145 bits (367),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 66/99 (67%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQ
Sbjct  893  TGRKPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQ  952

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP  314
            AVERP MREVVQ+LTE+PK PP      T +   + L P
Sbjct  953  AVERPTMREVVQILTEIPKLPPSKDQPTTESTPENELSP  991



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score =   145 bits (366),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 67/108 (62%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  K+ V+K+LD RLS++PIHE  H+FYVA+LCVEEQ
Sbjct  892  TGRKPVGEFGDGVDIVQWVRKMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQ  951

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDD  287
            AVERP MREVVQ+LTE+PK PP      T +   S L P     +  D
Sbjct  952  AVERPTMREVVQILTEIPKLPPSKDQPMTESAPESELSPKSGVQSPPD  999



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score =   145 bits (365),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 82/112 (73%), Gaps = 5/112 (4%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVRKMTD  KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQ
Sbjct  892   TGRKPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQ  951

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGT--TACESSALE---PPPSTGTSD  290
             AVERP MREVVQ+LTE+PK PP      T  T  E S  E    P S G  D
Sbjct  952   AVERPTMREVVQILTEIPKMPPLKDQPATELTGVEKSTAENELSPKSGGPPD  1003



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score =   145 bits (365),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 66/99 (67%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQ
Sbjct  892  TGRKPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQ  951

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP  314
            AVERP MREVVQ+LTE+PK PP      T +   + L P
Sbjct  952  AVERPTMREVVQILTEIPKLPPPKDQPTTESTPENELSP  990



>gb|KHN01704.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=854

 Score =   144 bits (363),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQ
Sbjct  728  TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQ  787

Query  430  AVERPKMREVVQMLTELPKQPPGTK  356
            AVERP MREVVQ+LTELPK PP +K
Sbjct  788  AVERPTMREVVQILTELPK-PPSSK  811



>dbj|BAF01968.1| receptor protein kinase like protein [Arabidopsis thaliana]
Length=243

 Score =   137 bits (345),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 79/106 (75%), Gaps = 4/106 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +GKKPVGE GDGVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQ
Sbjct  129  TGKKPVGEFGDGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQ  188

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTS  293
            AVERP MREVVQ+LTE+PK P   +     A ES   E  P+   S
Sbjct  189  AVERPTMREVVQILTEIPKIPLSKQ----QAAESDVTEKAPAINES  230



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score =   145 bits (365),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 81/134 (60%), Positives = 93/134 (69%), Gaps = 14/134 (10%)
 Frame = -2

Query  607   GKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQA  428
             G+KPVGE GDGVDIVQWVRKMTD  KE V+K+LD RL +VP+ E MH+FYVA+LCVEEQA
Sbjct  894   GRKPVGEFGDGVDIVQWVRKMTDSSKESVLKVLDPRLPSVPLQEVMHVFYVAMLCVEEQA  953

Query  427   VERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP------PSTGTSDDAKDq---  275
             VERP MREVVQ+LTELPK PP +K   TT  E      P      P+T  + D KDQ   
Sbjct  954   VERPTMREVVQILTELPK-PPNSKEGDTTINEPPTSPSPDTTLDSPTTTITKDPKDQQQQ  1012

Query  274   ----qqppPDLLSI  245
                 +  PPDLLSI
Sbjct  1013  PPAPKSTPPDLLSI  1026



>ref|XP_008787754.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=990

 Score =   144 bits (364),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 76/125 (61%), Positives = 88/125 (70%), Gaps = 3/125 (2%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SGKKPVGE GDGVDIVQW+RKMTD  KE V  ILD RLSTVP+H+ MH+FYVA+LCVEEQ
Sbjct  866  SGKKPVGEFGDGVDIVQWMRKMTDSNKEAVTNILDPRLSTVPLHDVMHVFYVAMLCVEEQ  925

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppP---  260
            +VERP MREVVQ+L+ELP+  P    + +   ES A  P PS  T    + Q  P     
Sbjct  926  SVERPTMREVVQILSELPRPTPKPGEDSSNDEESEAPAPVPSAETPSKEQQQPAPRSPPP  985

Query  259  DLLSI  245
            DLLSI
Sbjct  986  DLLSI  990



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   144 bits (363),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 65/99 (66%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQ
Sbjct  893  TGRKPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQ  952

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP  314
            AVERP MREVVQ+LTE+PK PP      T +   + + P
Sbjct  953  AVERPTMREVVQILTEIPKLPPSKDQPTTESTPENEVSP  991



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score =   144 bits (362),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 75/113 (66%), Positives = 86/113 (76%), Gaps = 8/113 (7%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RLS+VP+ E MH+FYVA+LCVEEQ
Sbjct  890  TGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLSSVPLQEVMHVFYVAILCVEEQ  949

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDD  287
            AVERP MREVVQ+LTELPK    +K   +T  ESS     ALE P  T  S D
Sbjct  950  AVERPTMREVVQILTELPKSTE-SKLGDSTITESSLSSSNALESP--TAASKD  999



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score =   143 bits (361),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  KEGV+K+LD RL +VP++E MH+FYVA+LCVEEQ
Sbjct  887  AGRKPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLNEVMHVFYVAMLCVEEQ  946

Query  430  AVERPKMREVVQMLTELPKQPPGTK  356
            AVERP MREVVQMLTELPK PP +K
Sbjct  947  AVERPTMREVVQMLTELPK-PPSSK  970



>ref|XP_004955422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1030

 Score =   143 bits (360),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 70/115 (61%), Positives = 86/115 (75%), Gaps = 4/115 (3%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +GKKPVGE GDGVDIVQWV+ MTD  KE V+KI+D RLSTVP+HE MH+FYVALLCVEEQ
Sbjct  895   TGKKPVGEFGDGVDIVQWVKTMTDSNKEQVIKIMDPRLSTVPVHEVMHIFYVALLCVEEQ  954

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGT----SDDAKD  278
             +V+RP MREVVQML+ELPK       E  +  + +A  PP S  +    +D+AK+
Sbjct  955   SVQRPTMREVVQMLSELPKPTSRQGDELPSGDDGAAPNPPVSADSVEALNDEAKE  1009



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score =   142 bits (359),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 65/99 (66%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQ
Sbjct  893  TGRKPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQ  952

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP  314
            AVERP MREVVQ+LTE+PK  P      T +   + L P
Sbjct  953  AVERPTMREVVQILTEIPKSLPSKDQPTTESTPENELSP  991



>emb|CDY45620.1| BnaCnng13280D [Brassica napus]
Length=973

 Score =   142 bits (358),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  K+ V+K+LD RLS++PIHE  H+FYVA+LCVEEQ
Sbjct  863  TGRKPVGEFGDGVDIVQWVRKMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQ  922

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGT  344
            AVERP MREVVQ+LTE+PK PP      T
Sbjct  923  AVERPTMREVVQILTEVPKMPPSKDQPAT  951



>ref|XP_010936307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1007

 Score =   142 bits (357),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 62/81 (77%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD KKEGV+ +LD RL +VP+HEAMH+FYVA+LCVEEQ
Sbjct  901  TGRKPVGEFGDGVDIVQWVRKMTDSKKEGVLSVLDPRLPSVPLHEAMHVFYVAMLCVEEQ  960

Query  430  AVERPKMREVVQMLTELPKQP  368
            ++ERP MREVVQ+LTELP+ P
Sbjct  961  SIERPTMREVVQILTELPRPP  981



>emb|CDY08759.1| BnaA06g24650D [Brassica napus]
Length=971

 Score =   141 bits (356),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  K+ V+K+LD RLS++PIHE  H+FYVA+LCVEEQ
Sbjct  861  TGRKPVGEFGDGVDIVQWVRKMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQ  920

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGT  344
            AVERP MREVVQ+LTE+PK PP      T
Sbjct  921  AVERPTMREVVQILTEVPKMPPSKDQPAT  949



>ref|XP_009150662.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brassica rapa]
Length=997

 Score =   142 bits (357),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMTD  K+ V+K+LD RLS++PIHE  H+FYVA+LCVEEQ
Sbjct  887  TGRKPVGEFGDGVDIVQWVRKMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQ  946

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGT  344
            AVERP MREVVQ+LTE+PK PP      T
Sbjct  947  AVERPTMREVVQILTEVPKMPPSKDQAAT  975



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score =   141 bits (356),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 66/101 (65%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMT+G K+G VK+LD RL  VP+HE  H+FYVA+LCVEEQ
Sbjct  900  TGRKPVGEFGDGVDIVQWVRKMTEGNKQGAVKVLDPRLERVPLHEVTHVFYVAMLCVEEQ  959

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPP  308
            AVERP MREVVQMLTELP         G    E     PPP
Sbjct  960  AVERPTMREVVQMLTELPGDSGSEVKLGHQEQEMPISSPPP  1000



>ref|XP_006650665.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1021

 Score =   141 bits (356),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 6/117 (5%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIV WVR MTD  KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ
Sbjct  886   TGRKPVGEFGDGVDIVHWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHIFYVALLCIEEQ  945

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  278
             +V+RP MREVVQ+L+ELPK  P      + A + SA  PP   PS      + DAKD
Sbjct  946   SVQRPTMREVVQILSELPKLAPRQGEVLSHAVDGSASNPPAPVPSGSAKAPTGDAKD  1002



>gb|AAO26313.1| receptor-like protein kinase, partial [Elaeis guineensis]
Length=481

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRK+TD  KEG++KI+D RLS+VP+HEAMH+FYVA+LCVEEQ
Sbjct  363  TGRKPVGEFGDGVDIVQWVRKVTDTNKEGILKIIDPRLSSVPLHEAMHVFYVAMLCVEEQ  422

Query  430  AVERPKMREVVQMLTELPKQP  368
            +VERP MREVVQ+LTELP  P
Sbjct  423  SVERPTMREVVQILTELPGTP  443



>ref|XP_008785758.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Phoenix dactylifera]
Length=782

 Score =   140 bits (352),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVR++TD  KEGV+KILD RLS+VP+HEAMH+FYVA+LCVEEQ
Sbjct  664  TGRKPVGEFGDGVDIVQWVREVTDSSKEGVLKILDPRLSSVPLHEAMHVFYVAMLCVEEQ  723

Query  430  AVERPKMREVVQMLTELPKQPP  365
            +VERP  REVVQ+LTELP  PP
Sbjct  724  SVERPTTREVVQILTELPGPPP  745



>ref|XP_002461427.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
 gb|EER97948.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
Length=1031

 Score =   140 bits (353),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 66/98 (67%), Positives = 78/98 (80%), Gaps = 7/98 (7%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +GKKPVGE GDGVDIVQWV+ MTD  KE V+KI+D RLSTVP+HE MH+FYVALLCVEEQ
Sbjct  895  TGKKPVGEFGDGVDIVQWVKTMTDANKEQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQ  954

Query  430  AVERPKMREVVQMLTELPK-------QPPGTKPEGTTA  338
            +V+RP MREVVQML+ELPK       +PP    +G+ A
Sbjct  955  SVQRPTMREVVQMLSELPKPAARQGDEPPSVDDDGSAA  992



>gb|EAY92008.1| hypothetical protein OsI_13698 [Oryza sativa Indica Group]
Length=1029

 Score =   140 bits (353),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 6/117 (5%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVR MTD  KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ
Sbjct  894   TGRKPVGEFGDGVDIVQWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQ  953

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  278
             +V+RP MREVVQ+L+ELPK  P      + A +  A  PP   PS      + DAKD
Sbjct  954   SVQRPTMREVVQILSELPKLAPRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  1010



>gb|AAP68887.1| putative receptor-like protein kinase 1 [Oryza sativa Japonica 
Group]
 gb|ABF99107.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=1029

 Score =   140 bits (353),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 6/117 (5%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVR MTD  KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ
Sbjct  894   TGRKPVGEFGDGVDIVQWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQ  953

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  278
             +V+RP MREVVQ+L+ELPK  P      + A +  A  PP   PS      + DAKD
Sbjct  954   SVQRPTMREVVQILSELPKLAPRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  1010



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score =   140 bits (353),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 62/81 (77%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRK+TD  KEG++KI+D RLS+VP+HEAMH+FYVA+LCVEEQ
Sbjct  902  TGRKPVGEFGDGVDIVQWVRKVTDTNKEGILKIIDPRLSSVPLHEAMHVFYVAMLCVEEQ  961

Query  430  AVERPKMREVVQMLTELPKQP  368
            +VERP MREVVQ+LTELP  P
Sbjct  962  SVERPTMREVVQILTELPGTP  982



>gb|EEE60014.1| hypothetical protein OsJ_12761 [Oryza sativa Japonica Group]
Length=979

 Score =   140 bits (353),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 6/117 (5%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVR MTD  KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ
Sbjct  844  TGRKPVGEFGDGVDIVQWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQ  903

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  278
            +V+RP MREVVQ+L+ELPK  P      + A +  A  PP   PS      + DAKD
Sbjct  904  SVQRPTMREVVQILSELPKLAPRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  960



>ref|XP_010023395.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Eucalyptus grandis]
Length=875

 Score =   140 bits (352),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 70/115 (61%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQW+RKMT+  KE V KILD RL  VP+HEAMH+FYVA+LCVEEQ
Sbjct  744  SGRKPVGEFGDGVDIVQWMRKMTNSNKEEVQKILDPRLPAVPLHEAMHVFYVAMLCVEEQ  803

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP----PSTGTSDDAKD  278
            AVERP MREVVQ+LTE P+ PPG+    +    + +L P      S  T+ D K+
Sbjct  804  AVERPTMREVVQILTERPR-PPGSAKGDSVVVVAQSLPPQGLALESLATTKDGKE  857



>ref|NP_001051418.1| Os03g0773700 [Oryza sativa Japonica Group]
 dbj|BAF13332.1| Os03g0773700, partial [Oryza sativa Japonica Group]
Length=885

 Score =   139 bits (351),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 6/117 (5%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVR MTD  KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ
Sbjct  750  TGRKPVGEFGDGVDIVQWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQ  809

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  278
            +V+RP MREVVQ+L+ELPK  P      + A +  A  PP   PS      + DAKD
Sbjct  810  SVQRPTMREVVQILSELPKLAPRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  866



>gb|KCW59634.1| hypothetical protein EUGRSUZ_H023832 [Eucalyptus grandis]
Length=871

 Score =   139 bits (350),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 70/115 (61%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQW+RKMT+  KE V KILD RL  VP+HEAMH+FYVA+LCVEEQ
Sbjct  740  SGRKPVGEFGDGVDIVQWMRKMTNSNKEEVQKILDPRLPAVPLHEAMHVFYVAMLCVEEQ  799

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP----PSTGTSDDAKD  278
            AVERP MREVVQ+LTE P+ PPG+    +    + +L P      S  T+ D K+
Sbjct  800  AVERPTMREVVQILTERPR-PPGSAKGDSVVVVAQSLPPQGLALESLATTKDGKE  853



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score =   139 bits (351),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 79/106 (75%), Gaps = 4/106 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +GKKPVGE GDGVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQ
Sbjct  888  TGKKPVGEFGDGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQ  947

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTS  293
            AVERP MREVVQ+LTE+PK P   +     A ES   E  P+   S
Sbjct  948  AVERPTMREVVQILTEIPKIPLSKQ----QAAESDVTEKAPAINES  989



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score =   139 bits (350),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 72/116 (62%), Positives = 87/116 (75%), Gaps = 9/116 (8%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +GKKPVGE GDGVDIVQWV+ MTD  KE V+KILD RLSTVP+HE MH+FYVALLCVEEQ
Sbjct  893   TGKKPVGEFGDGVDIVQWVKTMTDSNKEHVIKILDPRLSTVPVHEVMHVFYVALLCVEEQ  952

Query  430   AVERPKMREVVQMLTELPKQPPGTK-----PEGTTACESSALEPPPSTGTSDDAKD  278
             +V+RP MREVVQ+L+ELPK  P +K     P G  A   S L  P  +  +++AK+
Sbjct  953   SVQRPTMREVVQILSELPK--PTSKQGEEPPSGEGAV--SDLVVPAESAEANEAKE  1004



>emb|CDY23037.1| BnaC07g31500D [Brassica napus]
Length=967

 Score =   139 bits (350),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 66/102 (65%), Positives = 77/102 (75%), Gaps = 4/102 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVR MTD  KE V+K++D RLS+VP+HE  H+FYVALLCVEEQ
Sbjct  862  TGRKPVGEFGDGVDIVQWVRSMTDSNKECVLKVIDHRLSSVPVHEVTHVFYVALLCVEEQ  921

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS  305
            AV RP MREVVQ+LTELPK P   +     A ES   E  P+
Sbjct  922  AVARPTMREVVQILTELPKIPLSKQ----LAVESDVTEKSPA  959



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score =   139 bits (350),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +GKKPVGE GDGVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQ
Sbjct  883  TGKKPVGEFGDGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQ  942

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSAL---EPPPSTGTSDD  287
            AVERP MREVVQ+LTE+PK P   + E  +     A    E  P +G+  D
Sbjct  943  AVERPTMREVVQILTEIPKLPLSKQQETESDVTEKAPRMNESSPDSGSPPD  993



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score =   139 bits (349),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 67/102 (66%), Positives = 78/102 (76%), Gaps = 4/102 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVR MTD  KE V+K++D RLS+VPIHE  H+FYVALLCVEEQ
Sbjct  884  TGRKPVGEFGDGVDIVQWVRSMTDSNKECVLKVIDLRLSSVPIHEVTHVFYVALLCVEEQ  943

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS  305
            AVERP MREVVQ+LTE+PK      P    A ES+  E  P+
Sbjct  944  AVERPTMREVVQILTEIPK----ILPTKQHAAESNVTEISPA  981



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score =   139 bits (349),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +GKKPVGE GDGVDIVQWV+ MTD  KE V+KILD RLSTVP+HE MH+FYVALLCVEEQ
Sbjct  893   TGKKPVGEFGDGVDIVQWVKTMTDSNKEHVIKILDPRLSTVPVHEVMHVFYVALLCVEEQ  952

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALE--PPPSTGTSDDAKD  278
             +V+RP MREVVQ+L+ELPK P   + E   + E +  +   P  +  +++AK+
Sbjct  953   SVQRPTMREVVQILSELPK-PTSKQGEEPPSGEGAVFDLVVPAESAEANEAKE  1004



>ref|XP_010943209.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Elaeis guineensis]
Length=995

 Score =   138 bits (347),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 79/130 (61%), Positives = 94/130 (72%), Gaps = 8/130 (6%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SGKKPVGE GDGVDIVQW+RKMTD  K+ V  ILD RLS+VP+H+ MH+FYVA+LCVEEQ
Sbjct  866  SGKKPVGEFGDGVDIVQWMRKMTDSNKQAVTNILDPRLSSVPLHDVMHVFYVAMLCVEEQ  925

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESS-ALEPPPSTGT-SDDAKDqqqppP-  260
            +VERP MREVVQ+L+ELP+  P    E ++  E S A  P PS  T S + K+QQQ P  
Sbjct  926  SVERPTMREVVQILSELPRPTPKPGEEDSSNNEESGAPAPVPSAETPSKETKEQQQQPAR  985

Query  259  -----DLLSI  245
                 DLLSI
Sbjct  986  QSPPPDLLSI  995



>dbj|BAJ84911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1020

 Score =   138 bits (347),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 65/106 (61%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +GKKPVGE GDGVDIV W++  TD KKE V+KI+D RLSTVP+HE MH+FYVALLCVEEQ
Sbjct  888  TGKKPVGEFGDGVDIVHWIKMTTDSKKEQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQ  947

Query  430  AVERPKMREVVQMLTELPK---QPPGTKPEGTTACESSALEPPPST  302
            +V+RP MREVVQ+L+ELPK   +  G +  G++  +   L  PP T
Sbjct  948  SVQRPTMREVVQILSELPKPIAKQGGEQLTGSSDGDEPGLSGPPET  993



>ref|XP_008787359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1, partial [Phoenix 
dactylifera]
Length=1004

 Score =   137 bits (346),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/83 (73%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            SG+KPVGE GDGVDIVQWVRKMTD  +E V +ILD RLSTVP+HE +H+F+VA+LCVEEQ
Sbjct  893  SGRKPVGEFGDGVDIVQWVRKMTDSNREAVTEILDPRLSTVPLHEVLHVFHVAMLCVEEQ  952

Query  430  AVERPKMREVVQMLTELPKQPPG  362
            +VERP MREVVQ+L E PK  PG
Sbjct  953  SVERPTMREVVQILAEFPKPKPG  975



>emb|CDY02112.1| BnaA03g40550D [Brassica napus]
Length=969

 Score =   137 bits (345),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 4/107 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVR MTD  KE V+K++D RLS+VP+HE  H+FYVA+LCVEEQ
Sbjct  863  TGRKPVGEFGDGVDIVQWVRSMTDSNKECVLKVIDHRLSSVPVHEVTHVFYVAMLCVEEQ  922

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  290
            AV RP MREVVQ+LTE+PK P   +     A ES   E  P+    D
Sbjct  923  AVARPTMREVVQILTEVPKIPLSEQ----LAVESDVTEKSPAVDEED  965



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score =   137 bits (345),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 79/106 (75%), Gaps = 4/106 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +GKKPVGE GDGVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQ
Sbjct  887  TGKKPVGEFGDGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQ  946

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTS  293
            AVERP MREVVQ+LTE+PK P   +     A ES   E  P+   S
Sbjct  947  AVERPTMREVVQILTEIPKIPLLKQ----QAAESDVSEKAPAMNES  988



>ref|XP_004981595.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1029

 Score =   137 bits (346),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 68/110 (62%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQW + MTD  KE V+KILD RLSTVP+HE MH+FYVALLC EEQ
Sbjct  894   TGRKPVGEFGDGVDIVQWAKMMTDSSKEQVMKILDPRLSTVPLHEIMHVFYVALLCTEEQ  953

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP-PPSTGTSDDA  284
             +V+RP MREVVQ+L+ELPK       E   AC+ SA  P  P+   S++A
Sbjct  954   SVQRPTMREVVQILSELPKPSTKQGEEVPNACDGSASGPLHPAPAGSNEA  1003



>ref|XP_009136515.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=993

 Score =   137 bits (345),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 4/107 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVR MTD  KE V+K++D RLS+VP+HE  H+FYVA+LCVEEQ
Sbjct  887  TGRKPVGEFGDGVDIVQWVRSMTDSNKECVLKVIDHRLSSVPVHEVTHVFYVAMLCVEEQ  946

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  290
            AV RP MREVVQ+LTE+PK P   +     A ES   E  P+    D
Sbjct  947  AVARPMMREVVQILTEVPKIPLSEQ----LAVESDVTEKSPAVDEED  989



>ref|XP_009399076.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1021

 Score =   137 bits (345),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 68/107 (64%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMT   KE V KILD RL T PIHE MH+FYVA+LCVEEQ
Sbjct  891  TGRKPVGEFGDGVDIVQWVRKMTGSDKENVAKILDPRLPTAPIHEVMHVFYVAMLCVEEQ  950

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  290
            +V RP MREVVQMLTELP  P   + E +++   +A  PPP   + D
Sbjct  951  SVGRPTMREVVQMLTELPI-PSLKQGEDSSSGNVTAQPPPPIVASVD  996



>ref|XP_006657429.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=864

 Score =   136 bits (343),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +GKKPVGE GDGVDIVQWV+ MTD  KE V+KILD RLSTVP+HE MH+FYVALLCVEEQ
Sbjct  729  TGKKPVGEFGDGVDIVQWVKTMTDSNKEQVIKILDPRLSTVPVHEVMHVFYVALLCVEEQ  788

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSA--LEPPPSTGTSDDAKD  278
            +++RP MREVVQ+L+ELPK P   + E   + E +   L  P  +  +++AK+
Sbjct  789  SMQRPTMREVVQILSELPK-PASKQGEEPPSGEGAVPDLVVPAESAEANEAKE  840



>gb|EMS57320.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Triticum urartu]
Length=788

 Score =   135 bits (341),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 68/116 (59%), Positives = 85/116 (73%), Gaps = 5/116 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +GKKPVGE GDGVDIV W++ MTD K+E V+KI+D RLSTVP+HE MH+FYVALLCVEEQ
Sbjct  653  TGKKPVGEFGDGVDIVHWIKMMTDSKREQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQ  712

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTAC----ESSALEPPPSTG-TSDDAKD  278
            +V+RP MREVVQ+L+ELPK       E  T      ES  + PP +    +D+AK+
Sbjct  713  SVQRPTMREVVQILSELPKPTTKHGEEQLTGSGDGDESGPVGPPETVEPATDEAKE  768



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score =   135 bits (341),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRK+T   KE V KILD RL T+P+HEAMH+FYVA+LCVEEQ
Sbjct  893  TGRKPVGEFGDGVDIVQWVRKVTGSNKEEVTKILDPRLPTLPVHEAMHVFYVAMLCVEEQ  952

Query  430  AVERPKMREVVQMLTELPKQP  368
            +VERP MREVVQ+LTELPK P
Sbjct  953  SVERPTMREVVQILTELPKPP  973



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score =   135 bits (340),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 65/106 (61%), Positives = 79/106 (75%), Gaps = 3/106 (3%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVR MTD  K+ V+K++D RLS+VPIHE  H+FYVA+LCVEE+
Sbjct  900   TGRKPVGEFGDGVDIVQWVRGMTDSNKDCVLKVIDLRLSSVPIHEVTHVFYVAMLCVEER  959

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTS  293
             AVERP MREVVQ+LTE+PK P   +     A ES   E  P+   S
Sbjct  960   AVERPTMREVVQILTEIPKIPISKQ---KAAAESDVTEKSPAMNES  1002



>ref|XP_003557615.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1019

 Score =   135 bits (340),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 64/99 (65%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +GKKPVGE GDGVDIVQW++ MTD  KE V+KI+D RLSTVP+HE MH+FYVALLCVEEQ
Sbjct  888  TGKKPVGEFGDGVDIVQWIKMMTDSSKERVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQ  947

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP  314
            +V+RP MREVVQ+L+E PK  P    E   + E   L+P
Sbjct  948  SVQRPTMREVVQILSEPPKLIPKQGEELPGSGEGDELDP  986



>ref|XP_010941985.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1024

 Score =   135 bits (340),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 67/111 (60%), Positives = 80/111 (72%), Gaps = 3/111 (3%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             SG+KPVGE GDGVDIVQWVRKMTD  KE V +ILD RLSTVP+ E +H+F+VA+LCVEEQ
Sbjct  893   SGRKPVGEFGDGVDIVQWVRKMTDSNKEAVSEILDPRLSTVPLQEVIHVFHVAMLCVEEQ  952

Query  430   AVERPKMREVVQMLTELPKQPPG---TKPEGTTACESSALEPPPSTGTSDD  287
             +VERP MREVVQ+L E PK  PG   +  EG+       +E   S  T +D
Sbjct  953   SVERPTMREVVQILAEFPKPKPGEDSSANEGSVPPPPVPVEETSSKETKED  1003



>gb|ADB85328.1| putative receptor protein kinase [Phyllostachys edulis]
Length=743

 Score =   134 bits (337),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 66/110 (60%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVR MTD  KE V+ I D RLSTVP+HE MH+FYVALLCVEEQ
Sbjct  609  TGRKPVGEFGDGVDIVQWVRMMTDSNKEQVMMIRDPRLSTVPLHEVMHVFYVALLCVEEQ  668

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSAL-EPPPSTGTSDDA  284
            +V+RP MREVVQ+L++LPK  P    + + + + SA   P P+   S +A
Sbjct  669  SVQRPTMREVVQILSDLPKPAPKQGEDLSLSGDGSASNSPAPAPSGSAEA  718



>ref|XP_010028033.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
 gb|KCW54695.1| hypothetical protein EUGRSUZ_I00635 [Eucalyptus grandis]
Length=1023

 Score =   135 bits (339),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 68/100 (68%), Positives = 77/100 (77%), Gaps = 4/100 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRKMT+  KE V  ILD RL+TVP+HEAMH+FYVA+LCVEEQ
Sbjct  902  TGRKPVGEFGDGVDIVQWVRKMTNSNKEEVQLILDPRLNTVPLHEAMHLFYVAMLCVEEQ  961

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP  311
            AVERP MREVVQ+LTE PK     + E  T    S LE P
Sbjct  962  AVERPTMREVVQILTEFPKPCNVKQDEPLT----SPLESP  997



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   134 bits (338),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 3/109 (3%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE G GVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQ
Sbjct  886  TGRKPVGEFGAGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQ  945

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDA  284
            AVERP MREVVQ+L E+PK P   + E  +     A   PP   +S D+
Sbjct  946  AVERPTMREVVQILAEIPKMPLTKQLETESDVTEKA---PPMNDSSPDS  991



>ref|XP_003558681.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1027

 Score =   134 bits (338),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWV+ MTD  KE V+KILD RLSTVP+HE MH+FYVALLC+EEQ
Sbjct  893  TGRKPVGEFGDGVDIVQWVKMMTDSNKEQVMKILDPRLSTVPLHEVMHVFYVALLCIEEQ  952

Query  430  AVERPKMREVVQMLTELPK  374
            +V+RP MREVVQ+L+ELPK
Sbjct  953  SVQRPTMREVVQILSELPK  971



>gb|AAY32333.1| RLK1 [Phyllostachys praecox]
Length=804

 Score =   133 bits (335),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +GKKPV E GDGVDIV WV+ MTD  KE V+KILD RLSTVP+HE MH+FYVALLCVEEQ
Sbjct  672  TGKKPVWEFGDGVDIVHWVKMMTDLNKEQVIKILDPRLSTVPVHEVMHVFYVALLCVEEQ  731

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS  305
            +V+RP MREVVQ+L+ELP        E  +  + +A +PP +
Sbjct  732  SVQRPTMREVVQILSELPSPTSKQGEEFPSGGDGAASDPPAA  773



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score =   133 bits (335),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 77/106 (73%), Gaps = 4/106 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE G GVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQ
Sbjct  885  TGRKPVGEFGAGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQ  944

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTS  293
            AVERP MREVVQ+L E+PK P   + E     ES   E  P+   S
Sbjct  945  AVERPTMREVVQILAEIPKMPLTKQLE----TESDVTEKAPAMNES  986



>gb|EMT14290.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=895

 Score =   133 bits (334),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 67/116 (58%), Positives = 84/116 (72%), Gaps = 5/116 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +GKKPVGE GDGVDIV W++ MT  K+E V+KI+D RLSTVP+HE MH+FYVALLCVEEQ
Sbjct  760  TGKKPVGEFGDGVDIVHWIKMMTGSKREQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQ  819

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTAC----ESSALEPPPST-GTSDDAKD  278
            +V+RP MREVVQ+L+ELPK       E  T      ES  + PP +    +D+AK+
Sbjct  820  SVQRPTMREVVQILSELPKPTTKHGEEQLTGSGDGDESGPVGPPETVEPATDEAKE  875



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   133 bits (335),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 70/121 (58%), Positives = 85/121 (70%), Gaps = 7/121 (6%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE G GVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQ
Sbjct  886  TGRKPVGEFGAGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQ  945

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLL  251
            AVERP MREVVQ+L E+PK P   + E     ES   E  P   T +++      PPDLL
Sbjct  946  AVERPTMREVVQILAEIPKMPLTKQLE----TESDVTEKAP---TMNESSPDSGSPPDLL  998

Query  250  S  248
            S
Sbjct  999  S  999



>ref|XP_009394785.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   132 bits (333),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 1/91 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVR+MTD  KEGV+KILD RL TVP+ E MH+FYVA+LCVEEQ
Sbjct  898  TGRKPVGEFGDGVDIVQWVRRMTDSSKEGVLKILDHRLPTVPLDEVMHVFYVAMLCVEEQ  957

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTA  338
            +V RP MREVVQ+LT+LP+ P  T+ +   A
Sbjct  958  SVGRPTMREVVQILTDLPR-PATTQADDCEA  987



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score =   132 bits (331),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVRK+T G KE V+KI+DSRLST PI E  H+FYVA+LCVEEQ
Sbjct  893  TGRKPVGEFGDGVDIVQWVRKITGGNKEEVMKIVDSRLSTPPIEEVTHVFYVAMLCVEEQ  952

Query  430  AVERPKMREVVQMLTELP  377
            AVERP MREVVQ+LTELP
Sbjct  953  AVERPTMREVVQILTELP  970



>ref|XP_009396449.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   132 bits (331),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 63/103 (61%), Positives = 78/103 (76%), Gaps = 2/103 (2%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE G+GVDIVQWVR+MT   KEGV++I+D RL TVP+ E MH+FYVA+LCVEEQ
Sbjct  897  TGRKPVGEFGEGVDIVQWVRRMTGCNKEGVLEIVDPRLPTVPLDEVMHVFYVAMLCVEEQ  956

Query  430  AVERPKMREVVQMLTELPK--QPPGTKPEGTTACESSALEPPP  308
            +VERP MREVVQ+LT+LP   +  G   E  T  +  A E PP
Sbjct  957  SVERPTMREVVQILTDLPNPARKQGEDREAATKEQQQAAEKPP  999



>ref|XP_009408581.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1016

 Score =   132 bits (331),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 83/126 (66%), Gaps = 6/126 (5%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVR++T  KK  V KILD RL TVP+HE MH+F VA+LCVEEQ
Sbjct  893   TGRKPVGEFGDGVDIVQWVREVTGLKKGEVTKILDPRLPTVPLHEVMHVFCVAMLCVEEQ  952

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP----PSTGTSDDAKDqqqpp  263
             +VERP MREVVQ+LTELPK PP  K  G T      +  P    P T            P
Sbjct  953   SVERPTMREVVQILTELPKPPP--KQGGDTPTPRGDVSAPRYIIPETREQQQQPASDSLP  1010

Query  262   PDLLSI  245
              DLLS+
Sbjct  1011  SDLLSM  1016



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   131 bits (329),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 68/107 (64%), Positives = 80/107 (75%), Gaps = 9/107 (8%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +GKKPVGE GDGVDIVQWVR+ TD KKEGV++ILD RL TVP+ EAMH+FYVA+LCVEEQ
Sbjct  895  TGKKPVGELGDGVDIVQWVRETTDSKKEGVLQILDRRLPTVPLDEAMHVFYVAMLCVEEQ  954

Query  430  AVERPKMREVVQMLTELPK----QPP--GTKPEGTTACESSALEPPP  308
            +VERP MREVVQ+L + PK      P    K +   A E+S   PPP
Sbjct  955  SVERPTMREVVQILMDRPKGHGCDAPIKEVKEQQQRAAENS---PPP  998



>gb|EMS67650.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Triticum urartu]
Length=868

 Score =   130 bits (328),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 68/123 (55%), Positives = 82/123 (67%), Gaps = 17/123 (14%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWV+ MT   KE V+KILD RLSTVP+HE MH+FYVALLC EE 
Sbjct  729  TGRKPVGEFGDGVDIVQWVKMMTGPNKEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEH  788

Query  430  AVERPKMREVVQMLTELPKQP------------PGTKPEGTTACESSALEPPPSTGTSDD  287
            +V+RP MREVVQ+L+ELPK               G  PE  T   +S+ + P     + D
Sbjct  789  SVQRPTMREVVQILSELPKPAANQGDGEEELPLSGEGPESNTPAPTSSTDAP-----TGD  843

Query  286  AKD  278
            AKD
Sbjct  844  AKD  846



>ref|XP_009395647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   130 bits (328),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 78/106 (74%), Gaps = 8/106 (8%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE G+GVDIVQWVRKMTD  KEG +KILD RL T P  EAMH+FYVA LCV+EQ
Sbjct  897  TGRKPVGEFGEGVDIVQWVRKMTDSNKEGALKILDPRLPTAPPDEAMHVFYVATLCVQEQ  956

Query  430  AVERPKMREVVQMLTELPKQ-----PPGTKPEGTTACESSALEPPP  308
            +VERP MREVVQ+LT+ PKQ      P  + E   A +S+   PPP
Sbjct  957  SVERPTMREVVQILTDPPKQGEDRETPIKEAEQQQAAQST---PPP  999



>ref|XP_002466378.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
 gb|EER93376.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
Length=1030

 Score =   130 bits (328),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 65/106 (61%), Positives = 76/106 (72%), Gaps = 7/106 (7%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQW + MT+  KE V+KILD RLSTVP+ E MH+FYVALLC EEQ
Sbjct  896  TGRKPVGEFGDGVDIVQWAKMMTNSSKEQVMKILDPRLSTVPLQEVMHVFYVALLCTEEQ  955

Query  430  AVERPKMREVVQMLTELPKQPPGTK-----PEGTTACESSALEPPP  308
            +V+RP MREVVQ+L+ELPK  P  K     P       SS L P P
Sbjct  956  SVQRPTMREVVQILSELPK--PANKQGEDVPNSGDGSASSPLHPAP  999



>dbj|BAJ89729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1030

 Score =   130 bits (326),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 5/113 (4%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWV+ MT   KE V+KILD RLSTVP+HE MH+FYVALLC EE 
Sbjct  893   TGRKPVGEFGDGVDIVQWVKMMTGPSKEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEH  952

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSA----LEPPPSTGTSDDA  284
             +V+RP MREVVQ+L+ELPK P  ++ +G      S       PP  T +S +A
Sbjct  953   SVQRPTMREVVQILSELPK-PAASQGDGEEELPLSGDGPESNPPAPTSSSTEA  1004



>gb|EMT20446.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=866

 Score =   129 bits (323),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWV+ MT   KE V+KILD RLSTVP+HE MH+FYVALLC EE 
Sbjct  729  TGRKPVGEFGDGVDIVQWVKMMTGPNKEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEH  788

Query  430  AVERPKMREVVQMLTELPKQPP--GTKPEGTTACESSALEPPPSTGTSD  290
            +V+RP MREVVQ+L+ELPK     G + E   + E     PP  T +++
Sbjct  789  SVQRPTMREVVQILSELPKPAANQGDEEELPLSGEGPESNPPAPTSSTE  837



>ref|XP_008665503.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Zea mays]
 tpg|DAA51666.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1034

 Score =   128 bits (322),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 1/85 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQW +  T+  KE V+K+LD RLSTVP+HE  H+FYVALLC EEQ
Sbjct  890  TGRKPVGEFGDGVDIVQWAKMTTNSNKEQVMKVLDPRLSTVPLHEVTHVFYVALLCTEEQ  949

Query  430  AVERPKMREVVQMLTELPKQPPGTK  356
            +V+RP MREVVQ+L+ELPK PP TK
Sbjct  950  SVQRPTMREVVQILSELPK-PPSTK  973



>ref|XP_006649672.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1001

 Score =   127 bits (318),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 82/133 (62%), Gaps = 20/133 (15%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVR +T   KEGV KI D RLSTVP+HE  H+FYVA+LCV EQ
Sbjct  878   AGRKPVGEFGDGVDIVQWVRMVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQ  937

Query  430   AVERPKMREVVQMLTELP-----------KQPPGTKPEGTTACESSALEPPPSTGTSDDA  284
             +VERP MREVVQ+LT+LP              PG K +GTT          P      D 
Sbjct  938   SVERPTMREVVQILTDLPGTAATPMDDAASHGPG-KDQGTTT--------SPEKPQQQDG  988

Query  283   KDqqqppPDLLSI  245
               +  P  DLLSI
Sbjct  989   SRESPPQQDLLSI  1001



>ref|XP_009787949.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana sylvestris]
Length=1000

 Score =   126 bits (316),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/90 (57%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVGE GDGVDIVQW +++T+ K+E V  I+D RL+TVP  EAMH+F+VA+LC++E 
Sbjct  887  TGRRPVGEFGDGVDIVQWSKRVTNCKREQVTHIVDPRLTTVPEDEAMHLFFVAMLCIQEN  946

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTT  341
            +VERP MREV+QML+E P+Q P  +P  ++
Sbjct  947  SVERPTMREVIQMLSEFPRQSPEYQPSSSS  976



>gb|AAM27467.1|AC099732_4 Putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=1001

 Score =   124 bits (311),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIV WVR +T   KEGV KI D RLSTVP+HE  H+FYVA+LCV EQ
Sbjct  881   AGRKPVGEFGDGVDIVHWVRMVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQ  940

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLL  251
             +VERP MREVVQ+LT+LP     T  +  +       +        D +++   P  DLL
Sbjct  941   SVERPTMREVVQILTDLPGTAAATAMDAPSHGSGKEQDRSAEMQQQDGSRE-SPPQQDLL  999

Query  250   SI  245
             SI
Sbjct  1000  SI  1001



>ref|NP_001049453.1| Os03g0228800 [Oryza sativa Japonica Group]
 gb|ABF94768.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11367.1| Os03g0228800 [Oryza sativa Japonica Group]
 gb|EEE58640.1| hypothetical protein OsJ_10012 [Oryza sativa Japonica Group]
Length=1007

 Score =   124 bits (311),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIV WVR +T   KEGV KI D RLSTVP+HE  H+FYVA+LCV EQ
Sbjct  887   AGRKPVGEFGDGVDIVHWVRMVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQ  946

Query  430   AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLL  251
             +VERP MREVVQ+LT+LP     T  +  +       +        D +++   P  DLL
Sbjct  947   SVERPTMREVVQILTDLPGTAAATAMDAPSHGSGKEQDRSAEMQQQDGSRE-SPPQQDLL  1005

Query  250   SI  245
             SI
Sbjct  1006  SI  1007



>dbj|BAJ99137.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1004

 Score =   123 bits (309),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 68/125 (54%), Positives = 79/125 (63%), Gaps = 13/125 (10%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G+KPVGE GDGVDIVQWVR  T   KEGV+KI D RLSTVPI E  H+FYVA+LCV EQ
Sbjct  890   TGRKPVGEFGDGVDIVQWVRMATGSTKEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQ  949

Query  430   AVERPKMREVVQMLTELP---KQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppP  260
             +VERP MREVVQ+L ++P       GT+ E T   E    +     GT D          
Sbjct  950   SVERPTMREVVQILADMPGATSMTVGTRSEATVEVEEEHQD-----GTQDSP-----AQQ  999

Query  259   DLLSI  245
             DLLSI
Sbjct  1000  DLLSI  1004



>gb|EEC74807.1| hypothetical protein OsI_10619 [Oryza sativa Indica Group]
Length=1010

 Score =   123 bits (309),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIV WVR +T   KEGV KI D RLSTVP+HE  H+FYVA+LCV EQ
Sbjct  885  AGRKPVGEFGDGVDIVHWVRMVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQ  944

Query  430  AVERPKMREVVQMLTELP  377
            +VERP MREVVQ+LT+LP
Sbjct  945  SVERPTMREVVQILTDLP  962



>gb|AAX94895.1| Similar to receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=139

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 76/101 (75%), Gaps = 8/101 (8%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIVQW +++TDG++E V +I+D R+STVP+ E  H+F+V++LCV+E 
Sbjct  25   TGRRPVGDFGEGVDIVQWTKRVTDGRRESVHRIIDRRISTVPMDEVAHIFFVSMLCVQEN  84

Query  430  AVERPKMREVVQMLTELPKQ------PPGTKPEGTTACESS  326
            +VERP MREVVQML+E P+       P  + PE  T  ESS
Sbjct  85   SVERPTMREVVQMLSEFPRHGSDQPSPSSSAPE--TGEESS  123



>ref|XP_010228930.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1008

 Score =   123 bits (308),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 63/100 (63%), Positives = 73/100 (73%), Gaps = 11/100 (11%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVR +    KEGV+KI D RLSTVPI E  H+FYVA+LCV EQ
Sbjct  889  AGRKPVGEFGDGVDIVQWVRMVAGSTKEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQ  948

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP  311
            +VERP MREVVQ+LT+LP         GTT   S +L PP
Sbjct  949  SVERPTMREVVQILTDLP---------GTTT--SMSLPPP  977



>gb|ACN35202.1| unknown [Zea mays]
Length=320

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDG-KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +GKKPVGE GDGVDIV WVR  T G  KE VVK++D RLS+VP+HE  H+F VALLCVEE
Sbjct  180  TGKKPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEE  239

Query  433  QAVERPKMREVVQMLTELPK  374
            Q+V+RP MREVVQML ELPK
Sbjct  240  QSVQRPTMREVVQMLGELPK  259



>gb|ABE79572.2| Protein kinase [Medicago truncatula]
Length=989

 Score =   122 bits (306),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVG+ G+GVD+VQW +K T+G++E VV I+DSRL  VP  EAMHMF++A+LC+EE 
Sbjct  867  TGRKPVGDFGEGVDLVQWCKKATNGRREEVVNIIDSRLMVVPKEEAMHMFFIAMLCLEEN  926

Query  430  AVERPKMREVVQMLTELPKQ  371
            +V+RP MREVVQML+E P+Q
Sbjct  927  SVQRPTMREVVQMLSEFPRQ  946



>ref|XP_003592924.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES63175.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1007

 Score =   122 bits (306),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVG+ G+GVD+VQW +K T+G++E VV I+DSRL  VP  EAMHMF++A+LC+EE 
Sbjct  885  TGRKPVGDFGEGVDLVQWCKKATNGRREEVVNIIDSRLMVVPKEEAMHMFFIAMLCLEEN  944

Query  430  AVERPKMREVVQMLTELPKQ  371
            +V+RP MREVVQML+E P+Q
Sbjct  945  SVQRPTMREVVQMLSEFPRQ  964



>gb|EMT15500.1| hypothetical protein F775_52402 [Aegilops tauschii]
Length=811

 Score =   122 bits (305),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 66/122 (54%), Positives = 78/122 (64%), Gaps = 5/122 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVR  T   KEGV+KI D RLSTVPI E  H+FYVA+LCV EQ
Sbjct  695  TGRKPVGEFGDGVDIVQWVRTATGSSKEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQ  754

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLL  251
            +VERP MREVVQ+L ++P     T   GTT  E++            D   +     DLL
Sbjct  755  SVERPTMREVVQILADMPGATSMTA--GTTRVEATV---EGEDEEHQDGPQESPAQQDLL  809

Query  250  SI  245
            SI
Sbjct  810  SI  811



>ref|NP_001169902.1| uncharacterized protein LOC100383797 [Zea mays]
 gb|ACN27138.1| unknown [Zea mays]
Length=459

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDG-KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +GKKPVGE GDGVDIV WVR  T G  KE VVK++D RLS+VP+HE  H+F VALLCVEE
Sbjct  319  TGKKPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEE  378

Query  433  QAVERPKMREVVQMLTELPK  374
            Q+V+RP MREVVQML ELPK
Sbjct  379  QSVQRPTMREVVQMLGELPK  398



>ref|XP_009403711.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403712.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403713.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
Length=995

 Score =   122 bits (305),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 55/99 (56%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVGE GDGVDIVQW +++TD  ++ V  I D RLSTVPI E MH+F+VA+LCV+E 
Sbjct  881  TGRRPVGEFGDGVDIVQWAKRVTDCSRDNVAAIADPRLSTVPIAEVMHVFFVAMLCVQEN  940

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTAC---ESSA  323
            +VERP MREVVQML+E P   P +    ++A    ESS+
Sbjct  941  SVERPTMREVVQMLSEFPHHVPESHSPSSSATALKESSS  979



>ref|XP_004985112.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2-like [Setaria italica]
Length=998

 Score =   121 bits (304),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 65/124 (52%), Positives = 81/124 (65%), Gaps = 5/124 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIVQWVR +T   KEGV+KI D RLSTVP++E  H+FYVA+LCV EQ
Sbjct  878  TGRKPVGEFGDGVDIVQWVRMVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQ  937

Query  430  AVERPKMREVVQMLTELPKQPPGT--KPEGTTACESSALEPPPSTGTSDDAKDqqqppPD  257
            +VERP MREVVQ+L ++P     +   P      E ++ E PP      +      P  D
Sbjct  938  SVERPTMREVVQILADMPGSTSTSIDAPLVIEPKEDASSEKPPR---QQEGPHDSPPQQD  994

Query  256  LLSI  245
            LLSI
Sbjct  995  LLSI  998



>ref|XP_004230451.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Solanum lycopersicum]
Length=995

 Score =   121 bits (304),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVGE GDGVDIVQW +K+T+ K+E V  I+D RL++VP  EAMH+F++++LC++E 
Sbjct  880  TGRRPVGEFGDGVDIVQWSKKVTNCKREQVTHIVDPRLTSVPQDEAMHLFFISMLCIQEN  939

Query  430  AVERPKMREVVQMLTELPKQPP  365
            +VERP MREV+QML+E P+Q P
Sbjct  940  SVERPTMREVIQMLSEFPRQSP  961



>ref|XP_009603651.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana tomentosiformis]
Length=1000

 Score =   121 bits (303),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 50/90 (56%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVGE GDGVDIVQW +++T+ K+E V  I+D RL+TVP  EAMH+F+VA+L ++E 
Sbjct  887  TGRRPVGEFGDGVDIVQWSKRVTNCKREQVRHIVDPRLTTVPEDEAMHLFFVAMLSIQEN  946

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTT  341
            +VERP MREV+QML+E P+Q P  +P  ++
Sbjct  947  SVERPTMREVIQMLSEFPRQSPEYQPSSSS  976



>emb|CDY68180.1| BnaAnng26370D [Brassica napus]
Length=99

 Score =   111 bits (278),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  580  DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREV  401
            DGV +VQWVRKMTD  KE VVK+LD RLS+  +HE  H+FYVA+LCVEEQAVERP +REV
Sbjct  8    DGVGVVQWVRKMTDSNKESVVKVLDPRLSSFALHEVTHVFYVAMLCVEEQAVERPTIREV  67

Query  400  VQMLTELPKQP  368
            VQ+LTE+PK P
Sbjct  68   VQILTEVPKMP  78



>gb|ACL54651.1| unknown [Zea mays]
Length=441

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIV WVR +T   KEGV+KI D RLSTVP++E  H+FYVA+LCV EQ
Sbjct  318  AGRKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQ  377

Query  430  AVERPKMREVVQMLTELPKQPPGTK  356
            +VERP MREVVQ+L ++P     T 
Sbjct  378  SVERPTMREVVQILADMPGSTSTTS  402



>emb|CDX91053.1| BnaC02g05440D [Brassica napus]
Length=99

 Score =   111 bits (278),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  580  DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREV  401
            DGV +VQWVRKMTD  KE VVK+LD RLS+ P+HE  H+FYVA+LCVEEQAVERP +RE 
Sbjct  8    DGVGVVQWVRKMTDSNKESVVKVLDPRLSSFPLHEVTHVFYVAMLCVEEQAVERPTIRED  67

Query  400  VQMLTELPKQP  368
            VQ+LTE+PK P
Sbjct  68   VQILTEVPKMP  78



>gb|AAX96206.1| Similar to receptor-like protein kinase 3 [Oryza sativa Japonica 
Group]
 gb|ABA92267.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
Length=1061

 Score =   120 bits (301),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 77/104 (74%), Gaps = 4/104 (4%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G++PVG+ G+GVDIVQW +++TDG++E V +I+D R+STVP+ E  H+F+V++LCV+E 
Sbjct  947   TGRRPVGDFGEGVDIVQWTKRVTDGRRESVHRIIDRRISTVPMDEVAHIFFVSMLCVQEN  1006

Query  430   AVERPKMREVVQMLTELPK----QPPGTKPEGTTACESSALEPP  311
             +VERP MREVVQML+E P+    QP  +     T  ESS  + P
Sbjct  1007  SVERPTMREVVQMLSEFPRHGSDQPSPSSSAPETGEESSPEKEP  1050



>ref|XP_006431638.1| hypothetical protein CICLE_v10000148mg [Citrus clementina]
 gb|ESR44878.1| hypothetical protein CICLE_v10000148mg [Citrus clementina]
Length=997

 Score =   120 bits (300),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ GDGVDIVQW ++ T+G+KE  + ILD RLSTVP  EAMH+ +VA+LC++E 
Sbjct  887  TGRRPVGDFGDGVDIVQWSKRATNGRKEEFLSILDPRLSTVPKEEAMHLLFVAMLCIQEN  946

Query  430  AVERPKMREVVQMLTELPKQ  371
            ++ERP+MREVVQML+E P+ 
Sbjct  947  SIERPRMREVVQMLSEFPRH  966



>tpg|DAA59489.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1037

 Score =   120 bits (300),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDG-KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +GKKPVGE GDGVDIV WVR  T G  KE VVK++D RLS+VP+HE  H+F VALLCVEE
Sbjct  897  TGKKPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEE  956

Query  433  QAVERPKMREVVQMLTELPK  374
            Q+V+RP MREVVQML ELPK
Sbjct  957  QSVQRPTMREVVQMLGELPK  976



>ref|XP_006349327.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Solanum tuberosum]
Length=999

 Score =   120 bits (300),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVGE GDGVDIVQW +K+T+ K+E V  I+D RL+TVP  EAMH+F++++LC++E 
Sbjct  884  TGRRPVGEFGDGVDIVQWSKKVTNCKREQVTHIVDPRLTTVPEDEAMHLFFISMLCIQEN  943

Query  430  AVERPKMREVVQMLTELPKQ  371
            +VERP MREV+QML+E P+Q
Sbjct  944  SVERPTMREVIQMLSEFPRQ  963



>gb|EEC67924.1| hypothetical protein OsI_35629 [Oryza sativa Indica Group]
Length=1035

 Score =   119 bits (299),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 77/104 (74%), Gaps = 4/104 (4%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G++PVG+ G+GVDIVQW +++TDG++E V +I+D R+STVP+ E  H+F+V++LCV+E 
Sbjct  921   TGRRPVGDFGEGVDIVQWTKRVTDGRRESVHRIVDRRISTVPMDEVAHIFFVSMLCVQEN  980

Query  430   AVERPKMREVVQMLTELPK----QPPGTKPEGTTACESSALEPP  311
             +VERP MREVVQML+E P+    QP  +     T  ESS  + P
Sbjct  981   SVERPTMREVVQMLSEFPRHGSDQPSPSSSAPETGEESSPEKEP  1024



>tpg|DAA44225.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1002

 Score =   119 bits (298),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIV WVR +T   KEGV+KI D RLSTVP++E  H+FYVA+LCV EQ
Sbjct  879  AGRKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQ  938

Query  430  AVERPKMREVVQMLTELP  377
            +VERP MREVVQ+L ++P
Sbjct  939  SVERPTMREVVQILADMP  956



>ref|NP_001145765.1| uncharacterized protein LOC100279272 [Zea mays]
 gb|ACL52548.1| unknown [Zea mays]
Length=771

 Score =   118 bits (296),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE GDGVDIV WVR +T   KEGV+KI D RLSTVP++E  H+FYVA+LCV EQ
Sbjct  648  AGRKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQ  707

Query  430  AVERPKMREVVQMLTELP  377
            +VERP MREVVQ+L ++P
Sbjct  708  SVERPTMREVVQILADMP  725



>gb|EMT21762.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=313

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIVQW +++TDG++E V K++D RLSTVP+ E  H+F+V++LCV+E 
Sbjct  206  TGRRPVGDFGEGVDIVQWAKRVTDGRRESVPKVVDRRLSTVPMDEVSHLFFVSMLCVQEN  265

Query  430  AVERPKMREVVQMLTELPKQ  371
            +VERP MREVVQML+E P+ 
Sbjct  266  SVERPTMREVVQMLSEFPRH  285



>gb|KDO44093.1| hypothetical protein CISIN_1g001922mg [Citrus sinensis]
Length=995

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ GDGVDIVQW ++ T+G+KE  + ILD RLS VP  EAMH+ +VA+LC++E 
Sbjct  885  TGRRPVGDFGDGVDIVQWSKRATNGRKEEFLSILDPRLSMVPKEEAMHLLFVAMLCIQEN  944

Query  430  AVERPKMREVVQMLTELPKQ  371
            ++ERP+MREVVQML+E P+ 
Sbjct  945  SIERPRMREVVQMLSEFPRH  964



>ref|XP_006492589.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=995

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ GDGVDIVQW ++ T+G+KE  + ILD RLS VP  EAMH+ +VA+LC++E 
Sbjct  885  TGRRPVGDFGDGVDIVQWSKRATNGRKEEFLSILDPRLSMVPKEEAMHLLFVAMLCIQEN  944

Query  430  AVERPKMREVVQMLTELPKQ  371
            ++ERP+MREVVQML+E P+ 
Sbjct  945  SIERPRMREVVQMLSEFPRH  964



>dbj|BAJ90459.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1024

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIVQW +++TDG++E V K++D RLSTVP+ E  H+F+V++LCV+E 
Sbjct  912  TGRRPVGDFGEGVDIVQWAKRVTDGRRESVPKVVDRRLSTVPMDEVSHLFFVSMLCVQEN  971

Query  430  AVERPKMREVVQMLTELPKQ  371
            +VERP MREVVQML+E P+ 
Sbjct  972  SVERPTMREVVQMLSEFPRH  991



>ref|XP_006858565.1| hypothetical protein AMTR_s00071p00176900 [Amborella trichopoda]
 gb|ERN20032.1| hypothetical protein AMTR_s00071p00176900 [Amborella trichopoda]
Length=803

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/88 (57%), Positives = 67/88 (76%), Gaps = 2/88 (2%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G +PVG+ GDGVDIVQW ++ T G +  V  ILDSRL+ VP+ E+MH+F++A+LCV+E 
Sbjct  664  TGHRPVGDFGDGVDIVQWAKRTTGGDRRKVTLILDSRLNQVPLEESMHLFFIAMLCVQEN  723

Query  430  AVERPKMREVVQMLTEL--PKQPPGTKP  353
            ++ERP MREVVQML+E   PK P  T P
Sbjct  724  SIERPTMREVVQMLSEFPNPKPPSQTSP  751



>ref|XP_010912647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=992

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 48/91 (53%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVGE G+GVDIVQW +++T+  K  V KI+DSRLSTVPI+E MH+F++ +LC+ E 
Sbjct  880  TGRRPVGEFGEGVDIVQWAKRITNCDKNNVAKIVDSRLSTVPINEVMHVFFITMLCIHEN  939

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTA  338
            ++ERP MREVVQML+E P      +   ++A
Sbjct  940  SIERPTMREVVQMLSEFPHHASEDQSPSSSA  970



>gb|EEE51888.1| hypothetical protein OsJ_33462 [Oryza sativa Japonica Group]
Length=881

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 77/104 (74%), Gaps = 4/104 (4%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIVQW +++TDG++E V +I+D R+STVP+ E  H+F+V++LCV+E 
Sbjct  767  TGRRPVGDFGEGVDIVQWTKRVTDGRRESVHRIIDRRISTVPMDEVAHIFFVSMLCVQEN  826

Query  430  AVERPKMREVVQMLTELPK----QPPGTKPEGTTACESSALEPP  311
            +VERP MREVVQML+E P+    QP  +     T  ESS  + P
Sbjct  827  SVERPTMREVVQMLSEFPRHGSDQPSPSSSAPETGEESSPEKEP  870



>ref|XP_003576141.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1043

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
             +G++PVG+ G+GVDIVQW +++TDG++EGV K++D RLSTV + E  H+F+V++LCV+E 
Sbjct  931   TGRRPVGDFGEGVDIVQWAKRVTDGRREGVPKVVDRRLSTVAMDEVAHLFFVSMLCVQEN  990

Query  430   AVERPKMREVVQMLTELPKQ  371
             +VERP MREVVQML+E P+ 
Sbjct  991   SVERPTMREVVQMLSEFPRH  1010



>emb|CDO97616.1| unnamed protein product [Coffea canephora]
Length=1001

 Score =   116 bits (291),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 52/91 (57%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLST-VPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+GVDIVQW R+ T+ ++E V  I+D RLST VP  EAMH+F++A+LCV+E
Sbjct  882  TGRRPVGDFGEGVDIVQWARRATNCRREEVDGIVDPRLSTAVPKDEAMHLFFIAMLCVQE  941

Query  433  QAVERPKMREVVQMLTELPKQPPGTKPEGTT  341
             +VERP MREVVQML+E P+Q   T P+  T
Sbjct  942  NSVERPTMREVVQMLSEFPRQFSSTPPDYRT  972



>ref|XP_010930574.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=994

 Score =   116 bits (290),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVGE G+GVDIVQW +++T+  ++ V  I+DSRLSTVPI+E MH+F+VA+LCV+E 
Sbjct  881  TGRRPVGEFGNGVDIVQWAKRITNCNRDNVATIIDSRLSTVPINEVMHVFFVAMLCVQEN  940

Query  430  AVERPKMREVVQMLTEL  380
            +VERP MREVVQML+E 
Sbjct  941  SVERPTMREVVQMLSEF  957



>ref|XP_009355307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=999

 Score =   115 bits (289),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEE  434
            +G++PVGE G+GVDIVQW +K T+ +KE V  I+D RL+ +VP  EAMHMF++A+LC++E
Sbjct  884  TGRRPVGEFGEGVDIVQWSKKATNCRKEDVANIVDHRLTISVPKDEAMHMFFIAMLCIQE  943

Query  433  QAVERPKMREVVQMLTELPKQPP  365
             +VERP MREVVQML+E P+  P
Sbjct  944  NSVERPTMREVVQMLSEFPRHTP  966



>gb|KDP42443.1| hypothetical protein JCGZ_00240 [Jatropha curcas]
Length=995

 Score =   115 bits (287),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIVQW R++T  ++E V++++D RL+ VP  EAMH+F++A+LC +E 
Sbjct  882  TGRRPVGDFGEGVDIVQWSRRVTSNRREDVMQVVDRRLTMVPKDEAMHLFFIAMLCSQEN  941

Query  430  AVERPKMREVVQMLTELPKQPP  365
            ++ERP MREVVQML+E P+  P
Sbjct  942  SIERPTMREVVQMLSEFPRHSP  963



>ref|XP_010520784.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X2 [Tarenaya hassleriana]
Length=958

 Score =   115 bits (287),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 56/115 (49%), Positives = 76/115 (66%), Gaps = 18/115 (16%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIVQWV+ +T  +KE V+ ++D RLS VP  EA H+ +VA+LCVEE 
Sbjct  849  TGRRPVGDFGEGVDIVQWVKTVTRRRKEEVMLVVDHRLSNVPRQEAAHLLFVAMLCVEEN  908

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-----GTSDDAK  281
            +VERP MREVVQML E P      +PE       +   PPP+      G ++DAK
Sbjct  909  SVERPSMREVVQMLLEFP------RPE-------TPFSPPPAVHSPCKGVTNDAK  950



>ref|XP_010520783.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Tarenaya hassleriana]
Length=994

 Score =   115 bits (287),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 56/115 (49%), Positives = 76/115 (66%), Gaps = 18/115 (16%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIVQWV+ +T  +KE V+ ++D RLS VP  EA H+ +VA+LCVEE 
Sbjct  885  TGRRPVGDFGEGVDIVQWVKTVTRRRKEEVMLVVDHRLSNVPRQEAAHLLFVAMLCVEEN  944

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-----GTSDDAK  281
            +VERP MREVVQML E P      +PE       +   PPP+      G ++DAK
Sbjct  945  SVERPSMREVVQMLLEFP------RPE-------TPFSPPPAVHSPCKGVTNDAK  986



>emb|CBI29704.3| unnamed protein product [Vitis vinifera]
Length=895

 Score =   115 bits (287),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/90 (52%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIVQW ++ T+  KE V++I+D RL+T+P +EA H+F++ALLC+EE 
Sbjct  803  TGRRPVGDFGEGVDIVQWAKRTTNCCKENVIRIVDPRLATIPRNEATHLFFIALLCIEEN  862

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTT  341
            +VERP MREVVQML+E  +  P  K   ++
Sbjct  863  SVERPTMREVVQMLSESHRNSPDNKTSSSS  892



>ref|XP_002263291.2| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=976

 Score =   115 bits (287),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/90 (52%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIVQW ++ T+  KE V++I+D RL+T+P +EA H+F++ALLC+EE 
Sbjct  884  TGRRPVGDFGEGVDIVQWAKRTTNCCKENVIRIVDPRLATIPRNEATHLFFIALLCIEEN  943

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTT  341
            +VERP MREVVQML+E  +  P  K   ++
Sbjct  944  SVERPTMREVVQMLSESHRNSPDNKTSSSS  973



>ref|XP_007041221.1| Leucine-rich receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOX97052.1| Leucine-rich receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=988

 Score =   115 bits (287),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIV W +++T+ ++E V++I+D RL+TVP  EAMH+ ++A+LCV+E 
Sbjct  881  TGRRPVGDFGEGVDIVHWAKRVTNCRREEVMRIVDPRLTTVPKDEAMHLLFIAMLCVQEN  940

Query  430  AVERPKMREVVQMLTELPKQPP  365
            ++ERP MREVVQML+E P+  P
Sbjct  941  SIERPTMREVVQMLSEFPRHSP  962



>ref|XP_007224667.1| hypothetical protein PRUPE_ppa026134mg [Prunus persica]
 gb|EMJ25866.1| hypothetical protein PRUPE_ppa026134mg [Prunus persica]
Length=998

 Score =   114 bits (286),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEE  434
            +G++PVGE G+GVDIVQW +K T+ +KE V  I+D RL+ +VP  EAMH+F++A+LC++E
Sbjct  883  TGRRPVGEFGEGVDIVQWSKKATNCRKEDVTSIVDPRLAISVPKDEAMHLFFIAMLCIQE  942

Query  433  QAVERPKMREVVQMLTELPKQPP  365
             +VERP MREVVQML+E P+  P
Sbjct  943  HSVERPTMREVVQMLSEFPRHSP  965



>gb|EYU26470.1| hypothetical protein MIMGU_mgv1a019834mg [Erythranthe guttata]
Length=1001

 Score =   114 bits (286),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVGE G+GVDIVQWVR  T+ ++E V +I+D R++  P  EAMH+F+VA+LCV+E 
Sbjct  886  TGRRPVGEFGEGVDIVQWVRCSTNCRREDVTRIIDPRITVAPKDEAMHLFFVAMLCVQEN  945

Query  430  AVERPKMREVVQMLTELPK  374
            +VERP MREVVQML+E P+
Sbjct  946  SVERPTMREVVQMLSEFPR  964



>ref|XP_009411355.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1009

 Score =   114 bits (286),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 61/114 (54%), Positives = 77/114 (68%), Gaps = 17/114 (15%)
 Frame = -2

Query  610   SGKKPVGEXGDGVDIVQWVRKMTD--GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVE  437
             +G+KPVGE G+GVDIVQWVRKMT+    + GV +I+D RL TVP+ EA+H+F+VA+LCVE
Sbjct  895   TGRKPVGEFGEGVDIVQWVRKMTECGSNRGGVPQIVDPRLPTVPMDEAVHVFHVAMLCVE  954

Query  436   EQAVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALE-----------PPP  308
             EQ+VERP MREVVQ+L + PK      PE    CE+   E           PPP
Sbjct  955   EQSVERPTMREVVQILMDAPK----AAPEQGDDCEAPTKEAKEHQQPAQTSPPP  1004



>ref|XP_006859064.1| hypothetical protein AMTR_s00068p00198250 [Amborella trichopoda]
 gb|ERN20531.1| hypothetical protein AMTR_s00068p00198250 [Amborella trichopoda]
Length=737

 Score =   114 bits (284),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVGE GDGVDIVQW +  T   KEGV +ILDSRL  +PI EA H+F+VA+LCV+EQ
Sbjct  643  TGRRPVGEFGDGVDIVQWAKSTTSACKEGVFEILDSRLKDIPIEEAKHVFFVAMLCVQEQ  702

Query  430  AVERPKMREVVQMLTE  383
            +VERP MREVV ML +
Sbjct  703  SVERPTMREVVHMLQQ  718



>gb|KJB32855.1| hypothetical protein B456_005G265400 [Gossypium raimondii]
Length=992

 Score =   114 bits (285),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE G+G+DIV W + +T+ +K  V  I+D RL+TVP  EAMH+ ++A+LCV+E 
Sbjct  885  TGRKPVGEFGEGIDIVHWTKLVTNCRKAEVTSIVDPRLTTVPKDEAMHLLFIAMLCVQEN  944

Query  430  AVERPKMREVVQMLTELPKQPP  365
            ++ERP MREVVQML+E P+Q P
Sbjct  945  SIERPTMREVVQMLSEFPRQSP  966



>ref|XP_011092305.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Sesamum indicum]
Length=1004

 Score =   114 bits (284),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = -2

Query  610  SGKKPVG-EXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG E G+GVDIVQW +  TD ++E V +ILD RL+ VP  EAMH+F+VA+LC++E
Sbjct  894  TGRRPVGGEFGEGVDIVQWTKCSTDCRREEVSRILDPRLAVVPKDEAMHLFFVAMLCIQE  953

Query  433  QAVERPKMREVVQMLTELPKQPP  365
             +VERP MREVVQML+E P++ P
Sbjct  954  NSVERPTMREVVQMLSEFPRRSP  976



>ref|XP_011087678.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Sesamum indicum]
Length=992

 Score =   114 bits (284),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G +PVG  G+GVDIVQW+R  T+  +E V +I+D RL+ VP  EAMH+F+VA+LCV+E 
Sbjct  882  TGHRPVGGFGEGVDIVQWIRCSTNCNREEVTRIIDPRLTVVPKDEAMHLFFVAMLCVQEN  941

Query  430  AVERPKMREVVQMLTELPKQPP  365
             VERP MREVVQML+E P++ P
Sbjct  942  CVERPTMREVVQMLSEFPRRSP  963



>emb|CAN71863.1| hypothetical protein VITISV_023530 [Vitis vinifera]
Length=954

 Score =   113 bits (283),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 47/90 (52%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIVQW ++ T+  KE V+ I+D RL+T+P +EA H+F++ALLC+EE 
Sbjct  862  TGRRPVGDFGEGVDIVQWAKRTTNCCKENVIXIVDPRLATIPRNEATHLFFIALLCIEEN  921

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTT  341
            +VERP MREVVQML+E  +  P  K   ++
Sbjct  922  SVERPTMREVVQMLSESHRNSPDNKTSSSS  951



>gb|EYU33270.1| hypothetical protein MIMGU_mgv1a0010742mg, partial [Erythranthe 
guttata]
Length=138

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 75/101 (74%), Gaps = 3/101 (3%)
 Frame = -2

Query  610  SGKKPVG-EXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG E  +GVDIVQW +  T+ ++E V +I+D RL+ VP  EAMH+F+VA+LCV+E
Sbjct  25   TGRRPVGGEFSEGVDIVQWTKCSTNCRREEVTRIIDPRLTVVPKDEAMHLFFVAMLCVQE  84

Query  433  QAVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP  311
             +VERP MREVVQML+E P++ P   P  +++  S  L+PP
Sbjct  85   NSVERPTMREVVQMLSEFPRRSPEFHPSSSSS--SHQLQPP  123



>ref|XP_004485432.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Cicer arietinum]
Length=987

 Score =   113 bits (283),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDG-KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +GKKPVG+ G+GVD+VQW +K T+G ++E V  I+DSRL  VP  E MHMF++A+LC+EE
Sbjct  887  TGKKPVGDFGEGVDLVQWCKKSTNGGRREDVFNIVDSRLVVVPKEEVMHMFFIAMLCLEE  946

Query  433  QAVERPKMREVVQMLTELPKQ  371
             +V+RP MREVVQML+E P Q
Sbjct  947  NSVQRPTMREVVQMLSEFPPQ  967



>ref|XP_009401113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=987

 Score =   113 bits (283),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 70/110 (64%), Gaps = 13/110 (12%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG  GDGVDIVQW + +T   ++    I+D RLSTVP+ E MH+F+VA+LCV+E 
Sbjct  878  TGRRPVGGFGDGVDIVQWAKSVTSCSRDNAAAIVDPRLSTVPVDELMHVFFVAMLCVQEN  937

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAK  281
            +VERP MREVVQML+E P   P               + P S+ T+ D K
Sbjct  938  SVERPTMREVVQMLSEFPHHVPEN-------------QSPSSSSTARDKK  974



>ref|XP_008218726.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Prunus mume]
Length=982

 Score =   113 bits (282),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEE  434
            +G++PVGE G+GVDIVQW +K T+ +KE V  I+D RL+ +VP  EAMH+F++A LC++E
Sbjct  867  TGRRPVGEFGEGVDIVQWSKKATNCRKEDVTSIVDPRLAISVPKDEAMHLFFIATLCIQE  926

Query  433  QAVERPKMREVVQMLTELPKQPP  365
             +VERP MREVVQML+E P+  P
Sbjct  927  HSVERPTMREVVQMLSEFPRHSP  949



>ref|XP_008786484.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Phoenix dactylifera]
Length=995

 Score =   112 bits (280),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVGE G+GVDIVQW +++T+  ++ V  I+DSRLST+PI+E MH+F++A+LC+ E 
Sbjct  881  TGRRPVGEFGNGVDIVQWAKRITNCSRDNVATIVDSRLSTMPINEVMHVFFIAMLCIXEN  940

Query  430  AVERPKMREVVQMLTELP  377
            +VERP MREVV ML+E P
Sbjct  941  SVERPTMREVVLMLSEFP  958



>ref|XP_006385034.1| hypothetical protein POPTR_0004s23260g [Populus trichocarpa]
 gb|ERP62831.1| hypothetical protein POPTR_0004s23260g [Populus trichocarpa]
Length=1001

 Score =   112 bits (279),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ GDGVDIVQW ++ T+ +KE  + I+D RL+ VP  EAMH+F++A+LC +E 
Sbjct  882  TGRRPVGDFGDGVDIVQWSKRATNSRKEDAMHIVDPRLTMVPKDEAMHLFFIAMLCSQEN  941

Query  430  AVERPKMREVVQMLTELPKQPPGTKPE  350
            ++ERP MREVVQML+E P+    T P+
Sbjct  942  SIERPTMREVVQMLSEFPRH---TSPD  965



>ref|XP_008795253.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=992

 Score =   112 bits (279),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 46/91 (51%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVGE GDGVDIV W +K+T+  K    +I+DSRL  VPI+E MH+F++A+LC  E 
Sbjct  880  TGRRPVGEFGDGVDIVHWAKKITNCDKNNASRIVDSRLGAVPINEVMHIFFIAMLCTHEN  939

Query  430  AVERPKMREVVQMLTELPKQPPGTKPEGTTA  338
            ++ERP MREVVQML+E P      +   ++A
Sbjct  940  SIERPTMREVVQMLSEFPHHASEDQSPSSSA  970



>ref|XP_008347921.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=999

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/79 (61%), Positives = 65/79 (82%), Gaps = 1/79 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEE  434
            +G++PVGE G+GVDIVQW +K T+ +KE V  I+D RL+ +VP  EAMHMF++A+LC++E
Sbjct  884  TGRRPVGEFGEGVDIVQWSKKATNCRKEXVANIVDHRLTISVPKDEAMHMFFIAMLCIQE  943

Query  433  QAVERPKMREVVQMLTELP  377
             +VERP MREVVQML+E P
Sbjct  944  NSVERPTMREVVQMLSEFP  962



>ref|XP_011028346.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1001

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ GDGVDIVQW ++ T+ +KE  + I+D RL+ VP  EAMH+F++A+LC +E 
Sbjct  882  TGRRPVGDFGDGVDIVQWSKRATNSRKEDAMHIVDPRLTMVPKAEAMHLFFIAMLCSQEN  941

Query  430  AVERPKMREVVQMLTELPKQPPGTKPE  350
            ++ERP MREVVQML+E P+    T P+
Sbjct  942  SIERPTMREVVQMLSEFPRH---TSPD  965



>ref|XP_008339390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=999

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEE  434
            +G++PVGE G+GVDIVQW +K T+ +KE V  I+D RL+ ++P  EAMHMF++A+LC++E
Sbjct  884  TGRRPVGEFGEGVDIVQWSKKATNCRKEDVTNIVDHRLTVSLPKDEAMHMFFIAMLCIQE  943

Query  433  QAVERPKMREVVQMLTELPKQ  371
             +VERP MREVVQML+E P+ 
Sbjct  944  NSVERPTMREVVQMLSEFPRH  964



>ref|XP_002526451.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF35946.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=996

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ GDGVDIVQW +++T+ +KE V+ I+DSRL+ VP  E MH+F++ALLC +E 
Sbjct  883  TGRRPVGDFGDGVDIVQWSKRVTNNRKEDVLNIIDSRLTMVPKDEVMHLFFIALLCSQEN  942

Query  430  AVERPKMREVVQMLTELPKQ  371
            ++ERP MREVVQML+E  + 
Sbjct  943  SIERPTMREVVQMLSEFHRH  962



>ref|XP_010687839.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1010

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIVQW R  T+ +KE V  ILDSRL+ VP  EAMH+F+VA+LC +E 
Sbjct  896  TGRRPVGDFGEGVDIVQWSRVQTNCRKETVPIILDSRLTAVPQDEAMHLFFVAMLCTQEN  955

Query  430  AVERPKMREVVQMLTELPKQPPG  362
            ++ERP MREVVQML+E P    G
Sbjct  956  SIERPTMREVVQMLSEYPYHAMG  978



>gb|KCW57119.1| hypothetical protein EUGRSUZ_I02765 [Eucalyptus grandis]
Length=760

 Score =   111 bits (277),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIVQW +KMT  +KE V  I+D +L  VP  EA H+F++A+LCV++ 
Sbjct  646  TGRRPVGDFGEGVDIVQWSKKMTGCRKEEVTCIVDPKLKAVPKDEATHLFFIAMLCVQDN  705

Query  430  AVERPKMREVVQMLTELPKQPP  365
            +VERP MREVVQML+E P+  P
Sbjct  706  SVERPTMREVVQMLSEYPRHSP  727



>ref|XP_007040964.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX96795.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=986

 Score =   111 bits (277),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW ++ T+  KEGVVKILD R S +P+ EAM +F+VA+LCVEE
Sbjct  900  TGRRPVGDFGEEGLDIVQWTKRQTNWNKEGVVKILDQRASNIPVEEAMQVFFVAMLCVEE  959

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQML +  KQP
Sbjct  960  HSVERPTMREVVQMLAQ-AKQP  980



>gb|KHG14208.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=992

 Score =   111 bits (277),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE G+G+DIV W + +T+ +   V  I+D RL+TVP  EAMH+ ++A+LCV+E 
Sbjct  885  TGRKPVGEFGEGIDIVHWTKLVTNCRIAEVTNIVDPRLTTVPKDEAMHLLFIAMLCVQEN  944

Query  430  AVERPKMREVVQMLTELPKQPP  365
            ++ERP MREVVQML+E P+Q P
Sbjct  945  SIERPTMREVVQMLSEFPRQSP  966



>ref|XP_009392568.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=1040

 Score =   111 bits (277),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ GDGVDIVQWV++ T  ++E    I+D RLS+VP  E MH+F+V++LCV+E 
Sbjct  914  TGRRPVGDFGDGVDIVQWVKRATACRRENAASIVDCRLSSVPTDEVMHVFFVSMLCVQEN  973

Query  430  AVERPKMREVVQMLTELP  377
            +VERP MREVVQML+E P
Sbjct  974  SVERPTMREVVQMLSEFP  991



>ref|XP_010030176.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
Length=994

 Score =   111 bits (277),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+ G+GVDIVQW +KMT  +KE V  I+D +L  VP  EA H+F++A+LCV++ 
Sbjct  880  TGRRPVGDFGEGVDIVQWSKKMTGCRKEEVTCIVDPKLKAVPKDEATHLFFIAMLCVQDN  939

Query  430  AVERPKMREVVQMLTELPKQPP  365
            +VERP MREVVQML+E P+  P
Sbjct  940  SVERPTMREVVQMLSEYPRHSP  961



>ref|XP_008356104.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=987

 Score =   110 bits (276),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG  G+ G+DIVQW +  T+ +KEGV+KILD RL TVP+ EAM +F+VA+LCV+E
Sbjct  901  TGRRPVGGFGEEGMDIVQWTKIQTNSQKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQE  960

Query  433  QAVERPKMREVVQMLTELPKQP  368
            Q+VERP MREVVQML +  KQP
Sbjct  961  QSVERPTMREVVQMLAQ-AKQP  981



>gb|KCW62729.1| hypothetical protein EUGRSUZ_G00319 [Eucalyptus grandis]
Length=958

 Score =   110 bits (275),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 64/83 (77%), Gaps = 1/83 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVR-KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ GDGVDIVQW +   T+ ++E   +++D RLS VP  EA H+F+VA+LCV+E
Sbjct  852  TGRRPVGDFGDGVDIVQWTKIATTNWRREEATRVVDPRLSLVPKDEATHVFFVAMLCVQE  911

Query  433  QAVERPKMREVVQMLTELPKQPP  365
             + ERP MREVVQML+E P+ PP
Sbjct  912  NSTERPTMREVVQMLSEFPRHPP  934



>ref|XP_010065309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
Length=990

 Score =   110 bits (275),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 64/83 (77%), Gaps = 1/83 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVR-KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ GDGVDIVQW +   T+ ++E   +++D RLS VP  EA H+F+VA+LCV+E
Sbjct  884  TGRRPVGDFGDGVDIVQWTKIATTNWRREEATRVVDPRLSLVPKDEATHVFFVAMLCVQE  943

Query  433  QAVERPKMREVVQMLTELPKQPP  365
             + ERP MREVVQML+E P+ PP
Sbjct  944  NSTERPTMREVVQMLSEFPRHPP  966



>ref|XP_010243895.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X1 [Nelumbo nucifera]
 ref|XP_010243896.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X2 [Nelumbo nucifera]
 ref|XP_010243898.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X3 [Nelumbo nucifera]
Length=991

 Score =   110 bits (275),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G++PVG+  +GVDIVQW ++ T+ +KE V++I+D RL+ VPI EAMH+F++A+LCV+E 
Sbjct  880  TGRRPVGDFEEGVDIVQWAKRSTNCRKEEVIRIIDPRLTGVPIDEAMHVFFIAMLCVQEN  939

Query  430  AVERPKMREVVQMLTEL  380
            +VERP MREVVQML+E 
Sbjct  940  SVERPTMREVVQMLSEF  956



>ref|XP_009363288.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=987

 Score =   110 bits (275),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG  G+ G+DIVQW +  T+ +KEGV+KILD RL  VP+ EAM +F+VA+LCVEE
Sbjct  901  TGRRPVGGFGEEGMDIVQWTKIQTNSQKEGVIKILDKRLDAVPMDEAMQVFFVAVLCVEE  960

Query  433  QAVERPKMREVVQMLTELPKQP  368
            Q+VERP MREVVQML +  KQP
Sbjct  961  QSVERPTMREVVQMLAQ-AKQP  981



>ref|XP_009353760.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=999

 Score =   110 bits (274),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEE  434
            +G++PVGE G+GVDIVQW +K T+ +KE V  I+D RL+ ++P  E MHMF++A+LC++E
Sbjct  884  TGRRPVGEFGEGVDIVQWSKKATNCRKEDVTNIVDHRLTISLPKDEVMHMFFIAMLCIQE  943

Query  433  QAVERPKMREVVQMLTELPKQ  371
             +VERP MREVVQML+E P+ 
Sbjct  944  NSVERPTMREVVQMLSEFPRH  964



>ref|XP_004295533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=982

 Score =   110 bits (274),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG  G+ G+DIVQW +  TD +KEGV+KILD RL +VP+ EAM +F+VA+LCV+E
Sbjct  896  TGRRPVGGFGEEGMDIVQWTKLQTDSRKEGVIKILDQRLGSVPLDEAMQVFFVAVLCVQE  955

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQML +  KQP
Sbjct  956  HSVERPTMREVVQMLAQ-AKQP  976



>ref|XP_002304615.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE79594.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score =   110 bits (274),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW +  T   KEGVVKILD RL+ +P+ EAM +F+VA+LCV+E
Sbjct  902  TGRRPVGDFGEEGLDIVQWTKTQTKSSKEGVVKILDQRLTDIPLIEAMQVFFVAMLCVQE  961

Query  433  QAVERPKMREVVQMLTELPKQP  368
            Q+VERP MREVVQML +  KQP
Sbjct  962  QSVERPTMREVVQMLAQ-AKQP  982



>gb|AHJ14779.1| CLAVATA1 [Rhododendron ovatum]
Length=992

 Score =   110 bits (274),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G DG+DIVQW +  T+  KEGVVKILD RL  VP+ EAM +F+VA+LCV+E
Sbjct  906  TGRRPVGDFGEDGMDIVQWTKIKTNWSKEGVVKILDERLKNVPVDEAMQVFFVAMLCVQE  965

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQML +  KQP
Sbjct  966  HSVERPTMREVVQMLAQ-AKQP  986



>gb|KJB16198.1| hypothetical protein B456_002G217000 [Gossypium raimondii]
Length=770

 Score =   108 bits (271),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE G+GVDIVQW ++ T+ ++E V  I+D RL++VP  EAMH+ ++A+LCV+E 
Sbjct  673  TGRKPVGEFGEGVDIVQWAKRSTNCRREEVSNIVDRRLTSVPKDEAMHLLFIAMLCVQEN  732

Query  430  AVERPKMREVVQMLTELPKQ  371
            ++ERP MREVVQML+E  + 
Sbjct  733  SIERPTMREVVQMLSEFARH  752



>gb|KHG17337.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1006

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE G+GVDIVQW ++ T+ ++E V  I+D RL++VP  EAMH+ ++A+LCV+E 
Sbjct  909  TGRKPVGEFGEGVDIVQWAKRSTNCRREEVSNIVDRRLTSVPKDEAMHLLFIAMLCVQEN  968

Query  430  AVERPKMREVVQMLTELPKQ  371
            ++ERP MREVVQML+E  + 
Sbjct  969  SIERPTMREVVQMLSEFARH  988



>gb|KJB16199.1| hypothetical protein B456_002G217000 [Gossypium raimondii]
Length=1007

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G+KPVGE G+GVDIVQW ++ T+ ++E V  I+D RL++VP  EAMH+ ++A+LCV+E 
Sbjct  910  TGRKPVGEFGEGVDIVQWAKRSTNCRREEVSNIVDRRLTSVPKDEAMHLLFIAMLCVQEN  969

Query  430  AVERPKMREVVQMLTELPKQ  371
            ++ERP MREVVQML+E  + 
Sbjct  970  SIERPTMREVVQMLSEFARH  989



>ref|XP_009368577.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=987

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG  G+ G+DIVQW +  T+ +KEGV+KILD RL TVP+ EAM +F+VA+LCV+E
Sbjct  901  TGRRPVGGFGEEGMDIVQWTKIQTNSQKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQE  960

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQML +  KQP
Sbjct  961  HSVERPTMREVVQMLAQ-AKQP  981



>ref|XP_008349109.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=987

 Score =   108 bits (271),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG  G+ G+DIVQW +  T+ +KEGV+KILD RL TVP+ EAM +F+VA+LCV+E
Sbjct  901  TGRRPVGGFGEEGMDIVQWTKIQTNSQKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQE  960

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQML +  KQP
Sbjct  961  HSVERPTMREVVQMLAQ-AKQP  981



>ref|XP_006468612.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like isoform X1 [Citrus sinensis]
Length=987

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW +  T+  KEGVVKILD RLS  P+ EAM +F+VA+LCV+E
Sbjct  901  TGRRPVGDFGEEGLDIVQWTKMQTNSSKEGVVKILDQRLSNTPLSEAMQVFFVAMLCVQE  960

Query  433  QAVERPKMREVVQMLTELPKQPPGT  359
              VERP MREVVQML +   Q P T
Sbjct  961  HGVERPTMREVVQMLAQ--AQKPNT  983



>ref|XP_007163887.1| hypothetical protein PHAVU_L008000g [Phaseolus vulgaris]
 gb|ESW35881.1| hypothetical protein PHAVU_L008000g [Phaseolus vulgaris]
Length=106

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -2

Query  547  MTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  374
            MTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK
Sbjct  1    MTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK  58



>ref|XP_011022287.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Populus euphratica]
Length=988

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW +  T   KEGVVKILD RL  +P+ EAM +F+VA+LCV+E
Sbjct  902  TGRRPVGDFGEEGLDIVQWTKTQTKSSKEGVVKILDQRLIDIPLIEAMQVFFVAMLCVQE  961

Query  433  QAVERPKMREVVQMLTELPKQP  368
            Q+VERP MREVVQML +  KQP
Sbjct  962  QSVERPTMREVVQMLAQ-AKQP  982



>gb|KDO77158.1| hypothetical protein CISIN_1g012213mg [Citrus sinensis]
Length=468

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW +  T+  KEGVVKILD RLS  P+ EAM +F+VA+LCV+E
Sbjct  382  TGRRPVGDFGEEGLDIVQWTKMQTNSSKEGVVKILDQRLSNTPLSEAMQVFFVAMLCVQE  441

Query  433  QAVERPKMREVVQMLTELPKQPPGT  359
              VERP MREVVQML +   Q P T
Sbjct  442  HGVERPTMREVVQMLAQ--AQKPNT  464



>ref|XP_008799579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Phoenix dactylifera]
Length=984

 Score =   108 bits (269),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW R  T+  KEGVVKILD RL   P+ EAM +F+V +LCV+E
Sbjct  898  TGRRPVGDFGEEGLDIVQWARMNTNWSKEGVVKILDPRLINFPLEEAMQVFFVGMLCVQE  957

Query  433  QAVERPKMREVVQMLTELPKQPPG  362
            Q+VERP MREVVQML E  KQP G
Sbjct  958  QSVERPTMREVVQML-EQTKQPFG  980



>ref|XP_011004294.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Populus euphratica]
Length=988

 Score =   108 bits (269),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW +  T   KEGVVKILD  L+ +P+ EAM +F+VA+LCV+E
Sbjct  902  TGRRPVGDFGEEGLDIVQWTKTQTKSSKEGVVKILDQGLTDIPLIEAMQVFFVAMLCVQE  961

Query  433  QAVERPKMREVVQMLTELPKQP  368
            Q+VERP MREVVQML E  KQP
Sbjct  962  QSVERPTMREVVQMLAE-AKQP  982



>ref|XP_002297907.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82712.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score =   108 bits (269),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW +  T   KEGVVKILD  L+ +P+ EAM +F+VA+LCV+E
Sbjct  902  TGRRPVGDFGEEGLDIVQWTKTQTKSSKEGVVKILDQGLTDIPLIEAMQVFFVAMLCVQE  961

Query  433  QAVERPKMREVVQMLTELPKQP  368
            Q+VERP MREVVQML E  KQP
Sbjct  962  QSVERPTMREVVQMLAE-AKQP  982



>gb|KDP23869.1| hypothetical protein JCGZ_27138 [Jatropha curcas]
Length=989

 Score =   107 bits (268),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG  G+ G+DIVQW +  T+  KE VVKILD RLS +P+ EAM +F+VA+LCV+E
Sbjct  903  TGRRPVGGFGEEGLDIVQWTKIQTNSSKERVVKILDQRLSEIPLIEAMQVFFVAMLCVQE  962

Query  433  QAVERPKMREVVQMLTELPKQP  368
            Q+VERP MREVVQML E  KQP
Sbjct  963  QSVERPTMREVVQMLAE-AKQP  983



>ref|XP_004491265.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Cicer arietinum]
Length=976

 Score =   107 bits (268),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW +  TD  KE VVKILD RL  +P+ EAM +F+VA+LCV+E
Sbjct  891  TGRRPVGDFGEEGIDIVQWTKLQTDWNKEKVVKILDGRLHHIPLDEAMQLFFVAMLCVQE  950

Query  433  QAVERPKMREVVQMLTELPKQP  368
            Q+VERP MREVV+ML +  KQP
Sbjct  951  QSVERPTMREVVEMLAQ-AKQP  971



>ref|XP_006448558.1| hypothetical protein CICLE_v10014145mg [Citrus clementina]
 gb|ESR61798.1| hypothetical protein CICLE_v10014145mg [Citrus clementina]
Length=987

 Score =   107 bits (267),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 50/85 (59%), Positives = 63/85 (74%), Gaps = 3/85 (4%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW +  T+  KEGVVKILD RLS  P+ EAM +F+VA LCV+E
Sbjct  901  TGRRPVGDFGEEGLDIVQWTKMQTNSSKEGVVKILDQRLSNTPLSEAMQVFFVATLCVQE  960

Query  433  QAVERPKMREVVQMLTELPKQPPGT  359
              VERP MREVVQML +   Q P T
Sbjct  961  HGVERPTMREVVQMLAQ--AQKPNT  983



>ref|XP_010087435.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM2 [Morus notabilis]
 gb|EXB29045.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM2 [Morus notabilis]
Length=1014

 Score =   107 bits (266),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 66/88 (75%), Gaps = 8/88 (9%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLST--------VPIHEAMHMFYV  455
            +G++PVGE G+GVDIVQW +K T+ ++E V++I+D RL T        VP  EAMH+F++
Sbjct  893  TGRRPVGEFGEGVDIVQWCKKATNCRREDVLQIVDRRLMTTSTTANYNVPKEEAMHLFFI  952

Query  454  ALLCVEEQAVERPKMREVVQMLTELPKQ  371
            A LCV+E +VERP MREVVQML+EL + 
Sbjct  953  ATLCVQENSVERPTMREVVQMLSELTRH  980



>ref|XP_008793129.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Phoenix dactylifera]
Length=988

 Score =   107 bits (266),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 49/77 (64%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G+KPVG+ G+ G+DIVQW R  T+  KEGVVKILD RL  VP+ EAM +F+V +LCV+E
Sbjct  902  TGRKPVGDFGEEGLDIVQWARMNTNWSKEGVVKILDPRLINVPLEEAMQVFFVGMLCVQE  961

Query  433  QAVERPKMREVVQMLTE  383
            Q+VERP MREVVQML +
Sbjct  962  QSVERPTMREVVQMLEQ  978



>ref|XP_007214567.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
 gb|EMJ15766.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
Length=986

 Score =   107 bits (266),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG  G+ G+DIVQW +  T+  KEGV+KILD RL +VP+ EAM +F+VA+LCV+E
Sbjct  900  TGRRPVGGFGEEGLDIVQWTKIQTNLLKEGVIKILDKRLDSVPLDEAMQVFFVAVLCVQE  959

Query  433  QAVERPKMREVVQMLTELPKQP  368
            Q+VERP MREVVQML +  KQP
Sbjct  960  QSVERPTMREVVQMLAQ-AKQP  980



>ref|XP_009600411.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana tomentosiformis]
Length=964

 Score =   106 bits (265),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG  G+ GVDIVQW ++ T+  KEGVVKILD RL  V   EAM +F+VA+LCVEE
Sbjct  878  TGRRPVGNFGEEGVDIVQWAKRETNWSKEGVVKILDERLKNVATAEAMQVFFVAMLCVEE  937

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQML++  KQP
Sbjct  938  YSVERPTMREVVQMLSQ-AKQP  958



>emb|CDP04113.1| unnamed protein product [Coffea canephora]
Length=987

 Score =   106 bits (265),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG  G+ G+DIVQW    T+  KEGVVKILD RL  VP++EAM +F+VA+LCV+E
Sbjct  901  TGRRPVGNFGEEGLDIVQWANIQTNWSKEGVVKILDERLKNVPLNEAMQVFFVAMLCVQE  960

Query  433  QAVERPKMREVVQMLTELPKQP  368
             ++ERP MREVVQML +  KQP
Sbjct  961  HSIERPTMREVVQMLAQ-AKQP  981



>ref|XP_008793131.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Phoenix dactylifera]
Length=813

 Score =   106 bits (264),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 49/77 (64%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G+KPVG+ G+ G+DIVQW R  T+  KEGVVKILD RL  VP+ EAM +F+V +LCV+E
Sbjct  727  TGRKPVGDFGEEGLDIVQWARMNTNWSKEGVVKILDPRLINVPLEEAMQVFFVGMLCVQE  786

Query  433  QAVERPKMREVVQMLTE  383
            Q+VERP MREVVQML +
Sbjct  787  QSVERPTMREVVQMLEQ  803



>ref|XP_004301907.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=1011

 Score =   106 bits (264),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEE  434
            +G++PVGE G+G+DIVQW +K+T+ +K+    I+D RL+ +VP  EAMH+F++A+ CV+E
Sbjct  897  TGRRPVGEFGEGIDIVQWSKKVTNCRKQDAADIVDPRLAISVPKDEAMHLFFIAMHCVQE  956

Query  433  QAVERPKMREVVQMLTELPK  374
             +VERP MREVVQML+E P+
Sbjct  957  NSVERPTMREVVQMLSEFPR  976



>ref|XP_010918071.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Elaeis guineensis]
Length=984

 Score =   106 bits (264),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/77 (61%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW R  T+  KEGVVKILD RL  VP+ EAM +F+V +LC++E
Sbjct  898  TGRRPVGDFGEEGLDIVQWARMNTNWSKEGVVKILDPRLINVPLEEAMQVFFVGMLCIQE  957

Query  433  QAVERPKMREVVQMLTE  383
            Q+VERP MREVVQML +
Sbjct  958  QSVERPTMREVVQMLEQ  974



>ref|XP_010260843.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
 ref|XP_010260847.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
Length=1006

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW +  T+  KEGV+KILD RL+ VP+ EAM +F+V +LCV+E
Sbjct  920  TGRRPVGDFGEEGLDIVQWTKMNTNWNKEGVMKILDERLTNVPLDEAMQVFFVGMLCVQE  979

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQML +  KQP
Sbjct  980  HSVERPTMREVVQMLVQ-AKQP  1000



>ref|XP_009415746.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=978

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +GK+PVG+ G+ G+DIVQW R  T+  KEGVV I+D RL  VP+ EAM +F+VA+LCV+E
Sbjct  892  TGKRPVGDLGEEGLDIVQWARMNTNWHKEGVVNIMDRRLIDVPMEEAMQVFFVAMLCVQE  951

Query  433  QAVERPKMREVVQMLTE  383
             +VERPKMREVVQML +
Sbjct  952  HSVERPKMREVVQMLEQ  968



>emb|CDY54567.1| BnaA08g30460D [Brassica napus]
Length=844

 Score =   105 bits (261),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G+KPV + G+ G+DIVQW +  T+  K+GVVKI+D RLS VP+ EAM +F+VA+LCV+E
Sbjct  761  TGRKPVDKFGEEGIDIVQWSKIQTNCNKQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQE  820

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQM+++  KQP
Sbjct  821  HSVERPTMREVVQMISQ-AKQP  841



>ref|XP_009763204.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana sylvestris]
Length=958

 Score =   105 bits (262),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG  G+ G+DIVQW ++ T+  KEGVVKILD RL  V   EAM +F+VA+LCVEE
Sbjct  872  TGRRPVGNFGEEGLDIVQWAKRETNWSKEGVVKILDERLKNVATAEAMQVFFVAMLCVEE  931

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQML++  KQP
Sbjct  932  YSVERPTMREVVQMLSQ-AKQP  952



>ref|XP_009108464.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=995

 Score =   105 bits (261),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G+KPV + G+ G+DIVQW +  T+  K+GVVKI+D RLS VP+ EAM +F+VA+LCV+E
Sbjct  912  TGRKPVDKFGEEGIDIVQWSKIQTNCNKQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQE  971

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQM+++  KQP
Sbjct  972  HSVERPTMREVVQMISQ-AKQP  992



>gb|EPS62062.1| protein kinase, partial [Genlisea aurea]
Length=979

 Score =   104 bits (260),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQ  431
            +G + VGE G+GVDIVQW R+ T+ +   V +ILD RLS VP  EAMH+ ++++LCV++ 
Sbjct  880  TGHRAVGEFGEGVDIVQWTRRSTNCRTAEVTRILDPRLSVVPKDEAMHLLFISMLCVDDN  939

Query  430  AVERPKMREVVQMLTELPKQ  371
            +V+RP MREVVQML+E P++
Sbjct  940  SVQRPTMREVVQMLSEFPRK  959



>gb|KHG23359.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Gossypium arboreum]
Length=995

 Score =   104 bits (260),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 66/83 (80%), Gaps = 3/83 (4%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVE  437
            +G++PVG+ G+ G+DIVQW ++ T  KKEGVVKILD R+S T+P  E M +F+VA+LCVE
Sbjct  908  TGRRPVGDFGEEGLDIVQWSKRETKLKKEGVVKILDHRVSNTIPKEEVMQVFFVAMLCVE  967

Query  436  EQAVERPKMREVVQMLTELPKQP  368
            E +VERP MREVVQML +  KQP
Sbjct  968  EHSVERPTMREVVQMLAQ-AKQP  989



>ref|XP_008781646.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Phoenix dactylifera]
Length=215

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW R  T+  KEGV KILD R   VP+ EAM +F+  +LCV+E
Sbjct  129  TGRQPVGDFGEEGLDIVQWARMNTNWSKEGVAKILDPRQINVPLEEAMQVFFGGMLCVQE  188

Query  433  QAVERPKMREVVQMLTELPKQPPG  362
            Q+VERP MREVVQML +  KQP G
Sbjct  189  QSVERPTMREVVQMLKQ-TKQPSG  211



>gb|KJB32927.1| hypothetical protein B456_005G268400 [Gossypium raimondii]
Length=995

 Score =   104 bits (260),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 66/83 (80%), Gaps = 3/83 (4%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVE  437
            +G++PVG+ G+ G+DIVQW ++ T  KKEGVVKILD R+S T+P  E M +F+VA+LCVE
Sbjct  908  TGRRPVGDFGEEGLDIVQWSKRETKLKKEGVVKILDHRVSNTIPEEEVMQVFFVAMLCVE  967

Query  436  EQAVERPKMREVVQMLTELPKQP  368
            E +VERP MREVVQML +  KQP
Sbjct  968  EHSVERPTMREVVQMLAQ-AKQP  989



>emb|CDX93999.1| BnaC07g36330D [Brassica napus]
Length=844

 Score =   104 bits (259),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G+KPV + G+ G+DIVQW +  T+  ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E
Sbjct  761  TGRKPVDKFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQE  820

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQM+++  KQP
Sbjct  821  HSVERPTMREVVQMISQ-AKQP  841



>emb|CDX98665.1| BnaA03g44500D [Brassica napus]
Length=844

 Score =   104 bits (259),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G+KPV + G+ G+DIVQW +  T+  ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E
Sbjct  761  TGRKPVDKFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQE  820

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQM+++  KQP
Sbjct  821  HSVERPTMREVVQMISQ-AKQP  841



>ref|XP_009137141.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=967

 Score =   104 bits (259),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G+KPV + G+ G+DIVQW +  T+  ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E
Sbjct  884  TGRKPVDKFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQE  943

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQM+++  KQP
Sbjct  944  HSVERPTMREVVQMISQ-AKQP  964



>ref|XP_006413888.1| hypothetical protein EUTSA_v10024310mg [Eutrema salsugineum]
 gb|ESQ55341.1| hypothetical protein EUTSA_v10024310mg [Eutrema salsugineum]
Length=996

 Score =   104 bits (259),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G+KPV + G+ G+DIVQW +  T+  ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E
Sbjct  913  TGRKPVDKFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQE  972

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQM+++  KQP
Sbjct  973  HSVERPTMREVVQMISQ-AKQP  993



>emb|CDY31445.1| BnaC03g63790D [Brassica napus]
Length=844

 Score =   103 bits (258),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G+KPV + G+ G+DIVQW +  T+  K+GVVKI+D RLS VP+ EAM +F++A+LCV+E
Sbjct  761  TGRKPVDKFGEEGIDIVQWSKIQTNCNKQGVVKIIDQRLSNVPLGEAMELFFLAMLCVQE  820

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQM+++  KQP
Sbjct  821  HSVERPTMREVVQMISQ-AKQP  841



>ref|XP_004229499.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Solanum lycopersicum]
Length=960

 Score =   103 bits (258),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG  G+ G+DIVQW +  T   KEGVVKILD RL  V I EAM +F+VA+LCVEE
Sbjct  874  TGRRPVGNFGEEGMDIVQWAKTETKWSKEGVVKILDERLKNVAIVEAMQVFFVAMLCVEE  933

Query  433  QAVERPKMREVVQMLTELPKQP  368
             ++ERP MREVVQML++  KQP
Sbjct  934  YSIERPTMREVVQMLSQ-AKQP  954



>ref|XP_010924539.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Elaeis guineensis]
Length=986

 Score =   103 bits (258),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 47/77 (61%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+ G+DIVQW R  T+  KEGVVKILD RL  VP+ EAM +F+V +LCV+E
Sbjct  900  TGRRPVGDFGEEGLDIVQWARMNTNWSKEGVVKILDPRLIDVPLEEAMQVFFVGMLCVQE  959

Query  433  QAVERPKMREVVQMLTE  383
             +VERP MREVVQML +
Sbjct  960  HSVERPTMREVVQMLEQ  976



>ref|XP_002869943.1| hypothetical protein ARALYDRAFT_492844 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46202.1| hypothetical protein ARALYDRAFT_492844 [Arabidopsis lyrata subsp. 
lyrata]
Length=992

 Score =   103 bits (258),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G+KPV   G+ G+DIVQW +  T+  ++GVVKI+D RLS +P+ EAM +F+VA+LCV+E
Sbjct  909  TGRKPVDNFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNIPLEEAMELFFVAMLCVQE  968

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQM+++  KQP
Sbjct  969  HSVERPTMREVVQMISQ-AKQP  989



>ref|NP_001170600.1| uncharacterized protein LOC100384637 [Zea mays]
 gb|ACR34174.1| unknown [Zea mays]
Length=206

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = -2

Query  610  SGKKPVGEXGDGVDIVQWVRKMTDGKKEGVVKILDSRL-STVPIHEAMHMFYVALLCVEE  434
            +G++PVG+ G+GVDIVQW ++ T G++E V  I+D RL    P  E  H+F+V++LCV++
Sbjct  78   TGRRPVGDFGEGVDIVQWAKRATAGRREAVPGIVDRRLVGGAPADEVAHLFFVSMLCVQD  137

Query  433  QAVERPKMREVVQMLTELPKQ  371
             +VERP MREVVQML ELP+ 
Sbjct  138  NSVERPTMREVVQMLAELPRH  158



>ref|XP_010439602.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Camelina sativa]
Length=997

 Score =   103 bits (258),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G+KPV   G+ G+DIVQW +  T+  ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E
Sbjct  914  TGRKPVDNFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQE  973

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQM+++  KQP
Sbjct  974  HSVERPTMREVVQMISQ-AKQP  994



>ref|XP_010449207.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Camelina sativa]
Length=998

 Score =   103 bits (258),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -2

Query  610  SGKKPVGEXGD-GVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEE  434
            +G+KPV   G+ G+DIVQW +  T+  ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E
Sbjct  915  TGRKPVDNFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQE  974

Query  433  QAVERPKMREVVQMLTELPKQP  368
             +VERP MREVVQM+++  KQP
Sbjct  975  HSVERPTMREVVQMISQ-AKQP  995



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230