BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF044J23

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006367734.1|  PREDICTED: probable pectin methyltransferase...    146   7e-37   Solanum tuberosum [potatoes]
ref|XP_009760349.1|  PREDICTED: probable pectin methyltransferase...    145   1e-36   Nicotiana sylvestris
ref|XP_010320179.1|  PREDICTED: probable pectin methyltransferase...    143   6e-36   Solanum lycopersicum
ref|XP_009629595.1|  PREDICTED: probable pectin methyltransferase...    142   1e-35   Nicotiana tomentosiformis
gb|ACJ85808.1|  unknown                                                 134   1e-35   Medicago truncatula
ref|XP_003615127.1|  hypothetical protein MTR_5g064080                  134   1e-32   Medicago truncatula
gb|KHG17567.1|  putative pectin methyltransferase QUA2 -like protein    132   5e-32   Gossypium arboreum [tree cotton]
ref|XP_007018751.1|  S-adenosyl-L-methionine-dependent methyltran...    130   2e-31   
ref|XP_007018750.1|  S-adenosyl-L-methionine-dependent methyltran...    131   2e-31   
ref|XP_011074193.1|  PREDICTED: probable pectin methyltransferase...    131   2e-31   Sesamum indicum [beniseed]
gb|KJB59031.1|  hypothetical protein B456_009G236100                    130   2e-31   Gossypium raimondii
gb|KJB59030.1|  hypothetical protein B456_009G236100                    130   4e-31   Gossypium raimondii
ref|XP_003542374.1|  PREDICTED: probable pectin methyltransferase...    130   4e-31   Glycine max [soybeans]
gb|KJB64256.1|  hypothetical protein B456_010G039800                    129   9e-31   Gossypium raimondii
ref|XP_004953963.1|  PREDICTED: probable pectin methyltransferase...    128   1e-30   
gb|KJB64260.1|  hypothetical protein B456_010G039800                    128   1e-30   Gossypium raimondii
gb|KHG28112.1|  putative pectin methyltransferase QUA2 -like protein    128   1e-30   Gossypium arboreum [tree cotton]
ref|XP_007141184.1|  hypothetical protein PHAVU_008G174000g             126   6e-30   Phaseolus vulgaris [French bean]
ref|XP_003522790.1|  PREDICTED: probable pectin methyltransferase...    126   8e-30   Glycine max [soybeans]
gb|KHN19772.1|  Putative pectin methyltransferase QUA2                  126   9e-30   Glycine soja [wild soybean]
ref|XP_011100984.1|  PREDICTED: probable pectin methyltransferase...    126   9e-30   Sesamum indicum [beniseed]
gb|KHN13350.1|  Putative pectin methyltransferase QUA2                  126   9e-30   Glycine soja [wild soybean]
ref|XP_010060014.1|  PREDICTED: probable pectin methyltransferase...    126   9e-30   
ref|XP_003544795.1|  PREDICTED: probable pectin methyltransferase...    126   1e-29   Glycine max [soybeans]
ref|XP_010098612.1|  putative pectin methyltransferase QUA2             126   1e-29   Morus notabilis
ref|XP_010535445.1|  PREDICTED: probable pectin methyltransferase...    126   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_004490695.1|  PREDICTED: probable pectin methyltransferase...    125   2e-29   Cicer arietinum [garbanzo]
gb|KDP41393.1|  hypothetical protein JCGZ_15800                         125   3e-29   Jatropha curcas
ref|XP_002452533.1|  hypothetical protein SORBIDRAFT_04g027500          124   3e-29   
ref|XP_010521185.1|  PREDICTED: probable pectin methyltransferase...    124   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_006649061.1|  PREDICTED: probable pectin methyltransferase...    122   5e-29   
gb|KEH34953.1|  pectin methyltransferase QUA2, putative                 124   5e-29   Medicago truncatula
ref|XP_006581532.1|  PREDICTED: probable pectin methyltransferase...    124   6e-29   Glycine max [soybeans]
ref|XP_010926316.1|  PREDICTED: probable pectin methyltransferase...    123   7e-29   Elaeis guineensis
ref|XP_010926317.1|  PREDICTED: probable pectin methyltransferase...    123   7e-29   Elaeis guineensis
ref|XP_009380861.1|  PREDICTED: probable pectin methyltransferase...    123   7e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003570613.2|  PREDICTED: probable pectin methyltransferase...    124   8e-29   
gb|AFW73428.1|  hypothetical protein ZEAMMB73_978140                    121   8e-29   
gb|KHN08942.1|  Putative pectin methyltransferase QUA2                  123   8e-29   Glycine soja [wild soybean]
ref|XP_006390005.1|  hypothetical protein EUTSA_v10018220mg             123   1e-28   Eutrema salsugineum [saltwater cress]
gb|EAY87574.1|  hypothetical protein OsI_08986                          122   1e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_002513934.1|  S-adenosylmethionine-dependent methyltransfe...    122   1e-28   
ref|XP_010939668.1|  PREDICTED: probable pectin methyltransferase...    122   1e-28   Elaeis guineensis
dbj|BAD17245.1|  putative early-responsive to dehydration stress ...    122   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ24662.1|  hypothetical protein OsJ_08431                          122   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EMT33652.1|  hypothetical protein F775_26112                         122   1e-28   
ref|XP_008781887.1|  PREDICTED: probable pectin methyltransferase...    122   2e-28   Phoenix dactylifera
ref|XP_010269315.1|  PREDICTED: probable pectin methyltransferase...    122   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010269316.1|  PREDICTED: probable pectin methyltransferase...    122   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_008646287.1|  PREDICTED: probable pectin methyltransferase...    121   4e-28   Zea mays [maize]
ref|XP_002302304.2|  hypothetical protein POPTR_0002s09820g             121   4e-28   Populus trichocarpa [western balsam poplar]
gb|KDO80998.1|  hypothetical protein CISIN_1g005417mg                   119   4e-28   Citrus sinensis [apfelsine]
gb|AFW64432.1|  hypothetical protein ZEAMMB73_102169                    121   4e-28   
ref|XP_008679296.1|  PREDICTED: probable pectin methyltransferase...    121   5e-28   Zea mays [maize]
dbj|BAJ94920.1|  predicted protein                                      121   5e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86389.1|  predicted protein                                      120   6e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX88430.1|  BnaC06g38740D                                          120   6e-28   
ref|XP_009387117.1|  PREDICTED: probable pectin methyltransferase...    120   8e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010676338.1|  PREDICTED: probable pectin methyltransferase...    120   8e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB80353.1|  hypothetical protein B456_013G093300                    120   8e-28   Gossypium raimondii
gb|KHG30605.1|  hypothetical protein F383_04558                         120   9e-28   Gossypium arboreum [tree cotton]
ref|XP_010676321.1|  PREDICTED: probable pectin methyltransferase...    120   9e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010937423.1|  PREDICTED: probable pectin methyltransferase...    120   9e-28   Elaeis guineensis
ref|XP_004500638.1|  PREDICTED: probable pectin methyltransferase...    120   1e-27   
ref|XP_008790889.1|  PREDICTED: probable pectin methyltransferase...    118   1e-27   
ref|XP_004500637.1|  PREDICTED: probable pectin methyltransferase...    120   1e-27   Cicer arietinum [garbanzo]
ref|XP_002285784.1|  PREDICTED: probable pectin methyltransferase...    120   2e-27   Vitis vinifera
ref|XP_006472587.1|  PREDICTED: probable pectin methyltransferase...    119   2e-27   Citrus sinensis [apfelsine]
ref|XP_006433967.1|  hypothetical protein CICLE_v10000463mg             120   2e-27   Citrus clementina [clementine]
gb|KDO80995.1|  hypothetical protein CISIN_1g005417mg                   119   2e-27   Citrus sinensis [apfelsine]
ref|XP_006472585.1|  PREDICTED: probable pectin methyltransferase...    120   2e-27   Citrus sinensis [apfelsine]
ref|XP_009409275.1|  PREDICTED: probable pectin methyltransferase...    119   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO80996.1|  hypothetical protein CISIN_1g005417mg                   119   2e-27   Citrus sinensis [apfelsine]
ref|XP_002889181.1|  hypothetical protein ARALYDRAFT_895718             119   2e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_010428946.1|  PREDICTED: probable pectin methyltransferase...    119   2e-27   Camelina sativa [gold-of-pleasure]
gb|AAG52090.1|AC012680_1  unknown protein, 5' partial; 69506-67937      117   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011016595.1|  PREDICTED: probable pectin methyltransferase...    119   2e-27   Populus euphratica
emb|CDP01069.1|  unnamed protein product                                119   3e-27   Coffea canephora [robusta coffee]
ref|XP_009106531.1|  PREDICTED: probable pectin methyltransferase...    118   4e-27   Brassica rapa
emb|CDX87461.1|  BnaA07g34120D                                          118   4e-27   
ref|XP_010267469.1|  PREDICTED: probable pectin methyltransferase...    119   4e-27   Nelumbo nucifera [Indian lotus]
emb|CDY26858.1|  BnaA02g18830D                                          119   4e-27   Brassica napus [oilseed rape]
ref|XP_010416801.1|  PREDICTED: probable pectin methyltransferase...    119   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010472034.1|  PREDICTED: probable pectin methyltransferase...    118   5e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009128288.1|  PREDICTED: probable pectin methyltransferase...    118   6e-27   Brassica rapa
ref|XP_008466224.1|  PREDICTED: probable pectin methyltransferase...    118   7e-27   Cucumis melo [Oriental melon]
ref|XP_008790887.1|  PREDICTED: probable pectin methyltransferase...    118   7e-27   Phoenix dactylifera
emb|CDY14622.1|  BnaC02g24910D                                          117   7e-27   Brassica napus [oilseed rape]
ref|NP_001288873.1|  probable pectin methyltransferase QUA2             117   8e-27   Brassica rapa
ref|XP_011003042.1|  PREDICTED: probable pectin methyltransferase...    118   8e-27   Populus euphratica
ref|XP_002306569.2|  hypothetical protein POPTR_0005s17180g             118   8e-27   
ref|XP_010916838.1|  PREDICTED: probable pectin methyltransferase...    117   9e-27   Elaeis guineensis
ref|NP_177948.3|  putative pectin methyltransferase TSD2                117   1e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79252.1|  BnaC06g20510D                                          117   1e-26   
ref|XP_009104583.1|  PREDICTED: probable pectin methyltransferase...    117   1e-26   Brassica rapa
emb|CDX68025.1|  BnaA07g20650D                                          117   1e-26   
gb|KJB50579.1|  hypothetical protein B456_008G177800                    116   2e-26   Gossypium raimondii
gb|KHG21066.1|  hypothetical protein F383_04870                         116   2e-26   Gossypium arboreum [tree cotton]
gb|KJB59919.1|  hypothetical protein B456_009G280800                    116   2e-26   Gossypium raimondii
gb|KJB59914.1|  hypothetical protein B456_009G280800                    116   2e-26   Gossypium raimondii
gb|KJB59915.1|  hypothetical protein B456_009G280800                    116   2e-26   Gossypium raimondii
gb|KJB59918.1|  hypothetical protein B456_009G280800                    116   2e-26   Gossypium raimondii
ref|XP_008353088.1|  PREDICTED: probable methyltransferase PMT4         114   2e-26   
gb|KHN20522.1|  Putative methyltransferase PMT4                         112   3e-26   Glycine soja [wild soybean]
ref|XP_004136285.1|  PREDICTED: probable pectin methyltransferase...    115   4e-26   Cucumis sativus [cucumbers]
ref|XP_008811174.1|  PREDICTED: probable pectin methyltransferase...    115   6e-26   Phoenix dactylifera
ref|XP_008219451.1|  PREDICTED: probable pectin methyltransferase...    115   6e-26   Prunus mume [ume]
ref|XP_007225175.1|  hypothetical protein PRUPE_ppa002227mg             115   6e-26   Prunus persica
ref|XP_007045901.1|  Quasimodo2 like 2 isoform 6                        114   8e-26   
ref|XP_007045896.1|  Quasimodo2 like 2 isoform 1                        114   8e-26   
ref|XP_004300652.1|  PREDICTED: probable pectin methyltransferase...    115   9e-26   Fragaria vesca subsp. vesca
ref|XP_007045897.1|  Quasimodo2 like 2 isoform 2                        114   9e-26   
ref|XP_008361773.1|  PREDICTED: probable methyltransferase PMT5         114   1e-25   
gb|EPS65073.1|  hypothetical protein M569_09706                         114   1e-25   Genlisea aurea
ref|XP_006300626.1|  hypothetical protein CARUB_v10019895mg             114   2e-25   Capsella rubella
ref|XP_007157839.1|  hypothetical protein PHAVU_002G102600g             113   2e-25   Phaseolus vulgaris [French bean]
ref|XP_009372838.1|  PREDICTED: probable pectin methyltransferase...    113   4e-25   Pyrus x bretschneideri [bai li]
ref|XP_004505366.1|  PREDICTED: probable methyltransferase PMT5-like    112   6e-25   Cicer arietinum [garbanzo]
ref|XP_006605543.1|  PREDICTED: probable methyltransferase PMT5-like    112   6e-25   Glycine max [soybeans]
ref|XP_011463023.1|  PREDICTED: probable methyltransferase PMT5         112   8e-25   Fragaria vesca subsp. vesca
ref|XP_006583950.1|  PREDICTED: probable methyltransferase PMT5-like    111   1e-24   Glycine max [soybeans]
gb|KHG00547.1|  hypothetical protein F383_17617                         111   1e-24   Gossypium arboreum [tree cotton]
ref|XP_009334340.1|  PREDICTED: probable pectin methyltransferase...    111   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_008221508.1|  PREDICTED: probable methyltransferase PMT5         111   1e-24   Prunus mume [ume]
ref|XP_007226959.1|  hypothetical protein PRUPE_ppa002650mg             111   2e-24   
ref|XP_009334333.1|  PREDICTED: probable pectin methyltransferase...    111   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_009356400.1|  PREDICTED: probable methyltransferase PMT5         110   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_010320876.1|  PREDICTED: probable methyltransferase PMT5         110   2e-24   
ref|XP_010680526.1|  PREDICTED: probable pectin methyltransferase...    111   2e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006348706.1|  PREDICTED: probable methyltransferase PMT5-l...    110   2e-24   Solanum tuberosum [potatoes]
ref|XP_006348707.1|  PREDICTED: probable methyltransferase PMT5-l...    110   2e-24   Solanum tuberosum [potatoes]
ref|XP_010066852.1|  PREDICTED: probable methyltransferase PMT5         110   3e-24   Eucalyptus grandis [rose gum]
ref|XP_008372670.1|  PREDICTED: probable pectin methyltransferase...    110   5e-24   
gb|KJB30458.1|  hypothetical protein B456_005G145000                    109   5e-24   Gossypium raimondii
ref|XP_008383924.1|  PREDICTED: probable pectin methyltransferase...    109   9e-24   Malus domestica [apple tree]
ref|XP_009631773.1|  PREDICTED: probable methyltransferase PMT5 i...    108   9e-24   Nicotiana tomentosiformis
ref|XP_009631772.1|  PREDICTED: probable methyltransferase PMT5 i...    108   9e-24   Nicotiana tomentosiformis
ref|XP_002316092.1|  dehydration-responsive family protein              108   1e-23   
ref|XP_006853194.1|  hypothetical protein AMTR_s00038p00207680          108   1e-23   
gb|AES89995.2|  methyltransferase PMT16, putative                       108   2e-23   Medicago truncatula
ref|XP_003607798.1|  hypothetical protein MTR_4g083030                  108   2e-23   
ref|XP_011012134.1|  PREDICTED: probable methyltransferase PMT5         107   2e-23   Populus euphratica
ref|XP_011018345.1|  PREDICTED: probable methyltransferase PMT5 i...    107   2e-23   Populus euphratica
ref|XP_006365135.1|  PREDICTED: probable methyltransferase PMT5-l...    107   3e-23   
emb|CDY45558.1|  BnaC09g21520D                                          107   3e-23   Brassica napus [oilseed rape]
ref|XP_002512094.1|  ATP binding protein, putative                      107   4e-23   
ref|XP_006365134.1|  PREDICTED: probable methyltransferase PMT5-l...    107   4e-23   Solanum tuberosum [potatoes]
ref|XP_010323873.1|  PREDICTED: probable methyltransferase PMT5         106   6e-23   Solanum lycopersicum
ref|XP_004135150.1|  PREDICTED: probable methyltransferase PMT4-like    106   7e-23   
ref|XP_006484179.1|  PREDICTED: probable methyltransferase PMT5-l...    106   7e-23   Citrus sinensis [apfelsine]
gb|KHN03641.1|  Putative methyltransferase PMT4                         106   7e-23   Glycine soja [wild soybean]
ref|XP_006573141.1|  PREDICTED: probable methyltransferase PMT5-l...    106   7e-23   Glycine max [soybeans]
gb|KHN29999.1|  Putative methyltransferase PMT4                         106   7e-23   Glycine soja [wild soybean]
ref|XP_006574934.1|  PREDICTED: probable methyltransferase PMT4-l...    106   8e-23   Glycine max [soybeans]
gb|AAD17428.2|  expressed protein                                       103   9e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009802931.1|  PREDICTED: probable methyltransferase PMT5         105   1e-22   Nicotiana sylvestris
ref|XP_008446426.1|  PREDICTED: probable methyltransferase PMT5         105   1e-22   Cucumis melo [Oriental melon]
emb|CDP00420.1|  unnamed protein product                                105   2e-22   Coffea canephora [robusta coffee]
ref|XP_009777411.1|  PREDICTED: probable methyltransferase PMT5 i...    105   2e-22   Nicotiana sylvestris
ref|XP_009777410.1|  PREDICTED: probable methyltransferase PMT5 i...    105   2e-22   Nicotiana sylvestris
ref|XP_011075591.1|  PREDICTED: probable methyltransferase PMT5         105   2e-22   Sesamum indicum [beniseed]
emb|CBI27262.3|  unnamed protein product                              98.6    2e-22   Vitis vinifera
ref|XP_002892777.1|  hypothetical protein ARALYDRAFT_471543             104   2e-22   
emb|CAN64162.1|  hypothetical protein VITISV_040645                   99.0    2e-22   Vitis vinifera
ref|XP_009152172.1|  PREDICTED: probable methyltransferase PMT5         104   3e-22   Brassica rapa
ref|XP_009129088.1|  PREDICTED: probable methyltransferase PMT5         104   3e-22   Brassica rapa
ref|XP_010680718.1|  PREDICTED: probable methyltransferase PMT5         104   3e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010554289.1|  PREDICTED: probable methyltransferase PMT5         104   3e-22   Tarenaya hassleriana [spider flower]
gb|EMS61645.1|  putative pectin methyltransferase QUA2                  105   3e-22   Triticum urartu
gb|AAK63953.1|  At2g03480/T4M8.9                                        102   4e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAN46794.1|  At2g03480/T4M8.9                                        102   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114154.1|  PREDICTED: probable methyltransferase PMT5         104   4e-22   Brassica rapa
ref|NP_027543.2|  QUASIMODO2 like 2                                     103   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973410.1|  QUASIMODO2 like 2                                     103   4e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDY04154.1|  BnaA09g19320D                                          104   5e-22   
ref|XP_010527954.1|  PREDICTED: probable methyltransferase PMT5         103   6e-22   
ref|XP_006395700.1|  hypothetical protein EUTSA_v10003873mg             103   9e-22   
ref|XP_010476413.1|  PREDICTED: probable methyltransferase PMT4         102   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006307032.1|  hypothetical protein CARUB_v10008622mg             102   1e-21   Capsella rubella
ref|XP_010495624.1|  PREDICTED: probable methyltransferase PMT4         102   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010458849.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    102   1e-21   
ref|XP_010942462.1|  PREDICTED: probable methyltransferase PMT4 i...    100   1e-21   
ref|XP_007153532.1|  hypothetical protein PHAVU_003G043400g             102   1e-21   Phaseolus vulgaris [French bean]
ref|XP_010942457.1|  PREDICTED: probable methyltransferase PMT4 i...    100   1e-21   
ref|XP_009798763.1|  PREDICTED: probable methyltransferase PMT5         102   2e-21   Nicotiana sylvestris
ref|XP_002875206.1|  predicted protein                                  102   2e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_006292704.1|  hypothetical protein CARUB_v10018950mg             102   2e-21   
ref|NP_849656.2|  QUASIMODO2 LIKE 1                                     100   2e-21   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56871.1|  AT1G13860                                              102   3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425139.1|  PREDICTED: probable methyltransferase PMT5 i...    101   3e-21   
gb|EYU28853.1|  hypothetical protein MIMGU_mgv1a003065mg                101   3e-21   Erythranthe guttata [common monkey flower]
ref|XP_010425141.1|  PREDICTED: probable methyltransferase PMT5 i...    101   3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010514117.1|  PREDICTED: probable methyltransferase PMT5         101   3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010906131.1|  PREDICTED: probable methyltransferase PMT5         101   3e-21   Elaeis guineensis
ref|XP_008807815.1|  PREDICTED: probable methyltransferase PMT5         101   5e-21   
dbj|BAC42014.1|  unknown protein                                        100   7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172839.1|  QUASIMODO2 LIKE 1                                     100   7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009590890.1|  PREDICTED: probable methyltransferase PMT5         100   8e-21   Nicotiana tomentosiformis
ref|XP_010502360.1|  PREDICTED: probable methyltransferase PMT5         100   1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006837150.1|  hypothetical protein AMTR_s00110p00151520        99.4    2e-20   
ref|XP_008797047.1|  PREDICTED: probable methyltransferase PMT5 i...  97.8    6e-20   Phoenix dactylifera
ref|XP_010649494.1|  PREDICTED: probable methyltransferase PMT5       97.8    6e-20   Vitis vinifera
ref|XP_008797046.1|  PREDICTED: probable methyltransferase PMT5 i...  97.8    7e-20   Phoenix dactylifera
ref|XP_006344244.1|  PREDICTED: probable methyltransferase PMT5-l...  95.5    4e-19   Solanum tuberosum [potatoes]
ref|XP_004237055.1|  PREDICTED: probable methyltransferase PMT5       95.1    5e-19   
ref|XP_004155297.1|  PREDICTED: probable methyltransferase PMT4-like  95.1    5e-19   
ref|XP_010258081.1|  PREDICTED: probable methyltransferase PMT5       91.7    9e-18   
emb|CDY02989.1|  BnaC07g22380D                                        90.9    2e-17   
emb|CDY53946.1|  BnaA02g36960D                                        87.8    2e-16   Brassica napus [oilseed rape]
ref|XP_008221505.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  85.9    2e-16   
gb|AAF79416.1|AC068197_26  F16A14.7                                   86.3    6e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY37197.1|  BnaC02g35050D                                        85.9    8e-16   Brassica napus [oilseed rape]
emb|CDY51215.1|  BnaA06g39940D                                        85.5    1e-15   Brassica napus [oilseed rape]
ref|XP_010109369.1|  putative methyltransferase PMT5                  82.4    1e-14   
gb|KHN02028.1|  Putative pectin methyltransferase QUA2                74.3    4e-14   Glycine soja [wild soybean]
ref|XP_010677437.1|  PREDICTED: probable methyltransferase PMT21      80.5    4e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001767424.1|  predicted protein                                78.6    2e-13   
gb|ABS83492.1|  early response to drought 3                           75.5    2e-13   Pinus pinaster [cluster pine]
gb|AEW70168.1|  early responsive to dehydration 3                     75.5    2e-13   Pinus sylvestris var. mongolica
gb|AHY28780.1|  early response to drought 3                           74.3    2e-13   Pinus taeda
gb|AIF75711.1|  early response to drought 3                           75.5    2e-13   Pinus hwangshanensis
gb|AEW70174.1|  early responsive to dehydration 3                     75.5    2e-13   Pinus densiflora var. ussuriensis
gb|AEW70176.1|  early responsive to dehydration 3                     75.5    2e-13   Pinus densiflora var. densiflora
gb|AEW70171.1|  early responsive to dehydration 3                     75.5    2e-13   Pinus sylvestris var. mongolica
gb|AIF75714.1|  early response to drought 3                           75.5    2e-13   Pinus hwangshanensis
gb|AIF75712.1|  early response to drought 3                           75.5    2e-13   Pinus hwangshanensis
gb|AEW70169.1|  early responsive to dehydration 3                     75.1    2e-13   Pinus sylvestris var. mongolica
ref|XP_003580350.1|  PREDICTED: probable methyltransferase PMT13      78.6    2e-13   Brachypodium distachyon [annual false brome]
ref|XP_008802976.1|  PREDICTED: probable methyltransferase PMT21 ...  78.2    3e-13   Phoenix dactylifera
gb|AEW70177.1|  early responsive to dehydration 3                     74.7    3e-13   Pinus densiflora var. densiflora
gb|ACO57101.1|  early responsive to dehydration 3                     75.1    3e-13   Pinus halepensis [Aleppo pine]
ref|XP_008802979.1|  PREDICTED: probable methyltransferase PMT21 ...  78.2    3e-13   Phoenix dactylifera
ref|XP_010063906.1|  PREDICTED: probable methyltransferase PMT25 ...  78.2    4e-13   Eucalyptus grandis [rose gum]
ref|XP_002993743.1|  hypothetical protein SELMODRAFT_137575           77.8    4e-13   
gb|AHY28778.1|  early response to drought 3                           74.3    4e-13   Pinus elliottii [American pitch pine]
gb|AHY28777.1|  early response to drought 3                           74.3    4e-13   Pinus echinata [shortleaf pine]
gb|ACB59070.1|  early response to drought 3                           74.3    5e-13   Pinus elliottii [American pitch pine]
gb|AAW72877.1|  early response to drought 3                           74.3    5e-13   Pinus taeda
gb|AAW72852.1|  early response to drought 3                           73.9    7e-13   Pinus taeda
emb|CDX98606.1|  BnaA03g43910D                                        77.0    7e-13   
gb|AAW72868.1|  early response to drought 3                           73.9    7e-13   Pinus taeda
gb|KHG22120.1|  hypothetical protein F383_28461                       77.4    7e-13   Gossypium arboreum [tree cotton]
emb|CDY01583.1|  BnaC07g35730D                                        77.0    7e-13   
ref|XP_008802371.1|  PREDICTED: probable methyltransferase PMT19      77.0    7e-13   Phoenix dactylifera
ref|XP_011022921.1|  PREDICTED: probable methyltransferase PMT26      77.4    8e-13   Populus euphratica
dbj|BAJ96685.1|  predicted protein                                    76.6    8e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002867953.1|  early-responsive to dehydration 3                76.6    9e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_002987768.1|  hypothetical protein SELMODRAFT_426562           76.6    9e-13   Selaginella moellendorffii
gb|AIU48591.1|  quasimodo 3                                           76.3    1e-12   Brachypodium distachyon [annual false brome]
ref|XP_002306259.2|  dehydration-responsive family protein            76.6    1e-12   
dbj|BAJ98075.1|  predicted protein                                    76.3    1e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002285889.2|  PREDICTED: probable methyltransferase PMT24      76.6    1e-12   Vitis vinifera
gb|ACF86888.1|  unknown                                               73.2    1e-12   Zea mays [maize]
ref|XP_008802980.1|  PREDICTED: probable methyltransferase PMT21 ...  75.5    2e-12   
emb|CDX74348.1|  BnaA03g26990D                                        75.1    3e-12   
ref|XP_009134532.1|  PREDICTED: probable methyltransferase PMT13      75.1    3e-12   Brassica rapa
ref|XP_006282955.1|  hypothetical protein CARUB_v10007621mg           75.1    3e-12   Capsella rubella
gb|EPS60043.1|  hypothetical protein M569_14761                       73.6    3e-12   Genlisea aurea
ref|XP_006857872.1|  hypothetical protein AMTR_s00069p00098800        75.1    3e-12   Amborella trichopoda
ref|XP_010530224.1|  PREDICTED: probable methyltransferase PMT24      70.9    3e-12   Tarenaya hassleriana [spider flower]
ref|XP_009401770.1|  PREDICTED: probable methyltransferase PMT13      75.1    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002300957.2|  hypothetical protein POPTR_0002s07640g           75.1    3e-12   Populus trichocarpa [western balsam poplar]
emb|CDY07198.1|  BnaCnng02130D                                        74.7    3e-12   
ref|XP_011031161.1|  PREDICTED: probable methyltransferase PMT26 ...  75.1    4e-12   Populus euphratica
ref|XP_011031160.1|  PREDICTED: probable methyltransferase PMT26 ...  75.1    4e-12   Populus euphratica
ref|XP_011031158.1|  PREDICTED: probable methyltransferase PMT26 ...  75.1    4e-12   Populus euphratica
ref|XP_011031157.1|  PREDICTED: probable methyltransferase PMT26 ...  75.1    4e-12   Populus euphratica
ref|XP_011031156.1|  PREDICTED: probable methyltransferase PMT26 ...  75.1    4e-12   Populus euphratica
ref|XP_009136994.1|  PREDICTED: probable methyltransferase PMT21      74.7    4e-12   Brassica rapa
gb|KJB22349.1|  hypothetical protein B456_004G042500                  74.7    4e-12   Gossypium raimondii
ref|XP_002309924.1|  dehydration-responsive family protein            75.1    4e-12   
ref|XP_002511800.1|  conserved hypothetical protein                   74.3    4e-12   
ref|XP_010538339.1|  PREDICTED: probable methyltransferase PMT20      74.7    4e-12   Tarenaya hassleriana [spider flower]
emb|CDY09274.1|  BnaC03g63040D                                        74.7    4e-12   Brassica napus [oilseed rape]
ref|XP_011027424.1|  PREDICTED: probable methyltransferase PMT24      74.7    4e-12   Populus euphratica
gb|KHF97731.1|  putative methyltransferase PMT21 -like protein        74.7    4e-12   Gossypium arboreum [tree cotton]
ref|XP_002460211.1|  hypothetical protein SORBIDRAFT_02g024670        74.7    5e-12   Sorghum bicolor [broomcorn]
ref|XP_009384739.1|  PREDICTED: probable methyltransferase PMT21      74.3    5e-12   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY70936.1|  BnaAnng35600D                                        71.2    5e-12   Brassica napus [oilseed rape]
gb|KJB59346.1|  hypothetical protein B456_009G250600                  74.7    5e-12   
ref|XP_010912141.1|  PREDICTED: probable methyltransferase PMT19      74.3    5e-12   
ref|XP_007137790.1|  hypothetical protein PHAVU_009G155600g           74.7    5e-12   
ref|XP_003602637.1|  Ankyrin-like protein                             74.7    5e-12   
ref|XP_003573760.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  74.3    5e-12   
dbj|BAF01846.1|  hypothetical protein                                 68.2    6e-12   
gb|ACN26954.1|  unknown                                               72.8    6e-12   
ref|NP_001063174.1|  Os09g0415700                                     74.3    6e-12   
gb|EAZ09099.1|  hypothetical protein OsI_31366                        74.3    6e-12   
ref|XP_009111460.1|  PREDICTED: probable methyltransferase PMT13      74.3    6e-12   
ref|XP_002520274.1|  ATP binding protein, putative                    74.3    6e-12   
emb|CDY51142.1|  BnaA09g51770D                                        73.9    6e-12   
ref|XP_009108413.1|  PREDICTED: probable methyltransferase PMT21      73.9    7e-12   
ref|XP_010277710.1|  PREDICTED: probable methyltransferase PMT24      74.3    7e-12   
ref|XP_010439756.1|  PREDICTED: probable methyltransferase PMT21      73.9    7e-12   
ref|XP_009397061.1|  PREDICTED: probable methyltransferase PMT20 ...  73.9    7e-12   
ref|XP_009397063.1|  PREDICTED: probable methyltransferase PMT20 ...  73.6    8e-12   
ref|XP_010434448.1|  PREDICTED: probable methyltransferase PMT21      73.9    8e-12   
gb|AIU48601.1|  quasimodo 3                                           73.6    8e-12   
gb|AFN44819.1|  early responsive to dehydration 3                     69.7    8e-12   
ref|XP_006660624.1|  PREDICTED: probable methyltransferase PMT2-like  73.9    8e-12   
ref|NP_567575.1|  putative methyltransferase PMT21                    73.6    8e-12   
gb|AFN44820.1|  early responsive to dehydration 3                     69.7    8e-12   
gb|AFN44838.1|  early responsive to dehydration 3                     69.7    9e-12   
ref|XP_010063908.1|  PREDICTED: probable methyltransferase PMT25      73.9    9e-12   
ref|XP_010056181.1|  PREDICTED: probable methyltransferase PMT20      73.6    9e-12   
emb|CDX91893.1|  BnaC03g31950D                                        73.6    9e-12   
ref|XP_010674444.1|  PREDICTED: probable methyltransferase PMT26      73.9    9e-12   
ref|XP_010110847.1|  putative methyltransferase PMT18                 70.9    9e-12   
ref|XP_007046111.1|  S-adenosyl-L-methionine-dependent methyltran...  73.6    9e-12   
ref|XP_010029086.1|  PREDICTED: probable methyltransferase PMT9       73.6    1e-11   
emb|CDX76494.1|  BnaA08g09060D                                        73.6    1e-11   
gb|EYU23728.1|  hypothetical protein MIMGU_mgv1a001484mg              73.6    1e-11   
gb|AIF75710.1|  early response to drought 3                           70.5    1e-11   
ref|XP_010278811.1|  PREDICTED: probable methyltransferase PMT21      73.2    1e-11   
ref|XP_002307464.2|  hypothetical protein POPTR_0005s20670g           73.6    1e-11   
ref|XP_006414006.1|  hypothetical protein EUTSA_v10024718mg           73.2    1e-11   
gb|AIU48633.1|  quasimodo 3                                           73.2    1e-11   
gb|AEX55231.1|  putative cold-regulated protein                       72.0    1e-11   
ref|XP_011015217.1|  PREDICTED: probable methyltransferase PMT2       73.2    1e-11   
ref|XP_011021619.1|  PREDICTED: probable methyltransferase PMT2       73.2    1e-11   
gb|KDP32896.1|  hypothetical protein JCGZ_12188                       73.6    1e-11   
ref|XP_004502956.1|  PREDICTED: probable methyltransferase PMT26-...  73.6    1e-11   
ref|XP_011006303.1|  PREDICTED: probable methyltransferase PMT24 ...  73.6    1e-11   
ref|XP_008783335.1|  PREDICTED: probable methyltransferase PMT26      73.6    1e-11   
gb|AFN44830.1|  early responsive to dehydration 3                     68.9    1e-11   
gb|KJB29130.1|  hypothetical protein B456_005G086100                  73.6    1e-11   
ref|XP_009371893.1|  PREDICTED: probable methyltransferase PMT14 ...  73.2    1e-11   
ref|XP_011006302.1|  PREDICTED: probable methyltransferase PMT24 ...  73.6    1e-11   
ref|XP_006580338.1|  PREDICTED: probable methyltransferase PMT26-...  73.6    1e-11   
ref|XP_002320756.1|  dehydration-responsive family protein            73.2    1e-11   
ref|NP_001170352.1|  uncharacterized protein LOC100384329             69.7    1e-11   
gb|KHN34092.1|  Putative methyltransferase PMT26                      73.6    1e-11   
ref|XP_006663417.1|  PREDICTED: probable methyltransferase PMT2-like  70.9    1e-11   
ref|XP_008230498.1|  PREDICTED: probable methyltransferase PMT9       73.2    1e-11   
emb|CBI18946.3|  unnamed protein product                              72.8    1e-11   
gb|AAX94055.2|  dehydration-induced protein                           73.2    1e-11   
ref|XP_009383568.1|  PREDICTED: probable methyltransferase PMT26      73.2    1e-11   
ref|XP_010112029.1|  putative methyltransferase PMT24                 73.2    2e-11   
ref|XP_010908928.1|  PREDICTED: probable methyltransferase PMT26      73.2    2e-11   
ref|XP_010535872.1|  PREDICTED: probable methyltransferase PMT21      72.8    2e-11   
ref|XP_010449394.1|  PREDICTED: probable methyltransferase PMT21      72.8    2e-11   
ref|XP_008674698.1|  PREDICTED: probable methyltransferase PMT19      72.8    2e-11   
ref|XP_007051915.1|  S-adenosyl-L-methionine-dependent methyltran...  72.8    2e-11   
ref|XP_001754440.1|  predicted protein                                72.8    2e-11   
gb|KJB29128.1|  hypothetical protein B456_005G086100                  73.2    2e-11   
ref|XP_003527960.1|  PREDICTED: probable methyltransferase PMT26-...  73.2    2e-11   
ref|XP_010530222.1|  PREDICTED: probable methyltransferase PMT25      70.9    2e-11   
emb|CDP05238.1|  unnamed protein product                              72.8    2e-11   
ref|XP_004970814.1|  PREDICTED: probable methyltransferase PMT26-...  72.8    2e-11   
ref|XP_010930722.1|  PREDICTED: probable methyltransferase PMT26      73.2    2e-11   
ref|XP_009801988.1|  PREDICTED: probable methyltransferase PMT15 ...  72.8    2e-11   
dbj|BAJ86710.1|  predicted protein                                    71.6    2e-11   
ref|NP_001152470.1|  ankyrin protein kinase-like                      72.8    2e-11   
emb|CDX70102.1|  BnaA10g24510D                                        72.8    2e-11   
gb|KDO50369.1|  hypothetical protein CISIN_1g020011mg                 71.2    2e-11   
ref|XP_011035117.1|  PREDICTED: probable methyltransferase PMT13      72.4    2e-11   
ref|XP_008651354.1|  PREDICTED: uncharacterized protein LOC100279...  72.8    2e-11   
gb|AIU48621.1|  quasimodo 3                                           72.4    2e-11   
ref|XP_009122211.1|  PREDICTED: probable methyltransferase PMT12      72.8    2e-11   
ref|XP_010932067.1|  PREDICTED: probable methyltransferase PMT9 i...  72.4    2e-11   
ref|XP_010932066.1|  PREDICTED: probable methyltransferase PMT9 i...  72.4    2e-11   
emb|CBI37452.3|  unnamed protein product                              72.4    2e-11   
ref|XP_010911089.1|  PREDICTED: probable methyltransferase PMT26      72.8    2e-11   
ref|XP_002265127.1|  PREDICTED: probable methyltransferase PMT20      72.4    2e-11   
ref|XP_010932069.1|  PREDICTED: probable methyltransferase PMT9 i...  72.4    2e-11   
ref|XP_010932068.1|  PREDICTED: probable methyltransferase PMT9 i...  72.4    2e-11   
ref|XP_007019267.1|  S-adenosyl-L-methionine-dependent methyltran...  72.8    2e-11   
ref|XP_010090820.1|  putative methyltransferase PMT26                 72.8    2e-11   
ref|XP_009402695.1|  PREDICTED: probable methyltransferase PMT19      72.4    2e-11   
ref|XP_010054055.1|  PREDICTED: probable methyltransferase PMT21      72.4    3e-11   
dbj|BAH57120.1|  AT1G31850                                            71.6    3e-11   
ref|XP_006281931.1|  hypothetical protein CARUB_v10028139mg           72.4    3e-11   
ref|XP_007143370.1|  hypothetical protein PHAVU_007G066900g           72.4    3e-11   
ref|XP_003570093.1|  PREDICTED: probable methyltransferase PMT15      72.4    3e-11   
ref|XP_004976536.1|  PREDICTED: probable methyltransferase PMT15-...  72.0    3e-11   
ref|XP_006364469.1|  PREDICTED: probable methyltransferase PMT21-...  72.0    3e-11   
ref|XP_004976531.1|  PREDICTED: probable methyltransferase PMT13-...  72.0    3e-11   
ref|XP_010478606.1|  PREDICTED: probable methyltransferase PMT20      72.0    3e-11   
gb|AAL86466.1|AC077693_5  hypothetical protein                        72.4    3e-11   
gb|KJB41229.1|  hypothetical protein B456_007G095900                  72.0    3e-11   
ref|XP_010461320.1|  PREDICTED: probable methyltransferase PMT26      72.4    3e-11   
ref|XP_010484172.1|  PREDICTED: probable methyltransferase PMT26      72.4    3e-11   
ref|XP_002315803.2|  hypothetical protein POPTR_0010s10420g           72.0    3e-11   
ref|XP_002977565.1|  hypothetical protein SELMODRAFT_443549           72.0    3e-11   
ref|XP_008802977.1|  PREDICTED: probable methyltransferase PMT21 ...  72.0    3e-11   
ref|XP_008781596.1|  PREDICTED: probable methyltransferase PMT26      72.4    3e-11   
ref|XP_006584650.1|  PREDICTED: probable methyltransferase PMT26-...  72.4    3e-11   
ref|XP_004244424.1|  PREDICTED: probable methyltransferase PMT20      72.0    3e-11   
ref|XP_010509773.1|  PREDICTED: probable methyltransferase PMT25      72.0    3e-11   
ref|XP_006307042.1|  hypothetical protein CARUB_v10008629mg           72.0    3e-11   
gb|KHN44285.1|  Putative methyltransferase PMT25                      72.0    3e-11   
ref|XP_011078779.1|  PREDICTED: probable methyltransferase PMT26      72.0    3e-11   
ref|XP_002974980.1|  hypothetical protein SELMODRAFT_174651           72.0    3e-11   
ref|XP_002890952.1|  hypothetical protein ARALYDRAFT_473372           72.0    3e-11   
gb|ABK25383.1|  unknown                                               72.0    3e-11   
ref|XP_002975160.1|  hypothetical protein SELMODRAFT_232460           72.0    3e-11   
ref|NP_174468.1|  putative methyltransferase PMT20                    72.0    4e-11   
ref|NP_001065447.2|  Os10g0569300                                     72.0    4e-11   
gb|AIU48603.1|  quasimodo 3                                           71.6    4e-11   
gb|EAZ17038.1|  hypothetical protein OsJ_32528                        71.6    4e-11   
gb|KHN16949.1|  Putative methyltransferase PMT26                      72.0    4e-11   
gb|EYU37520.1|  hypothetical protein MIMGU_mgv1a003222mg              71.6    4e-11   
gb|EAY79581.1|  hypothetical protein OsI_34717                        71.6    4e-11   
gb|EYU37521.1|  hypothetical protein MIMGU_mgv1a003222mg              71.6    4e-11   
ref|XP_002458923.1|  hypothetical protein SORBIDRAFT_03g042770        70.9    4e-11   
gb|AAN60317.1|  unknown                                               71.6    4e-11   
ref|XP_004144403.1|  PREDICTED: probable methyltransferase PMT21-...  71.6    4e-11   
ref|XP_009113612.1|  PREDICTED: probable methyltransferase PMT17      71.6    4e-11   
ref|XP_009619970.1|  PREDICTED: probable methyltransferase PMT20      71.6    4e-11   
ref|XP_008460424.1|  PREDICTED: probable methyltransferase PMT21      71.6    4e-11   
gb|AIU48616.1|  quasimodo 3                                           71.2    4e-11   
gb|AIU48602.1|  quasimodo 3                                           71.2    4e-11   
ref|XP_010527657.1|  PREDICTED: probable methyltransferase PMT24      71.6    4e-11   
ref|XP_002458871.1|  hypothetical protein SORBIDRAFT_03g041910        71.6    4e-11   
ref|XP_006432561.1|  hypothetical protein CICLE_v10000643mg           71.2    4e-11   
emb|CDP16620.1|  unnamed protein product                              71.6    4e-11   
gb|KHN46967.1|  Putative methyltransferase PMT25                      71.6    5e-11   
gb|EYU19524.1|  hypothetical protein MIMGU_mgv1a002864mg              71.6    5e-11   
ref|XP_006295874.1|  hypothetical protein CARUB_v10025004mg           71.6    5e-11   
gb|KHN09623.1|  Putative methyltransferase PMT26                      71.6    5e-11   
ref|XP_003526869.1|  PREDICTED: probable methyltransferase PMT26-...  71.6    5e-11   
gb|AIU48607.1|  quasimodo 3                                           71.2    5e-11   
ref|XP_009770932.1|  PREDICTED: probable methyltransferase PMT15      71.6    5e-11   
ref|XP_006652660.1|  PREDICTED: probable methyltransferase PMT13-...  70.9    5e-11   
emb|CDP08881.1|  unnamed protein product                              71.6    5e-11   
ref|XP_010413759.1|  PREDICTED: probable methyltransferase PMT25      71.6    5e-11   
ref|XP_004133879.1|  PREDICTED: probable methyltransferase PMT13-...  71.2    5e-11   
ref|XP_008799028.1|  PREDICTED: probable methyltransferase PMT9 i...  71.2    5e-11   
emb|CDX98897.1|  BnaC09g49380D                                        71.2    5e-11   
ref|XP_008799029.1|  PREDICTED: probable methyltransferase PMT9 i...  71.2    5e-11   
gb|KJB51529.1|  hypothetical protein B456_008G220500                  71.2    5e-11   
ref|XP_010918079.1|  PREDICTED: probable methyltransferase PMT21      71.2    6e-11   
ref|XP_010940855.1|  PREDICTED: probable methyltransferase PMT21      71.6    6e-11   
ref|XP_007214946.1|  hypothetical protein PRUPE_ppa002968mg           71.2    6e-11   
ref|XP_010089182.1|  putative methyltransferase PMT9                  71.2    6e-11   
ref|XP_010275323.1|  PREDICTED: probable methyltransferase PMT14      71.2    6e-11   
ref|XP_006645134.1|  PREDICTED: probable methyltransferase PMT26-...  71.2    6e-11   
gb|AIU48590.1|  quasimodo 3                                           70.9    6e-11   
gb|ADV32343.1|  early responsive to dehydration 3                     67.0    6e-11   
gb|KDO49025.1|  hypothetical protein CISIN_1g007165mg                 70.9    6e-11   
gb|EMS53293.1|  putative methyltransferase PMT26                      71.6    6e-11   
emb|CDM85080.1|  unnamed protein product                              71.2    6e-11   
ref|XP_002864883.1|  hypothetical protein ARALYDRAFT_496597           71.2    6e-11   
gb|KHG21530.1|  hypothetical protein F383_05601                       71.2    6e-11   
ref|XP_006446646.1|  hypothetical protein CICLE_v10014628mg           70.5    6e-11   
ref|XP_006857883.1|  hypothetical protein AMTR_s00069p00110310        71.2    6e-11   
dbj|BAJ85549.1|  predicted protein                                    71.2    6e-11   
gb|EAY76734.1|  hypothetical protein OsI_04689                        71.2    6e-11   
ref|XP_009380165.1|  PREDICTED: probable methyltransferase PMT2       70.9    6e-11   
ref|XP_006415288.1|  hypothetical protein EUTSA_v10007126mg           70.9    7e-11   
ref|NP_001045015.1|  Os01g0883900                                     71.2    7e-11   
gb|EMT17461.1|  hypothetical protein F775_31288                       71.2    7e-11   
ref|XP_003580900.1|  PREDICTED: probable methyltransferase PMT26      71.2    7e-11   
gb|ABR16934.1|  unknown                                               70.9    7e-11   
ref|XP_009343540.1|  PREDICTED: probable methyltransferase PMT13      70.9    7e-11   
gb|EMS63450.1|  putative methyltransferase PMT21                      70.9    7e-11   
dbj|BAD82580.1|  ankyrin-like protein                                 71.2    7e-11   
ref|XP_003523221.1|  PREDICTED: probable methyltransferase PMT26-...  71.2    7e-11   
ref|XP_006340522.1|  PREDICTED: probable methyltransferase PMT15-...  70.9    7e-11   
ref|XP_004245921.1|  PREDICTED: probable methyltransferase PMT21      70.9    7e-11   
ref|XP_008385702.1|  PREDICTED: probable methyltransferase PMT13      70.9    7e-11   
ref|XP_006432559.1|  hypothetical protein CICLE_v10000643mg           70.9    7e-11   
ref|XP_009801989.1|  PREDICTED: probable methyltransferase PMT15 ...  70.9    8e-11   
ref|XP_006846361.1|  hypothetical protein AMTR_s00012p00261500        70.9    8e-11   
ref|XP_003623835.1|  hypothetical protein MTR_7g076170                70.9    8e-11   
gb|AIU48618.1|  quasimodo 3                                           70.5    8e-11   
ref|XP_011030063.1|  PREDICTED: probable methyltransferase PMT15      70.9    8e-11   
ref|XP_009393699.1|  PREDICTED: probable methyltransferase PMT2 i...  70.9    8e-11   
gb|EMS59100.1|  putative methyltransferase PMT17                      70.5    8e-11   
ref|XP_004978303.1|  PREDICTED: probable methyltransferase PMT26-...  71.2    8e-11   
ref|XP_009794519.1|  PREDICTED: probable methyltransferase PMT20      70.5    8e-11   
gb|KJB18847.1|  hypothetical protein B456_003G072700                  70.1    9e-11   
ref|XP_002977398.1|  hypothetical protein SELMODRAFT_151943           70.5    9e-11   
ref|XP_002448358.1|  hypothetical protein SORBIDRAFT_06g025780        70.5    9e-11   
gb|AIU48592.1|  quasimodo 3                                           70.5    9e-11   
dbj|BAK00591.1|  predicted protein                                    70.5    9e-11   
ref|XP_002300064.2|  hypothetical protein POPTR_0001s35650g           70.5    9e-11   
ref|XP_010461008.1|  PREDICTED: probable methyltransferase PMT20      70.5    9e-11   
gb|AFN44832.1|  early responsive to dehydration 3                     66.6    9e-11   
ref|XP_011465047.1|  PREDICTED: probable methyltransferase PMT20      70.5    9e-11   
ref|XP_010321993.1|  PREDICTED: probable methyltransferase PMT15 ...  70.5    9e-11   
ref|XP_009365745.1|  PREDICTED: probable methyltransferase PMT21      70.5    1e-10   
ref|XP_009587333.1|  PREDICTED: probable methyltransferase PMT14      70.5    1e-10   
ref|XP_006446647.1|  hypothetical protein CICLE_v10014628mg           70.5    1e-10   
gb|KJB08228.1|  hypothetical protein B456_001G071800                  70.5    1e-10   
ref|XP_010683197.1|  PREDICTED: probable methyltransferase PMT2       70.5    1e-10   
gb|KDO49019.1|  hypothetical protein CISIN_1g007165mg                 70.5    1e-10   
emb|CDX99539.1|  BnaC09g24530D                                        70.5    1e-10   
ref|XP_004982637.1|  PREDICTED: probable methyltransferase PMT18-...  70.5    1e-10   
gb|KDO49024.1|  hypothetical protein CISIN_1g007165mg                 70.5    1e-10   
gb|KJB48927.1|  hypothetical protein B456_008G094300                  70.5    1e-10   
ref|XP_006491616.1|  PREDICTED: probable methyltransferase PMT7-like  70.1    1e-10   
ref|XP_007159858.1|  hypothetical protein PHAVU_002G273700g           70.5    1e-10   
ref|XP_006578949.1|  PREDICTED: probable methyltransferase PMT26-...  70.5    1e-10   
ref|XP_008238097.1|  PREDICTED: probable methyltransferase PMT21      70.5    1e-10   
ref|XP_004982638.1|  PREDICTED: probable methyltransferase PMT18-...  70.5    1e-10   
gb|ACN28572.1|  unknown                                               70.5    1e-10   
ref|XP_010278571.1|  PREDICTED: probable methyltransferase PMT13      70.5    1e-10   
ref|XP_008669009.1|  PREDICTED: probable methyltransferase PMT13      70.1    1e-10   
ref|XP_008799998.1|  PREDICTED: probable methyltransferase PMT20 ...  70.5    1e-10   



>ref|XP_006367734.1| PREDICTED: probable pectin methyltransferase QUA2-like [Solanum 
tuberosum]
Length=697

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 82/93 (88%), Gaps = 3/93 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLL++EF Q  HSRC M +LF+E+DR+LRPEGWVI+RDT+PLIELAR H
Sbjct  607  YPRTYDLVHANGLLSMEFGQ--HSRCPMFDLFIEMDRVLRPEGWVILRDTVPLIELARSH  664

Query  436  AVQLKWDARVIE-SSSEEKLLVCQKPFVRKVAT  341
            A +LKWDARVIE  SS+EKLL+CQKPF R+ A+
Sbjct  665  AARLKWDARVIEVESSDEKLLICQKPFSRRQAS  697



>ref|XP_009760349.1| PREDICTED: probable pectin methyltransferase QUA2 [Nicotiana 
sylvestris]
Length=697

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 3/93 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLL+LEF Q  HSRC M +LF+EIDR+LRPEGWVIIRD++PLIELAR H
Sbjct  607  YPRTYDLVHANGLLSLEFGQ--HSRCLMFDLFIEIDRVLRPEGWVIIRDSVPLIELARVH  664

Query  436  AVQLKWDARVIE-SSSEEKLLVCQKPFVRKVAT  341
            A +LKWDARV+E  SS+EKLL+CQKPF R+ A+
Sbjct  665  AARLKWDARVVEVESSDEKLLICQKPFSRRQAS  697



>ref|XP_010320179.1| PREDICTED: probable pectin methyltransferase QUA2 [Solanum lycopersicum]
Length=697

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 81/93 (87%), Gaps = 3/93 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLL++EF Q  H RC M +LF+E+DR+LRPEGWVI+RDT+PLIELAR H
Sbjct  607  YPRTYDLVHANGLLSMEFGQ--HIRCPMFDLFIEMDRVLRPEGWVILRDTVPLIELARSH  664

Query  436  AVQLKWDARVIE-SSSEEKLLVCQKPFVRKVAT  341
            A +LKWDARVIE  SS+EKLL+CQKPF R+ A+
Sbjct  665  AARLKWDARVIEVESSDEKLLICQKPFSRRQAS  697



>ref|XP_009629595.1| PREDICTED: probable pectin methyltransferase QUA2 [Nicotiana 
tomentosiformis]
Length=697

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 3/93 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLL++EF Q  HSRC M +LF+EIDR+LRPEGWVIIRDT+PLIELAR H
Sbjct  607  YPRTYDLVHANGLLSVEFGQ--HSRCLMFDLFIEIDRVLRPEGWVIIRDTVPLIELARVH  664

Query  436  AVQLKWDARVIE-SSSEEKLLVCQKPFVRKVAT  341
            A +LKWDARV+E  SS+E LL+CQKPF R+ A+
Sbjct  665  ASRLKWDARVVEVESSDENLLICQKPFSRRQAS  697



>gb|ACJ85808.1| unknown [Medicago truncatula]
Length=153

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 4/93 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA G+L+LEFSQ    RC M +LF+EIDR+LRPEGW+IIRDTIPLIE AR  
Sbjct  62   YPRTYDLVHAAGILSLEFSQ--PLRCTMLDLFIEIDRLLRPEGWIIIRDTIPLIESARVL  119

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVA  344
            A QLKW+ARV  IES+SEEKLL+CQKPF +K A
Sbjct  120  AAQLKWEARVIEIESNSEEKLLICQKPFFKKHA  152



>ref|XP_003615127.1| hypothetical protein MTR_5g064080 [Medicago truncatula]
 gb|AES98085.1| S-adenosylmethionine-dependent methyltransferase, putative [Medicago 
truncatula]
Length=675

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 4/93 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA G+L+LEFSQ    RC M +LF+EIDR+LRPEGW+IIRDTIPLIE AR  
Sbjct  584  YPRTYDLVHAAGILSLEFSQ--PLRCTMLDLFIEIDRLLRPEGWIIIRDTIPLIESARVL  641

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVA  344
            A QLKW+ARV  IES+SEEKLL+CQKPF +K A
Sbjct  642  AAQLKWEARVIEIESNSEEKLLICQKPFFKKHA  674



>gb|KHG17567.1| putative pectin methyltransferase QUA2 -like protein [Gossypium 
arboreum]
Length=696

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 4/95 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+LE SQ  + RC M +LF EIDR+LRPEGWVII D  PLIE AR  
Sbjct  604  YPRTYDMVHADGLLSLETSQ--YRRCTMLDLFTEIDRLLRPEGWVIIHDKAPLIESARAL  661

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVATS  338
             VQLKWDARV  IES+S+E+LL+CQKPF ++ ATS
Sbjct  662  TVQLKWDARVVEIESNSDERLLICQKPFFKRQATS  696



>ref|XP_007018751.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY15976.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=658

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLL+LE SQN   RC M +LF EIDR+LRPEGWVIIRDT PLIE AR  
Sbjct  567  YPRTYDMVHAEGLLSLETSQNR--RCTMLDLFTEIDRLLRPEGWVIIRDTAPLIESARAL  624

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV+  ES+SEE+LL+CQKPF ++ A+
Sbjct  625  TTRLKWDARVVETESNSEERLLICQKPFFKRQAS  658



>ref|XP_007018750.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY15975.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=695

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLL+LE SQN   RC M +LF EIDR+LRPEGWVIIRDT PLIE AR  
Sbjct  604  YPRTYDMVHAEGLLSLETSQNR--RCTMLDLFTEIDRLLRPEGWVIIRDTAPLIESARAL  661

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV+  ES+SEE+LL+CQKPF ++ A+
Sbjct  662  TTRLKWDARVVETESNSEERLLICQKPFFKRQAS  695



>ref|XP_011074193.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011074194.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011074195.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
Length=697

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 77/94 (82%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLL+LEF++    RC M +LF EIDRILRPEGWVI++DT  LIE AR  
Sbjct  606  YPRTYDLVHAEGLLSLEFAE--QPRCQMLDLFAEIDRILRPEGWVILKDTARLIEFARSL  663

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              QLKWDARV  IES+S+EKLLVCQKPF++K A+
Sbjct  664  TTQLKWDARVVDIESNSDEKLLVCQKPFLKKQAS  697



>gb|KJB59031.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=608

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 76/95 (80%), Gaps = 4/95 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+LE SQ  + RC M +L  EIDR+LRPEGWVII D  PLIE AR  
Sbjct  516  YPRTYDMVHADGLLSLETSQ--YRRCTMLDLLTEIDRLLRPEGWVIIHDKAPLIESARAL  573

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVATS  338
             VQLKWDARV  IES+S+E+LL+CQKPF ++ ATS
Sbjct  574  TVQLKWDARVVEIESNSDERLLICQKPFFKRQATS  608



>gb|KJB59030.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=696

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 76/95 (80%), Gaps = 4/95 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+LE SQ  + RC M +L  EIDR+LRPEGWVII D  PLIE AR  
Sbjct  604  YPRTYDMVHADGLLSLETSQ--YRRCTMLDLLTEIDRLLRPEGWVIIHDKAPLIESARAL  661

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVATS  338
             VQLKWDARV  IES+S+E+LL+CQKPF ++ ATS
Sbjct  662  TVQLKWDARVVEIESNSDERLLICQKPFFKRQATS  696



>ref|XP_003542374.1| PREDICTED: probable pectin methyltransferase QUA2-like isoformX1 
[Glycine max]
 ref|XP_006593562.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
Length=694

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 76/94 (81%), Gaps = 5/94 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA GLL+LE  Q+   RC M +LF+EIDRILRPEGWVIIRDT+PLIE AR  
Sbjct  604  YPRTYDLVHAAGLLSLETEQH---RCSMLDLFIEIDRILRPEGWVIIRDTVPLIESARPL  660

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              QLKWDARV  IES S+++LL+CQKPF ++ A+
Sbjct  661  TAQLKWDARVIEIESDSDQRLLICQKPFFKRQAS  694



>gb|KJB64256.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64257.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64262.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64263.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=669

 Score =   129 bits (323),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 75/93 (81%), Gaps = 4/93 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+LE SQ  H RC M +LF EIDR+LRPEGW++IRD  PL+E AR  
Sbjct  578  YPRTYDMVHADGLLSLETSQ--HRRCTMLDLFTEIDRLLRPEGWILIRDAAPLVESARAL  635

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVA  344
              +LKWDAR+  IES+S+E+LL+CQKPF +K A
Sbjct  636  TTRLKWDARIIEIESNSDERLLICQKPFFKKQA  668



>ref|XP_004953963.1| PREDICTED: probable pectin methyltransferase QUA2-like [Setaria 
italica]
Length=656

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+LE S   H+RC   ++F+E+DRILRPEGWVIIRDT PLIE AR  
Sbjct  567  YPRTYDMVHADGLLSLEKSHK-HNRCSTLDIFLEVDRILRPEGWVIIRDTAPLIEAARSV  625

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              QL+WDAR+  ++ +S+EKLLVCQKPFVRK
Sbjct  626  VTQLRWDARILDLDIASDEKLLVCQKPFVRK  656



>gb|KJB64260.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=697

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 75/93 (81%), Gaps = 4/93 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+LE SQ  H RC M +LF EIDR+LRPEGW++IRD  PL+E AR  
Sbjct  606  YPRTYDMVHADGLLSLETSQ--HRRCTMLDLFTEIDRLLRPEGWILIRDAAPLVESARAL  663

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVA  344
              +LKWDAR+  IES+S+E+LL+CQKPF +K A
Sbjct  664  TTRLKWDARIIEIESNSDERLLICQKPFFKKQA  696



>gb|KHG28112.1| putative pectin methyltransferase QUA2 -like protein [Gossypium 
arboreum]
Length=697

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 75/93 (81%), Gaps = 4/93 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+LE SQ  H RC M +LF EIDR+LRPEGW++IRD  PL+E AR  
Sbjct  606  YPRTYDMVHADGLLSLETSQ--HRRCTMLDLFTEIDRLLRPEGWILIRDAAPLVESARAL  663

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVA  344
              +LKWDAR+  IES+S+E+LL+CQKPF +K A
Sbjct  664  TTRLKWDARIIEIESNSDERLLICQKPFFKKQA  696



>ref|XP_007141184.1| hypothetical protein PHAVU_008G174000g [Phaseolus vulgaris]
 gb|ESW13178.1| hypothetical protein PHAVU_008G174000g [Phaseolus vulgaris]
Length=693

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 5/94 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA G L+LE  Q+   RC M ++F+EIDRILRPEGWVIIRDT+PLIE AR  
Sbjct  603  YPRTYDLVHAAGFLSLETEQH---RCTMLDMFLEIDRILRPEGWVIIRDTVPLIESARAL  659

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRKVAT  341
              QLKWDARVI  ES S+++LL+CQKPF ++ A+
Sbjct  660  TAQLKWDARVIEVESDSDQRLLICQKPFFKRQAS  693



>ref|XP_003522790.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
1 [Glycine max]
Length=690

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA GLL+LEF+Q     C M ++F+EIDR+LRPEGW+IIRDT+PLIE AR  
Sbjct  599  YPRTYDLVHAAGLLSLEFAQ--QRSCTMLDMFIEIDRLLRPEGWIIIRDTVPLIESARAL  656

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV  IES S+++LL+CQKPF ++ A 
Sbjct  657  TTRLKWDARVVEIESDSDQRLLICQKPFFKRQAN  690



>gb|KHN19772.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=690

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA GLL+LEF+Q     C M ++F+EIDR+LRPEGW+IIRDT+PLIE AR  
Sbjct  599  YPRTYDLVHAAGLLSLEFAQ--QRSCTMLDMFIEIDRLLRPEGWIIIRDTVPLIESARAL  656

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV  IES S+++LL+CQKPF ++ A 
Sbjct  657  TTRLKWDARVVEIESDSDQRLLICQKPFFKRQAN  690



>ref|XP_011100984.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011100985.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011100986.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
Length=693

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLL+LEF++    RC + +LF EIDR+LRPEGWVI+RD+ P+IE AR  
Sbjct  602  YPRTYDLVHAEGLLSLEFAE--QPRCQLIDLFAEIDRLLRPEGWVILRDSAPVIEFARPL  659

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              QLKWDAR+  IES+S E+LL+CQKPF ++ A+
Sbjct  660  TTQLKWDARIVEIESNSNERLLICQKPFSKRQAS  693



>gb|KHN13350.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=693

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 5/94 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA GLL+LE  ++   RC + +LF+EIDRILRPEGWVIIRDT+PLIE AR  
Sbjct  603  YPRTYDLVHAAGLLSLETEKH---RCSILDLFIEIDRILRPEGWVIIRDTVPLIESARPL  659

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              QLKWDARV  IES S+++LL+CQKPF ++ A+
Sbjct  660  TAQLKWDARVIEIESDSDQRLLICQKPFFKRQAS  693



>ref|XP_010060014.1| PREDICTED: probable pectin methyltransferase QUA2 [Eucalyptus 
grandis]
 ref|XP_010060015.1| PREDICTED: probable pectin methyltransferase QUA2 [Eucalyptus 
grandis]
 gb|KCW66537.1| hypothetical protein EUGRSUZ_F00334 [Eucalyptus grandis]
Length=695

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA GLL+LE SQN   RC M +LF EIDRILRPEGW I RDT  LIELAR  
Sbjct  604  YPRTYDMVHASGLLSLENSQNR--RCSMLDLFAEIDRILRPEGWAIFRDTTSLIELARAL  661

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
            + + KWDARV  IES+++E+LL+CQKPF++K ++
Sbjct  662  STRFKWDARVIGIESNTDERLLICQKPFLKKPSS  695



>ref|XP_003544795.1| PREDICTED: probable pectin methyltransferase QUA2-like isoformX1 
[Glycine max]
 ref|XP_006596348.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
Length=693

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 5/94 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA GLL+LE  ++   RC + +LF+EIDRILRPEGWVIIRDT+PLIE AR  
Sbjct  603  YPRTYDLVHAAGLLSLETEKH---RCSILDLFIEIDRILRPEGWVIIRDTVPLIESARPL  659

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              QLKWDARV  IES S+++LL+CQKPF ++ A+
Sbjct  660  TAQLKWDARVIEIESDSDQRLLICQKPFFKRQAS  693



>ref|XP_010098612.1| putative pectin methyltransferase QUA2 [Morus notabilis]
 gb|EXB75351.1| putative pectin methyltransferase QUA2 [Morus notabilis]
Length=696

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLL+LE SQ    RC M +LF EIDRILRPEGWVIIRD  PLIE AR  
Sbjct  605  YPRTYDLVHAEGLLSLETSQ--QRRCTMLDLFTEIDRILRPEGWVIIRDRAPLIESARAL  662

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRKVAT  341
               LKWDARVI  ES+S+E+LL+CQKPF ++ A 
Sbjct  663  TTLLKWDARVIEMESNSDERLLICQKPFFKRQAN  696



>ref|XP_010535445.1| PREDICTED: probable pectin methyltransferase QUA2 [Tarenaya hassleriana]
Length=689

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+L+  Q + SRC + ++F+EIDR+LRPEGWVIIRDT  LIE AR  
Sbjct  599  YPRTYDMVHADGLLSLQTGQ-ARSRCSLMDIFMEIDRLLRPEGWVIIRDTAKLIETARSM  657

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              Q+KW+ARV  IESSSE++LL CQKPF R+
Sbjct  658  TTQMKWEARVIEIESSSEQRLLFCQKPFTRR  688



>ref|XP_004490695.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cicer 
arietinum]
 ref|XP_004505832.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cicer 
arietinum]
Length=683

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 72/91 (79%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA GLL+LEFSQ    RC   +LFVEIDR+LRPEGW+I RDT  LIE AR  
Sbjct  592  YPRTYDLVHAAGLLSLEFSQ--RRRCTTLDLFVEIDRLLRPEGWIIFRDTNLLIESARAL  649

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              QLKWDARV  IES+SEEKLL+CQKPF ++
Sbjct  650  TTQLKWDARVIDIESNSEEKLLICQKPFFKR  680



>gb|KDP41393.1| hypothetical protein JCGZ_15800 [Jatropha curcas]
Length=690

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA GLL+LE  Q    RC M ++F E+DR+LRPEGWVII DT PLIE AR  
Sbjct  599  YPRTYDLVHAAGLLSLEAGQ--QRRCTMLDIFTEVDRVLRPEGWVIIHDTAPLIESARAL  656

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
            A +LKWDARV  IES+S+E+LL+CQKPF ++ A+
Sbjct  657  ATRLKWDARVVEIESNSDERLLICQKPFFKRQAS  690



>ref|XP_002452533.1| hypothetical protein SORBIDRAFT_04g027500 [Sorghum bicolor]
 gb|EES05509.1| hypothetical protein SORBIDRAFT_04g027500 [Sorghum bicolor]
Length=656

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADG L+LE  +N   RC   ++F+E+DRILRPEGWVIIRDT PLIE AR  
Sbjct  568  YPRTYDMVHADGFLSLE--KNHKHRCSTLDIFLEVDRILRPEGWVIIRDTAPLIEAARSV  625

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              QL+WDAR+  ++ +S+EKLLVCQKPF+RK
Sbjct  626  VTQLRWDARILDLDIASDEKLLVCQKPFIRK  656



>ref|XP_010521185.1| PREDICTED: probable pectin methyltransferase QUA2 [Tarenaya hassleriana]
Length=696

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (78%), Gaps = 6/98 (6%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YD+VHADGLL+L+   +  +RC + ++F+EIDR+LRPEGWVIIRDT  LIE AR  
Sbjct  599  YPRSYDMVHADGLLSLQTGHHRRNRCSLMDIFIEIDRLLRPEGWVIIRDTTQLIETARTM  658

Query  436  AVQLKWDARVIE------SSSEEKLLVCQKPFVRKVAT  341
            A +LKW+ARVIE      SSS+++LL CQKPF +K++ 
Sbjct  659  ATRLKWEARVIEMAGSGSSSSDQRLLFCQKPFSKKLSN  696



>ref|XP_006649061.1| PREDICTED: probable pectin methyltransferase QUA2-like, partial 
[Oryza brachyantha]
Length=545

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+LE  Q    RC   ++F+E+DRILRPEGWVIIRDT PLIE AR  
Sbjct  456  YPRTYDMVHADGLLSLEKRQKH--RCSTLDIFLEVDRILRPEGWVIIRDTAPLIEAARSV  513

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              QL+WDAR+  ++ +S+EKLL+CQKPF+RK
Sbjct  514  VTQLRWDARILDLDIASDEKLLICQKPFIRK  544



>gb|KEH34953.1| pectin methyltransferase QUA2, putative [Medicago truncatula]
Length=693

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA G L+L+ SQ    RC M ++F+EIDR+LRPEGW+IIRDT+PLIE AR  
Sbjct  602  YPRTYDLVHAAGFLSLQTSQ--QYRCTMLDIFIEIDRLLRPEGWIIIRDTVPLIESARTL  659

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV  IES S+++LL+CQKPF ++ A 
Sbjct  660  TTRLKWDARVIEIESDSDQRLLICQKPFFKRQAN  693



>ref|XP_006581532.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Glycine max]
 ref|XP_006581533.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
 ref|XP_006581534.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X3 [Glycine max]
 ref|XP_006581535.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X4 [Glycine max]
Length=690

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA GLL+LEF+Q    RC M ++F+EIDR+LRPEGW+IIRD +PLIE AR  
Sbjct  599  YPRTYDLVHAAGLLSLEFAQ--QRRCTMLDMFIEIDRLLRPEGWIIIRDIVPLIESARAL  656

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV  IES S+++LL+CQKP  ++ A 
Sbjct  657  TTRLKWDARVVEIESDSDQRLLICQKPLFKRQAN  690



>ref|XP_010926316.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Elaeis guineensis]
Length=659

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLLTLE  Q    RC M ++F+EIDRILRPEGWVI+RDT PLIE AR  
Sbjct  569  YPRTYDMVHAEGLLTLETHQ--QDRCSMLDIFLEIDRILRPEGWVILRDTAPLIEAARSV  626

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
              QL+WDAR++E  ++ +EKLL+CQKPF +K
Sbjct  627  RTQLRWDARMLELNNNGDEKLLICQKPFFKK  657



>ref|XP_010926317.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Elaeis guineensis]
Length=656

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLLTLE  Q    RC M ++F+EIDRILRPEGWVI+RDT PLIE AR  
Sbjct  566  YPRTYDMVHAEGLLTLETHQ--QDRCSMLDIFLEIDRILRPEGWVILRDTAPLIEAARSV  623

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
              QL+WDAR++E  ++ +EKLL+CQKPF +K
Sbjct  624  RTQLRWDARMLELNNNGDEKLLICQKPFFKK  654



>ref|XP_009380861.1| PREDICTED: probable pectin methyltransferase QUA2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+LE  Q    RC M ++F+EIDRILRPEGWVIIRD   L+E AR  
Sbjct  569  YPRTYDMVHADGLLSLETRQKH--RCSMLDIFLEIDRILRPEGWVIIRDAAHLVEAARSM  626

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
              QL+WDAR++E  SSS++KLLVCQKPF RK
Sbjct  627  TTQLRWDARMVELDSSSDKKLLVCQKPFFRK  657



>ref|XP_003570613.2| PREDICTED: probable pectin methyltransferase QUA2 [Brachypodium 
distachyon]
Length=1014

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 74/91 (81%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADG L+LE  + S  RC   ++F+E+DRILRPEGW+IIRDT PLIE AR  
Sbjct  573  YPRTYDMVHADGFLSLE--KRSKRRCSTLDIFLEVDRILRPEGWIIIRDTAPLIEAARSV  630

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
            A QL+WDAR+  ++ +S+EKLLVCQKPF+RK
Sbjct  631  AAQLRWDARILDLDIASDEKLLVCQKPFLRK  661



>gb|AFW73428.1| hypothetical protein ZEAMMB73_978140 [Zea mays]
Length=381

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 72/91 (79%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADG L+LE  +    RC   ++F+E+DRILRPEGWVIIRDT PLIE AR  
Sbjct  293  YPRTYDMVHADGFLSLE--KTHKHRCSTLDIFLEVDRILRPEGWVIIRDTAPLIEAARSV  350

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              QL+WDAR+  ++ +S+EKLLVCQKPF+RK
Sbjct  351  VTQLRWDARILDLDIASDEKLLVCQKPFLRK  381



>gb|KHN08942.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=690

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA GLL+LEF+Q    RC M ++F+EIDR+LRPEGW+IIRD +PLIE AR  
Sbjct  599  YPRTYDLVHAAGLLSLEFAQ--QRRCTMLDIFIEIDRLLRPEGWIIIRDIVPLIESARAL  656

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV  IES S+++LL+CQKP  ++ A 
Sbjct  657  TTRLKWDARVVEIESDSDQRLLICQKPLFKRQAN  690



>ref|XP_006390005.1| hypothetical protein EUTSA_v10018220mg [Eutrema salsugineum]
 gb|ESQ27291.1| hypothetical protein EUTSA_v10018220mg [Eutrema salsugineum]
Length=684

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LLTL+ SQ   S C + E+F EIDR+LRPEGWVIIRDT  L+E AR  
Sbjct  592  YPRTYDLVHADNLLTLQTSQR-RSSCSLIEIFTEIDRLLRPEGWVIIRDTAQLVEAARAL  650

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              QLKW+ARV  IESSSE++LL+CQKPF ++
Sbjct  651  TTQLKWEARVIEIESSSEQRLLICQKPFTKR  681



>gb|EAY87574.1| hypothetical protein OsI_08986 [Oryza sativa Indica Group]
Length=660

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADG L+LE  Q    RC   ++F+E+DRILRPEGWVIIRDT PLIE AR  
Sbjct  571  YPRTYDMVHADGFLSLEKHQKH--RCSTLDIFLEVDRILRPEGWVIIRDTAPLIEAARSV  628

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              QL+WDAR+  ++ +S+EKLLVCQKPF+RK
Sbjct  629  VTQLRWDARILDLDIASDEKLLVCQKPFIRK  659



>ref|XP_002513934.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48517.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=656

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA GLL+LE  Q    RC M ++F E+DR+LRPEGW+II DT PLIE AR  
Sbjct  565  YPRTYDLVHAAGLLSLETGQ--QHRCTMLDIFTEVDRLLRPEGWMIIHDTAPLIESARAL  622

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV  IES+S+E+LL+CQKPF +K A+
Sbjct  623  TARLKWDARVIEIESNSDERLLICQKPFFKKQAS  656



>ref|XP_010939668.1| PREDICTED: probable pectin methyltransferase QUA2 [Elaeis guineensis]
Length=662

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+LEF Q    RC M ++F+EIDRILRPEGWVI+RDT PLIE AR  
Sbjct  572  YPRTYDMVHADGLLSLEFHQKH--RCSMLDIFLEIDRILRPEGWVILRDTAPLIEAARSV  629

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
              +LKWD R++E   +S+EKLLVCQK F RK
Sbjct  630  ITKLKWDIRMMEFDGNSDEKLLVCQKVFFRK  660



>dbj|BAD17245.1| putative early-responsive to dehydration stress protein [Oryza 
sativa Japonica Group]
Length=660

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADG L+LE  Q    RC   ++F+E+DRILRPEGWVIIRDT PLIE AR  
Sbjct  571  YPRTYDMVHADGFLSLEKHQKH--RCSTLDIFLEVDRILRPEGWVIIRDTAPLIEAARSV  628

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              QL+WDAR+  ++ +S+EKLLVCQKPF+RK
Sbjct  629  VTQLRWDARILDLDIASDEKLLVCQKPFIRK  659



>gb|EAZ24662.1| hypothetical protein OsJ_08431 [Oryza sativa Japonica Group]
Length=660

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADG L+LE  Q    RC   ++F+E+DRILRPEGWVIIRDT PLIE AR  
Sbjct  571  YPRTYDMVHADGFLSLEKHQKH--RCSTLDIFLEVDRILRPEGWVIIRDTAPLIEAARSV  628

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              QL+WDAR+  ++ +S+EKLLVCQKPF+RK
Sbjct  629  VTQLRWDARILDLDIASDEKLLVCQKPFIRK  659



>gb|EMT33652.1| hypothetical protein F775_26112 [Aegilops tauschii]
Length=571

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADG L+LE  Q    RC   ++F+E+DRILRPEGW+IIRDT PLIE AR  
Sbjct  483  YPRTYDMVHADGFLSLEKRQKR--RCSTLDIFLEVDRILRPEGWIIIRDTAPLIEAARSV  540

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
            A QL+WDAR+  ++ +S+EKLLVCQKPF++K
Sbjct  541  AAQLRWDARILDLDIASDEKLLVCQKPFLKK  571



>ref|XP_008781887.1| PREDICTED: probable pectin methyltransferase QUA2 [Phoenix dactylifera]
Length=658

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 71/91 (78%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLLTLE  Q    RC M ++F+EIDRILRPEGWVIIRDT PLIE  R  
Sbjct  567  YPRTYDLVHAEGLLTLETYQ--RHRCSMLDIFLEIDRILRPEGWVIIRDTDPLIEAVRSV  624

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
              QL+WDAR++E  + S EKLLVCQKPF +K
Sbjct  625  ITQLRWDARMMELDNDSNEKLLVCQKPFFKK  655



>ref|XP_010269315.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Nelumbo nucifera]
Length=704

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLL+LE  Q    RC M +LF E+DR+LRPEGWVI+RDT+PLIE AR  
Sbjct  613  YPRTYDMVHAEGLLSLETGQ--QHRCTMLDLFTEMDRLLRPEGWVILRDTVPLIESARAL  670

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A + +WDARV+  ES+S+E+LL+CQKPF ++
Sbjct  671  ATRFRWDARVVELESNSDERLLLCQKPFFKR  701



>ref|XP_010269316.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Nelumbo nucifera]
 ref|XP_010269317.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Nelumbo nucifera]
 ref|XP_010269318.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Nelumbo nucifera]
Length=700

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLL+LE  Q    RC M +LF E+DR+LRPEGWVI+RDT+PLIE AR  
Sbjct  609  YPRTYDMVHAEGLLSLETGQ--QHRCTMLDLFTEMDRLLRPEGWVILRDTVPLIESARAL  666

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A + +WDARV+  ES+S+E+LL+CQKPF ++
Sbjct  667  ATRFRWDARVVELESNSDERLLLCQKPFFKR  697



>ref|XP_008646287.1| PREDICTED: probable pectin methyltransferase QUA2 [Zea mays]
 gb|AFW73498.1| hypothetical protein ZEAMMB73_264626 [Zea mays]
Length=657

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 72/91 (79%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADG L+LE  +    RC   ++F+E+DRILRPEGWVIIRDT PLIE AR  
Sbjct  569  YPRTYDMVHADGFLSLE--KTHKHRCSTLDIFLEVDRILRPEGWVIIRDTAPLIEAARSV  626

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              QL+WDAR+  ++ +S+EKLLVCQKPF+RK
Sbjct  627  VTQLRWDARILDLDIASDEKLLVCQKPFLRK  657



>ref|XP_002302304.2| hypothetical protein POPTR_0002s09820g [Populus trichocarpa]
 gb|EEE81577.2| hypothetical protein POPTR_0002s09820g [Populus trichocarpa]
Length=694

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 73/95 (77%), Gaps = 4/95 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YDLVHA GLLTL+  Q    RC M +LF EIDR+LRPEGWVIIRDT PL+E AR  
Sbjct  601  YPRSYDLVHAKGLLTLQTHQ--QRRCTMLDLFTEIDRLLRPEGWVIIRDTAPLVESARML  658

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVATS  338
              +LKWDARV  IES+S+++LL+CQKPF ++   S
Sbjct  659  ITRLKWDARVIEIESNSDDRLLICQKPFFKRQGVS  693



>gb|KDO80998.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=458

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLL+LE S + H RC   ++F EIDRILRPEGWVIIRDT  LIE AR  
Sbjct  367  YPRTYDLVHAEGLLSLE-SGHRH-RCSTLDIFTEIDRILRPEGWVIIRDTARLIESARAL  424

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV  IES+S+E+LL+CQKPF ++ A+
Sbjct  425  TTRLKWDARVIEIESNSDERLLICQKPFFKRQAS  458



>gb|AFW64432.1| hypothetical protein ZEAMMB73_102169 [Zea mays]
Length=699

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 72/91 (79%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADG L+L+  +N   RC   ++F+E+DRILRPEGWVIIRD  PLIE AR  
Sbjct  611  YPRTYDMVHADGFLSLQ--KNHKHRCSTLDIFLEVDRILRPEGWVIIRDAAPLIEAARSV  668

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              QL+WDARV  ++ +S+EKLLVCQKPF+RK
Sbjct  669  VTQLRWDARVLDLDIASDEKLLVCQKPFLRK  699



>ref|XP_008679296.1| PREDICTED: probable pectin methyltransferase QUA2 [Zea mays]
Length=659

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 72/91 (79%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADG L+L+  +N   RC   ++F+E+DRILRPEGWVIIRD  PLIE AR  
Sbjct  571  YPRTYDMVHADGFLSLQ--KNHKHRCSTLDIFLEVDRILRPEGWVIIRDAAPLIEAARSV  628

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              QL+WDARV  ++ +S+EKLLVCQKPF+RK
Sbjct  629  VTQLRWDARVLDLDIASDEKLLVCQKPFLRK  659



>dbj|BAJ94920.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 73/91 (80%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADG L+LE  Q    RC   ++F+E+DRI+RPEGW+IIRDT PLIE AR  
Sbjct  561  YPRTYDMVHADGFLSLEKRQKR--RCSTLDIFLEVDRIVRPEGWIIIRDTAPLIEAARSV  618

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
            A QL+WDAR+  ++ +S+EKLLVCQKPF++K
Sbjct  619  AAQLRWDARILDLDIASDEKLLVCQKPFLKK  649



>dbj|BAJ86389.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=659

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 73/91 (80%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADG L+LE  Q    RC   ++F+E+DRI+RPEGW+IIRDT PLIE AR  
Sbjct  571  YPRTYDMVHADGFLSLEKRQKR--RCSTLDIFLEVDRIVRPEGWIIIRDTAPLIEAARSV  628

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
            A QL+WDAR+  ++ +S+EKLLVCQKPF++K
Sbjct  629  AAQLRWDARILDLDIASDEKLLVCQKPFLKK  659



>emb|CDX88430.1| BnaC06g38740D [Brassica napus]
Length=667

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+ SQ+  S C +  +F EIDR+LRPEGWVIIRDT  L+E AR  
Sbjct  575  YPRTYDLVHADNLLSLQTSQH-RSSCSLLNIFTEIDRLLRPEGWVIIRDTAQLVETARAL  633

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSSE++LL+CQKPF ++
Sbjct  634  TTQLKWEARVIEVESSSEQRLLICQKPFTKR  664



>ref|XP_009387117.1| PREDICTED: probable pectin methyltransferase QUA2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLL+L   Q    RC M ++F+EIDRILRPEGWVIIRDT  LIE AR  
Sbjct  569  YPRTYDMVHAEGLLSLGTHQKQ--RCSMLDIFLEIDRILRPEGWVIIRDTALLIETARSM  626

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
              QL+WDAR+IE   SS EKLLVCQKP+ RK
Sbjct  627  TTQLRWDARLIELDRSSNEKLLVCQKPYFRK  657



>ref|XP_010676338.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=666

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHADGLLTLE  ++S  RC   ++FVEIDRILRPEGWVI RD   LIE  R +
Sbjct  575  YPRTYDLVHADGLLTLE--KDSQRRCNTFDIFVEIDRILRPEGWVIFRDKANLIESIRPY  632

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVA  344
              +LKW+ARV  IES+++EKLLVCQKPF ++ A
Sbjct  633  LARLKWEARVIEIESNNDEKLLVCQKPFFKRHA  665



>gb|KJB80353.1| hypothetical protein B456_013G093300 [Gossypium raimondii]
Length=618

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL    S  +  RCG+ ELF+E+DRILRPEGWV++ D + +IELAR H
Sbjct  532  YPRTYDLLHANGLL----SHLTSERCGLMELFIEMDRILRPEGWVVLSDKLGVIELARAH  587

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++WDARVI  ++ S+E+LLVCQKPF++K
Sbjct  588  ATQIRWDARVIDLQNGSDERLLVCQKPFLKK  618



>gb|KHG30605.1| hypothetical protein F383_04558 [Gossypium arboreum]
Length=673

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL    S  +  RCG+ ELF+E+DRILRPEGWV++ D + +IELAR H
Sbjct  587  YPRTYDLLHANGLL----SHLTSERCGLMELFIEMDRILRPEGWVVLSDKLGVIELARAH  642

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++WDARVI  ++ S+E+LLVCQ+PFV+K
Sbjct  643  ATQIRWDARVIDLQNGSDERLLVCQRPFVKK  673



>ref|XP_010676321.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010676329.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=697

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHADGLLTLE  ++S  RC   ++FVEIDRILRPEGWVI RD   LIE  R +
Sbjct  606  YPRTYDLVHADGLLTLE--KDSQRRCNTFDIFVEIDRILRPEGWVIFRDKANLIESIRPY  663

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVA  344
              +LKW+ARV  IES+++EKLLVCQKPF ++ A
Sbjct  664  LARLKWEARVIEIESNNDEKLLVCQKPFFKRHA  696



>ref|XP_010937423.1| PREDICTED: probable pectin methyltransferase QUA2 [Elaeis guineensis]
 ref|XP_010937424.1| PREDICTED: probable pectin methyltransferase QUA2 [Elaeis guineensis]
Length=662

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+LE  +N   RC M ++F+EIDRILRPEGWVI+ DT PLI+ AR  
Sbjct  572  YPRTYDMVHADGLLSLE--KNQKHRCSMLDIFLEIDRILRPEGWVILHDTAPLIQAARPV  629

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
              QLKWD R++E   +S+EKLL+CQKPF  K
Sbjct  630  ITQLKWDMRMMELNGNSDEKLLICQKPFFMK  660



>ref|XP_004500638.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Cicer arietinum]
Length=659

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 74/94 (79%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YDLVHA G L+LE  Q    +C + ++F+EIDR+LRPEGW+IIRD++PLIE+AR  
Sbjct  568  YPRSYDLVHAAGFLSLETGQ--QRKCTLFDIFIEIDRLLRPEGWIIIRDSVPLIEMARAL  625

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRKVAT  341
              +LKWDARVIE  S S+++LL+CQKPF ++ A 
Sbjct  626  TTRLKWDARVIEIDSDSDQRLLICQKPFFKRQAN  659



>ref|XP_008790889.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Phoenix dactylifera]
Length=453

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+LE  Q    RC M ++F+EIDRILRPEGWVI  D  PLIE AR  
Sbjct  363  YPRTYDMVHADGLLSLEDHQKH--RCSMLDIFLEIDRILRPEGWVIFHDASPLIEAARSV  420

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
              +LKWD R++E   +S+EKLLVCQKPF RK
Sbjct  421  ITKLKWDIRMMEFDGNSDEKLLVCQKPFFRK  451



>ref|XP_004500637.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Cicer arietinum]
Length=689

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 74/94 (79%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YDLVHA G L+LE  Q    +C + ++F+EIDR+LRPEGW+IIRD++PLIE+AR  
Sbjct  598  YPRSYDLVHAAGFLSLETGQ--QRKCTLFDIFIEIDRLLRPEGWIIIRDSVPLIEMARAL  655

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRKVAT  341
              +LKWDARVIE  S S+++LL+CQKPF ++ A 
Sbjct  656  TTRLKWDARVIEIDSDSDQRLLICQKPFFKRQAN  689



>ref|XP_002285784.1| PREDICTED: probable pectin methyltransferase QUA2 [Vitis vinifera]
 ref|XP_010664337.1| PREDICTED: probable pectin methyltransferase QUA2 [Vitis vinifera]
 emb|CBI19170.3| unnamed protein product [Vitis vinifera]
Length=696

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 72/91 (79%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA GLL+LE SQ    RC M +LF EIDR+LRPEGWVI+RDT+ LI+ AR  
Sbjct  605  YPRTYDMVHAAGLLSLETSQ--QRRCTMLDLFTEIDRLLRPEGWVILRDTVSLIDSARML  662

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              +LKWDARV  IES+S E+LLVCQKPF ++
Sbjct  663  ITRLKWDARVVEIESNSNERLLVCQKPFFKR  693



>ref|XP_006472587.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X3 [Citrus sinensis]
Length=667

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLL+LE S + H RC   ++F EIDRILRPEGWVIIRDT  LIE AR  
Sbjct  576  YPRTYDLVHAEGLLSLE-SGHRH-RCSTLDIFTEIDRILRPEGWVIIRDTARLIESARAL  633

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV  IES+S+E+LL+CQKPF ++ A+
Sbjct  634  TTRLKWDARVIEIESNSDERLLICQKPFFKRQAS  667



>ref|XP_006433967.1| hypothetical protein CICLE_v10000463mg [Citrus clementina]
 gb|ESR47207.1| hypothetical protein CICLE_v10000463mg [Citrus clementina]
Length=697

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLL+LE S + H RC   ++F EIDRILRPEGWVIIRDT  LIE AR  
Sbjct  606  YPRTYDLVHAEGLLSLE-SGHRH-RCSTLDIFTEIDRILRPEGWVIIRDTARLIESARAL  663

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV  IES+S+E+LL+CQKPF ++ A+
Sbjct  664  TTRLKWDARVIEIESNSDERLLICQKPFFKRQAS  697



>gb|KDO80995.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=667

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLL+LE S + H RC   ++F EIDRILRPEGWVIIRDT  LIE AR  
Sbjct  576  YPRTYDLVHAEGLLSLE-SGHRH-RCSTLDIFTEIDRILRPEGWVIIRDTARLIESARAL  633

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV  IES+S+E+LL+CQKPF ++ A+
Sbjct  634  TTRLKWDARVIEIESNSDERLLICQKPFFKRQAS  667



>ref|XP_006472585.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006472586.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Citrus sinensis]
Length=697

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLL+LE S + H RC   ++F EIDRILRPEGWVIIRDT  LIE AR  
Sbjct  606  YPRTYDLVHAEGLLSLE-SGHRH-RCSTLDIFTEIDRILRPEGWVIIRDTARLIESARAL  663

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV  IES+S+E+LL+CQKPF ++ A+
Sbjct  664  TTRLKWDARVIEIESNSDERLLICQKPFFKRQAS  697



>ref|XP_009409275.1| PREDICTED: probable pectin methyltransferase QUA2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLL+LE  Q    RC + ++F+EIDRILRPEGW++IRDT  L+E AR  
Sbjct  569  YPRTYDMVHAEGLLSLETHQKH--RCSILDIFLEIDRILRPEGWIMIRDTAHLVETARTV  626

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
              QL+WDAR++E  SSS+EKLLVCQKPF RK
Sbjct  627  ITQLRWDARLMELDSSSDEKLLVCQKPFFRK  657



>gb|KDO80996.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
 gb|KDO80997.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=697

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA+GLL+LE S + H RC   ++F EIDRILRPEGWVIIRDT  LIE AR  
Sbjct  606  YPRTYDLVHAEGLLSLE-SGHRH-RCSTLDIFTEIDRILRPEGWVIIRDTARLIESARAL  663

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
              +LKWDARV  IES+S+E+LL+CQKPF ++ A+
Sbjct  664  TTRLKWDARVIEIESNSDERLLICQKPFFKRQAS  697



>ref|XP_002889181.1| hypothetical protein ARALYDRAFT_895718 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65440.1| hypothetical protein ARALYDRAFT_895718 [Arabidopsis lyrata subsp. 
lyrata]
Length=683

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+ SQ   S C + ++F EIDR+LRPEGWVIIRDT+ L+E AR  
Sbjct  591  YPRTYDLVHADNLLSLQTSQRRKS-CRLIDIFTEIDRLLRPEGWVIIRDTVQLVESARAL  649

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSSE++LL+CQKPF ++
Sbjct  650  VTQLKWEARVIEVESSSEQRLLICQKPFTKR  680



>ref|XP_010428946.1| PREDICTED: probable pectin methyltransferase QUA2 [Camelina sativa]
Length=692

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+  Q   S+C +  +F EIDR+LRPEGWVIIRDT  L+E AR  
Sbjct  598  YPRTYDLVHADNLLSLQTGQRRRSQCSLMAIFTEIDRLLRPEGWVIIRDTALLVEKARAM  657

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSSE++LL+CQKP  ++
Sbjct  658  ITQLKWEARVIEVESSSEQRLLICQKPLTKR  688



>gb|AAG52090.1|AC012680_1 unknown protein, 5' partial; 69506-67937 [Arabidopsis thaliana]
Length=379

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+ SQ   + C + ++F EIDR+LRPEGWVIIRDT  L+E AR+ 
Sbjct  287  YPRTYDLVHADNLLSLQTSQPRKT-CLLIDIFTEIDRLLRPEGWVIIRDTAQLVEKARET  345

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSSE++LL+CQKPF ++
Sbjct  346  ITQLKWEARVIEVESSSEQRLLICQKPFTKR  376



>ref|XP_011016595.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
 ref|XP_011016602.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
Length=693

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 5/95 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YDLVHA GLLTL+  Q    RC M +LF EIDR++RPEGWVI+RDT PL+E AR  
Sbjct  601  YPRSYDLVHARGLLTLQTQQR---RCTMLDLFTEIDRLIRPEGWVIVRDTAPLVESARML  657

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVATS  338
              +LKWDARV  IES+S+++LL+CQKPF ++   S
Sbjct  658  ITRLKWDARVIEIESNSDDRLLICQKPFFKRQGVS  692



>emb|CDP01069.1| unnamed protein product [Coffea canephora]
Length=696

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVH DGLL+LEF +    RC M ++F+E+DRILRPEGWVI+RDT  LIE AR  
Sbjct  605  YPRTYDLVHGDGLLSLEFGEKR--RCEMLDVFIEMDRILRPEGWVILRDTATLIEPARTL  662

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRKVA  344
               LKWDARV+E  ++S+E+LL+CQK FV++ A
Sbjct  663  TTLLKWDARVVEVDNNSDERLLICQKAFVKRPA  695



>ref|XP_009106531.1| PREDICTED: probable pectin methyltransferase QUA2 [Brassica rapa]
Length=658

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+ SQ+  S C +  +F EIDR+LRPEGWVIIRDT  L+E AR  
Sbjct  566  YPRTYDLVHADNLLSLQTSQH-RSSCSLLNIFTEIDRLLRPEGWVIIRDTAQLVETARAL  624

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  E SSE++LL+CQKPF ++
Sbjct  625  TTQLKWEARVIEVERSSEQRLLICQKPFTKR  655



>emb|CDX87461.1| BnaA07g34120D [Brassica napus]
Length=658

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+ SQ+  S C +  +F EIDR+LRPEGWVIIRDT  L+E AR  
Sbjct  566  YPRTYDLVHADNLLSLQTSQH-RSSCSLLNIFTEIDRLLRPEGWVIIRDTAQLVETARAL  624

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  E SSE++LL+CQKPF ++
Sbjct  625  TTQLKWEARVIEVERSSEQRLLICQKPFTKR  655



>ref|XP_010267469.1| PREDICTED: probable pectin methyltransferase QUA2 [Nelumbo nucifera]
 ref|XP_010267476.1| PREDICTED: probable pectin methyltransferase QUA2 [Nelumbo nucifera]
Length=700

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 72/91 (79%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLL+L+ S+    RC M +LF EIDR+LRPEGWVI+ DT  LIE  R  
Sbjct  609  YPRTYDMVHAEGLLSLQTSK--QHRCTMLDLFAEIDRLLRPEGWVILHDTASLIESGRAL  666

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +LKWDARV+  ES+S+EKLLVCQKPF ++
Sbjct  667  ATRLKWDARVVELESNSDEKLLVCQKPFFKR  697



>emb|CDY26858.1| BnaA02g18830D [Brassica napus]
Length=684

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+ SQ   S C + ++  E+DR+LRPEGWVIIRDT+ L+E AR  
Sbjct  592  YPRTYDLVHADNLLSLQMSQRKSS-CSLLQILTEVDRLLRPEGWVIIRDTVQLVEAARAL  650

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSS+++LL+CQKPF ++
Sbjct  651  TTQLKWEARVIEVESSSDQRLLICQKPFTKR  681



>ref|XP_010416801.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Camelina sativa]
 ref|XP_010416802.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Camelina sativa]
Length=689

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+ +Q   S C +  +F EIDR+LRPEGWVIIRDT  L+E AR  
Sbjct  595  YPRTYDLVHADNLLSLQTTQRRRSPCSLMAIFTEIDRLLRPEGWVIIRDTALLVEKARAM  654

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSSE++LL+CQKP  ++
Sbjct  655  ITQLKWEARVIEVESSSEQRLLICQKPLTKR  685



>ref|XP_010472034.1| PREDICTED: probable pectin methyltransferase QUA2 [Camelina sativa]
Length=688

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+ +Q   S C +  +F EIDR+LRPEGWVIIRDT  L+E AR  
Sbjct  594  YPRTYDLVHADNLLSLQTTQRRRSPCSLMAIFTEIDRLLRPEGWVIIRDTALLVEKARAM  653

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSSE++LL+CQKP  ++
Sbjct  654  ITQLKWEARVIEVESSSEQRLLICQKPLTKR  684



>ref|XP_009128288.1| PREDICTED: probable pectin methyltransferase QUA2 [Brassica rapa]
Length=662

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+ SQ   S C + ++  E+DR+LRPEGWVIIRDT+ L+E AR  
Sbjct  570  YPRTYDLVHADSLLSLQTSQRKSS-CSLLQILTEVDRLLRPEGWVIIRDTVQLVEAARAL  628

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSS+++LL+CQKPF ++
Sbjct  629  TTQLKWEARVIEVESSSDQRLLICQKPFTKR  659



>ref|XP_008466224.1| PREDICTED: probable pectin methyltransferase QUA2 [Cucumis melo]
Length=690

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YDLVHA GL++LE S+    RC M +LF EIDR+LRPEGWVIIRDT  LIE AR  
Sbjct  599  YPRSYDLVHAAGLMSLEASKKP--RCSMLDLFSEIDRLLRPEGWVIIRDTTTLIESARTV  656

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVA  344
              QLKWDARV  IE +++E++L+CQKPF+++ A
Sbjct  657  TTQLKWDARVTEIEDNNDERVLICQKPFLKRQA  689



>ref|XP_008790887.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Phoenix dactylifera]
 ref|XP_008790888.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Phoenix dactylifera]
Length=659

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADGLL+LE  Q    RC M ++F+EIDRILRPEGWVI  D  PLIE AR  
Sbjct  569  YPRTYDMVHADGLLSLEDHQKH--RCSMLDIFLEIDRILRPEGWVIFHDASPLIEAARSV  626

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
              +LKWD R++E   +S+EKLLVCQKPF RK
Sbjct  627  ITKLKWDIRMMEFDGNSDEKLLVCQKPFFRK  657



>emb|CDY14622.1| BnaC02g24910D [Brassica napus]
Length=662

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+ SQ   S C + ++  E+DR+LRPEGWVIIRDT+ L+E AR  
Sbjct  570  YPRTYDLVHADNLLSLQTSQR-RSSCSLLQILTEVDRLLRPEGWVIIRDTVQLVEAARAL  628

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSS+++LL+CQKPF ++
Sbjct  629  TTQLKWEARVIEVESSSDQRLLICQKPFTKR  659



>ref|NP_001288873.1| probable pectin methyltransferase QUA2 [Brassica rapa]
 gb|ABV89659.1| dehydration-responsive protein-related [Brassica rapa]
Length=662

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+ SQ   S C + ++  E+DR+LRPEGWVIIRDT+ L+E AR  
Sbjct  570  YPRTYDLVHADSLLSLQTSQRKSS-CSLLQILTEVDRLLRPEGWVIIRDTVQLVEAARAL  628

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSS+++LL+CQKPF ++
Sbjct  629  TTQLKWEARVIEVESSSDQRLLICQKPFTKR  659



>ref|XP_011003042.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
Length=694

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 73/95 (77%), Gaps = 4/95 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YDLVHA+GLL+L+  Q     C M +LF EIDR+LRPEGWVI+RDT PL+E AR  
Sbjct  601  YPRSYDLVHAEGLLSLQTRQ--QRWCTMLDLFTEIDRLLRPEGWVIMRDTAPLVESARRL  658

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVATS  338
              +LKWDARV  IES+S+++LL+CQKPF ++   S
Sbjct  659  TARLKWDARVIEIESNSDDRLLICQKPFFKRQGVS  693



>ref|XP_002306569.2| hypothetical protein POPTR_0005s17180g [Populus trichocarpa]
 gb|EEE93565.2| hypothetical protein POPTR_0005s17180g [Populus trichocarpa]
Length=718

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 73/95 (77%), Gaps = 4/95 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YDLVHA+GLL+L+  Q     C M +LF EIDR+LRPEGWVI+RDT PL+E AR  
Sbjct  625  YPRSYDLVHAEGLLSLQTRQ--QRWCTMLDLFTEIDRLLRPEGWVIMRDTAPLVESARRL  682

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVATS  338
              +LKWDARV  IES+S+++LL+CQKPF ++   S
Sbjct  683  TTRLKWDARVIEIESNSDDRLLICQKPFFKRQGVS  717



>ref|XP_010916838.1| PREDICTED: probable pectin methyltransferase QUA2 [Elaeis guineensis]
Length=657

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLLTLE  Q    RC M ++F+EID ILRPEGWVIIRD  PLIE AR  
Sbjct  566  YPRTYDMVHAEGLLTLETYQ--RHRCSMLDIFLEIDHILRPEGWVIIRDKDPLIEAARSV  623

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
              QL+WDAR++E  + S +KLLVCQKPF +K
Sbjct  624  IAQLRWDARMMELDNDSNKKLLVCQKPFFKK  654



>ref|NP_177948.3| putative pectin methyltransferase TSD2 [Arabidopsis thaliana]
 ref|NP_001154475.1| putative pectin methyltransferase TSD2 [Arabidopsis thaliana]
 sp|Q9C9Q8.2|PMTT_ARATH RecName: Full=Probable pectin methyltransferase QUA2; AltName: 
Full=Protein OVERSENSITIVE TO SUGAR 1; AltName: Full=Protein 
QUASIMODO 2; AltName: Full=Protein TUMOROUS SHOOT DEVELOPMENT 
2 [Arabidopsis thaliana]
 gb|AEE36085.1| putative pectin methyltransferase TSD2 [Arabidopsis thaliana]
 gb|AEE36086.1| putative pectin methyltransferase TSD2 [Arabidopsis thaliana]
Length=684

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+ SQ   + C + ++F EIDR+LRPEGWVIIRDT  L+E AR+ 
Sbjct  592  YPRTYDLVHADNLLSLQTSQPRKT-CLLIDIFTEIDRLLRPEGWVIIRDTAQLVEKARET  650

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSSE++LL+CQKPF ++
Sbjct  651  ITQLKWEARVIEVESSSEQRLLICQKPFTKR  681



>emb|CDX79252.1| BnaC06g20510D [Brassica napus]
Length=684

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LLTL+ S+   S C   ++F EIDR+LRPEGWVIIRDT  L+E AR  
Sbjct  592  YPRTYDLVHADNLLTLQTSK-LRSSCSFMQIFTEIDRLLRPEGWVIIRDTAQLVEAARAL  650

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSSE++LLVCQKP  ++
Sbjct  651  TTQLKWEARVIEVESSSEQRLLVCQKPITKR  681



>ref|XP_009104583.1| PREDICTED: probable pectin methyltransferase QUA2 [Brassica rapa]
 ref|XP_009104584.1| PREDICTED: probable pectin methyltransferase QUA2 [Brassica rapa]
Length=684

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LLTL+ S+   S C   ++F EIDR+LRPEGWVIIRDT  L+E AR  
Sbjct  592  YPRTYDLVHADNLLTLQTSK-LRSSCSFMQIFTEIDRLLRPEGWVIIRDTAQLVEAARAL  650

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSSE++LLVCQKP  ++
Sbjct  651  TTQLKWEARVIEVESSSEQRLLVCQKPITKR  681



>emb|CDX68025.1| BnaA07g20650D [Brassica napus]
Length=683

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LLTL+ S+   S C   ++F EIDR+LRPEGWVIIRDT  L+E AR  
Sbjct  591  YPRTYDLVHADNLLTLQTSK-LRSSCSFMQIFTEIDRLLRPEGWVIIRDTAQLVEAARAL  649

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSSE++LLVCQKP  ++
Sbjct  650  TTQLKWEARVIEVESSSEQRLLVCQKPITKR  680



>gb|KJB50579.1| hypothetical protein B456_008G177800 [Gossypium raimondii]
Length=618

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 72/91 (79%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL    S  +  RC + ELFVE+DRILRPEGWV++ D +  IELAR H
Sbjct  532  YPRTYDLLHANGLL----SHLTSERCSLVELFVEMDRILRPEGWVVLSDKLGAIELARAH  587

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++WDARVI  ++ ++++LLVCQKPFV+K
Sbjct  588  ATQVRWDARVIDVQNGNDQRLLVCQKPFVKK  618



>gb|KHG21066.1| hypothetical protein F383_04870 [Gossypium arboreum]
Length=621

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 72/91 (79%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL    S  +  RC + ELFVE+DRILRPEGWV++ D +  IELAR H
Sbjct  535  YPRTYDLLHANGLL----SHLTSERCSLVELFVEMDRILRPEGWVVLSDKLGAIELARAH  590

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++WDARVI  ++ ++++LLVCQKPFV+K
Sbjct  591  ATQVRWDARVIDVQNGNDQRLLVCQKPFVKK  621



>gb|KJB59919.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=660

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLL+LE SQ  H RC M ++F EIDR+LRPEGW+IIRDT  LI+ AR  
Sbjct  569  YPRTYDMVHAEGLLSLESSQ--HWRCTMVDIFTEIDRMLRPEGWIIIRDTALLIDSARVL  626

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              +LKW+ARV  IES+++E+LL+CQKPF ++
Sbjct  627  TRRLKWEARVIEIESNNDERLLICQKPFFKR  657



>gb|KJB59914.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=712

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLL+LE SQ  H RC M ++F EIDR+LRPEGW+IIRDT  LI+ AR  
Sbjct  621  YPRTYDMVHAEGLLSLESSQ--HWRCTMVDIFTEIDRMLRPEGWIIIRDTALLIDSARVL  678

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              +LKW+ARV  IES+++E+LL+CQKPF ++
Sbjct  679  TRRLKWEARVIEIESNNDERLLICQKPFFKR  709



>gb|KJB59915.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=711

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLL+LE SQ  H RC M ++F EIDR+LRPEGW+IIRDT  LI+ AR  
Sbjct  620  YPRTYDMVHAEGLLSLESSQ--HWRCTMVDIFTEIDRMLRPEGWIIIRDTALLIDSARVL  677

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              +LKW+ARV  IES+++E+LL+CQKPF ++
Sbjct  678  TRRLKWEARVIEIESNNDERLLICQKPFFKR  708



>gb|KJB59918.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=690

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA+GLL+LE SQ  H RC M ++F EIDR+LRPEGW+IIRDT  LI+ AR  
Sbjct  599  YPRTYDMVHAEGLLSLESSQ--HWRCTMVDIFTEIDRMLRPEGWIIIRDTALLIDSARVL  656

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
              +LKW+ARV  IES+++E+LL+CQKPF ++
Sbjct  657  TRRLKWEARVIEIESNNDERLLICQKPFFKR  687



>ref|XP_008353088.1| PREDICTED: probable methyltransferase PMT4 [Malus domestica]
Length=417

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HADGLL    S  S  RCGM +LF+E+DRILRPEGWV++ D    IE+AR  
Sbjct  331  YPRTYDLLHADGLL----SHLSSERCGMMDLFLEMDRILRPEGWVVLCDKKGAIEMARMF  386

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  E+ S+++LLVCQKPFV+K
Sbjct  387  ATQIRWEARVIDLENGSDQRLLVCQKPFVKK  417



>gb|KHN20522.1| Putative methyltransferase PMT4 [Glycine soja]
Length=297

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA GL+    S  S  RC M +LF+E+DRILRPEGWVI+ DTI  IE+AR  
Sbjct  211  YPRTYDMLHAYGLI----SHLSSERCSMVDLFLEMDRILRPEGWVILSDTIGAIEMARML  266

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++WDAR+I  ++ S+++LLVCQKPFV+K
Sbjct  267  AAQVRWDARIIDLQNGSDQRLLVCQKPFVKK  297



>ref|XP_004136285.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cucumis 
sativus]
 ref|XP_004160281.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cucumis 
sativus]
 gb|KGN60218.1| hypothetical protein Csa_3G889740 [Cucumis sativus]
Length=690

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YDLVHA GLL+LE  +    RC M +LF EIDR+LRPEGWVIIRDT  LIE AR  
Sbjct  599  YPRSYDLVHAAGLLSLEAIKKP--RCSMLDLFSEIDRLLRPEGWVIIRDTTTLIESARTV  656

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVA  344
              QLKWDARV  IE +++E++L+CQKPF+++ A
Sbjct  657  TTQLKWDARVIEIEDNNDERVLICQKPFLKRQA  689



>ref|XP_008811174.1| PREDICTED: probable pectin methyltransferase QUA2 [Phoenix dactylifera]
Length=662

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 70/91 (77%), Gaps = 4/91 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HADGLL+LE  Q    RC M ++F+EIDRILRPEGWVI+ D+ PLI+ AR  
Sbjct  572  YPRTYDMMHADGLLSLEKHQKH--RCSMLDIFLEIDRILRPEGWVILHDSAPLIQEARSV  629

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
              QLKWD R++E   +++EKLLVCQKPF  K
Sbjct  630  ITQLKWDTRMMEVNGNNDEKLLVCQKPFFMK  660



>ref|XP_008219451.1| PREDICTED: probable pectin methyltransferase QUA2 [Prunus mume]
 ref|XP_008219452.1| PREDICTED: probable pectin methyltransferase QUA2 [Prunus mume]
Length=698

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 68/94 (72%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA GLL+LE       RC + +LF EIDR+LRPEGWVII D   L+E AR  
Sbjct  607  YPRTYDLVHAAGLLSLEVDH--QRRCTILDLFTEIDRLLRPEGWVIIHDKAALVESARAL  664

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
               LKWDARV  IES+S+EKLL+CQKPF +K A 
Sbjct  665  TTGLKWDARVVEIESNSDEKLLICQKPFFKKQAN  698



>ref|XP_007225175.1| hypothetical protein PRUPE_ppa002227mg [Prunus persica]
 gb|EMJ26374.1| hypothetical protein PRUPE_ppa002227mg [Prunus persica]
Length=698

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 68/94 (72%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA GLL+LE       RC + +LF EIDR+LRPEGWVII D   L+E AR  
Sbjct  607  YPRTYDLVHAAGLLSLEVDH--QRRCTILDLFTEIDRLLRPEGWVIIHDKAALVESARAL  664

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
               LKWDARV  IES+S+EKLL+CQKPF +K A 
Sbjct  665  TTGLKWDARVVEIESNSDEKLLICQKPFFKKQAN  698



>ref|XP_007045901.1| Quasimodo2 like 2 isoform 6 [Theobroma cacao]
 gb|EOY01733.1| Quasimodo2 like 2 isoform 6 [Theobroma cacao]
Length=619

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  S  RC + +LFVE+DRILRPEGWV++ D +  IE AR H
Sbjct  533  YPRTYDMLHANGLL----SHLSSERCSLMDLFVEMDRILRPEGWVVLSDKLGAIEWARAH  588

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++WDARVI  ++ S+++LLVCQKPFV+K
Sbjct  589  ATQIRWDARVIDLQNGSDQRLLVCQKPFVKK  619



>ref|XP_007045896.1| Quasimodo2 like 2 isoform 1 [Theobroma cacao]
 gb|EOY01728.1| Quasimodo2 like 2 isoform 1 [Theobroma cacao]
Length=618

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  S  RC + +LFVE+DRILRPEGWV++ D +  IE AR H
Sbjct  532  YPRTYDMLHANGLL----SHLSSERCSLMDLFVEMDRILRPEGWVVLSDKLGAIEWARAH  587

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++WDARVI  ++ S+++LLVCQKPFV+K
Sbjct  588  ATQIRWDARVIDLQNGSDQRLLVCQKPFVKK  618



>ref|XP_004300652.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465516.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465517.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465518.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465519.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
Length=693

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA GLL++E  Q    RC + +LF EIDR+LRPEGWVII D   LIE AR  
Sbjct  601  YPRTYDMVHAQGLLSVETDQ--QRRCTILDLFTEIDRLLRPEGWVIIHDKASLIESARAL  658

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
               LKWDARV  IES+S+EKLL+CQKPF +K + 
Sbjct  659  TTGLKWDARVVEIESNSDEKLLICQKPFFKKQSN  692



>ref|XP_007045897.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045898.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045899.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045900.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045902.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045903.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01729.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01730.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01731.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01732.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01734.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01735.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
Length=619

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  S  RC + +LFVE+DRILRPEGWV++ D +  IE AR H
Sbjct  533  YPRTYDMLHANGLL----SHLSSERCSLMDLFVEMDRILRPEGWVVLSDKLGAIEWARAH  588

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++WDARVI  ++ S+++LLVCQKPFV+K
Sbjct  589  ATQIRWDARVIDLQNGSDQRLLVCQKPFVKK  619



>ref|XP_008361773.1| PREDICTED: probable methyltransferase PMT5 [Malus domestica]
Length=620

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HADGLL    S  S  RCGM +LF+E+DRILRPEGWV++ D    IE+AR  
Sbjct  534  YPRTYDLLHADGLL----SHLSSERCGMMDLFLEMDRILRPEGWVVLCDKKGAIEMARMF  589

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  E+ S+++LLVCQKPFV+K
Sbjct  590  ATQIRWEARVIDLENGSDQRLLVCQKPFVKK  620



>gb|EPS65073.1| hypothetical protein M569_09706, partial [Genlisea aurea]
Length=682

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 70/92 (76%), Gaps = 5/92 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHA GLL+LEF  N   RC + +LFVEIDR+LRPEGWVI++D    IE+AR  
Sbjct  592  YPRTYDLVHAQGLLSLEF--NEKPRCRLIDLFVEIDRVLRPEGWVILKDGARAIEVARPV  649

Query  436  AVQLKWDARVIES---SSEEKLLVCQKPFVRK  350
              QLKW+AR++E+     +E+LL+CQKPF ++
Sbjct  650  TTQLKWEARIVETEGNGGDERLLICQKPFFKR  681



>ref|XP_006300626.1| hypothetical protein CARUB_v10019895mg [Capsella rubella]
 gb|EOA33524.1| hypothetical protein CARUB_v10019895mg [Capsella rubella]
Length=687

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDLVHAD LL+L+ SQ     C + ++F EIDR+LRPEGWVIIRDT  L+E AR  
Sbjct  594  YPRTYDLVHADNLLSLQTSQRRKG-CSLLDMFTEIDRLLRPEGWVIIRDTTLLVEKARAL  652

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QLKW+ARVI  ESSS+++LL+CQKP  ++
Sbjct  653  VTQLKWEARVIEVESSSDQRLLICQKPLTKR  683



>ref|XP_007157839.1| hypothetical protein PHAVU_002G102600g [Phaseolus vulgaris]
 gb|ESW29833.1| hypothetical protein PHAVU_002G102600g [Phaseolus vulgaris]
Length=611

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 72/91 (79%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HADGLL    S  S  RC M +LF+E+DRILRPEGWVI+ DT+  IE++R  
Sbjct  525  YPRTYDLLHADGLL----SHLSSERCSMIDLFLEMDRILRPEGWVILSDTMGAIEMSRMV  580

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFV+K
Sbjct  581  ATQVRWEARVIDLQNGSDQRLLVCQKPFVKK  611



>ref|XP_009372838.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009372846.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009372855.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA GLL+LE   +   RC + +LF+EIDR+LRPEGWVII D   L+E AR  
Sbjct  604  YPRTYDMVHAAGLLSLE--SDHQRRCTILDLFIEIDRLLRPEGWVIIHDKAFLVESARAL  661

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
               LKW+ARV  IES+S+EKLL+CQKPF +K A 
Sbjct  662  TTGLKWEARVVEIESNSDEKLLICQKPFFKKQAN  695



>ref|XP_004505366.1| PREDICTED: probable methyltransferase PMT5-like [Cicer arietinum]
Length=619

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    SQ    RC M +LF+E+DRILRPEGWVI  DT+  IE+AR  
Sbjct  533  YPRTYDMLHANGLL----SQFISERCSMIDLFLEMDRILRPEGWVIFSDTVATIEIARTL  588

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++WDAR+I  ++ S+++LL+CQKPF++K
Sbjct  589  ATQVRWDARIIDLQNGSDQRLLICQKPFLKK  619



>ref|XP_006605543.1| PREDICTED: probable methyltransferase PMT5-like [Glycine max]
Length=624

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA GL+    S  S  RC M +LF+E+DRILRPEGWVI+ DTI  IE+AR  
Sbjct  538  YPRTYDMLHAYGLI----SHLSSERCSMVDLFLEMDRILRPEGWVILSDTIGAIEMARML  593

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++WDAR+I  ++ S+++LLVCQKPFV+K
Sbjct  594  AAQVRWDARIIDLQNGSDQRLLVCQKPFVKK  624



>ref|XP_011463023.1| PREDICTED: probable methyltransferase PMT5 [Fragaria vesca subsp. 
vesca]
 ref|XP_011463024.1| PREDICTED: probable methyltransferase PMT5 [Fragaria vesca subsp. 
vesca]
 ref|XP_011463025.1| PREDICTED: probable methyltransferase PMT5 [Fragaria vesca subsp. 
vesca]
Length=621

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 73/91 (80%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL+L  S+    RC M +LF+E+DRILRPEGWV++ D +  IE+AR  
Sbjct  535  YPRTYDLLHANGLLSLLSSE----RCSMMDLFLEMDRILRPEGWVVLSDKVGPIEMARMF  590

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFV+K
Sbjct  591  ATQVRWEARVIDPQNGSDQRLLVCQKPFVKK  621



>ref|XP_006583950.1| PREDICTED: probable methyltransferase PMT5-like [Glycine max]
Length=626

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA GL+    S  S  RC M +LF+E+DRILRPEGWVI+ DT+  IE+AR  
Sbjct  540  YPRTYDMLHAYGLI----SHLSSERCSMVDLFLEMDRILRPEGWVILSDTMGAIEMARMF  595

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++WDAR++  ++ S+++LLVCQKPFV+K
Sbjct  596  ATQVRWDARIVDLQNGSDQRLLVCQKPFVKK  626



>gb|KHG00547.1| hypothetical protein F383_17617 [Gossypium arboreum]
Length=600

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  S  RC + +LFVE+DRILRPEGWV++ D +  IELAR H
Sbjct  514  YPRTYDMLHANGLL----SHLSSERCSLMDLFVEMDRILRPEGWVVLYDKLGAIELARAH  569

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
            A Q++W ARV  I++ S+++LL+CQKPF+ K
Sbjct  570  ATQIRWGARVIDIQNGSDQRLLICQKPFLTK  600



>ref|XP_009334340.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334341.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334342.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA GLL+LE   +   RC + +LF EIDR+LRPEGWVI  D   LIE AR  
Sbjct  604  YPRTYDMVHAAGLLSLE--SDHQRRCTILDLFTEIDRLLRPEGWVIFHDKAALIESARAL  661

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
               LKW+ARV  IES+S EKLL+CQKPF +K A 
Sbjct  662  TTGLKWEARVVEIESNSGEKLLICQKPFFKKQAN  695



>ref|XP_008221508.1| PREDICTED: probable methyltransferase PMT5 [Prunus mume]
Length=620

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL    S  S  RC M +LF+E+DRILRPEGWV++ D +  IE+AR  
Sbjct  534  YPRTYDLLHANGLL----SHLSSERCSMMDLFLEMDRILRPEGWVVLCDKVGAIEMARMF  589

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFV+K
Sbjct  590  ATQIRWEARVIDLQNGSDQRLLVCQKPFVKK  620



>ref|XP_007226959.1| hypothetical protein PRUPE_ppa002650mg [Prunus persica]
 gb|EMJ28158.1| hypothetical protein PRUPE_ppa002650mg [Prunus persica]
Length=648

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL    S  S  RC M +LF+E+DRILRPEGWV++ D +  IE+AR  
Sbjct  562  YPRTYDLLHANGLL----SHLSSERCSMMDLFLEMDRILRPEGWVVLCDKVGAIEMARMF  617

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFV+K
Sbjct  618  ATQIRWEARVIDLQNGSDQRLLVCQKPFVKK  648



>ref|XP_009334333.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334334.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334335.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA GLL+LE   +   RC + +LF EIDR+LRPEGWVI  D   LIE AR  
Sbjct  604  YPRTYDMVHAAGLLSLE--SDHQRRCTILDLFTEIDRLLRPEGWVIFHDKAALIESARAL  661

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
               LKW+ARV  IES+S EKLL+CQKPF +K A 
Sbjct  662  TTGLKWEARVVEIESNSGEKLLICQKPFFKKQAN  695



>ref|XP_009356400.1| PREDICTED: probable methyltransferase PMT5 [Pyrus x bretschneideri]
Length=620

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL    S  S  RC M +LF+E+DRILRPEGWV++ D +  IE+AR  
Sbjct  534  YPRTYDLLHANGLL----SHLSSERCSMMDLFLEMDRILRPEGWVVLCDKVGAIEMARVF  589

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFV+K
Sbjct  590  ATQIRWEARVIDLQNGSDQRLLVCQKPFVKK  620



>ref|XP_010320876.1| PREDICTED: probable methyltransferase PMT5 [Solanum lycopersicum]
Length=617

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL+   SQ    +C M EL +E+DRILRPEGW+I+ DT+  IE AR  
Sbjct  531  YPRTYDLLHANGLLSHIASQ----KCSMFELLLEMDRILRPEGWIILSDTLGTIEKARTL  586

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFVRK
Sbjct  587  AAQIRWEARVIDLQNGSDQRLLVCQKPFVRK  617



>ref|XP_010680526.1| PREDICTED: probable pectin methyltransferase QUA2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010680527.1| PREDICTED: probable pectin methyltransferase QUA2 [Beta vulgaris 
subsp. vulgaris]
Length=679

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 71/88 (81%), Gaps = 4/88 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HADGLL+LE  Q  H +C M +LF++IDR+LRPEGW+I RDT  +IELAR  
Sbjct  589  YPRTYDMIHADGLLSLETLQ--HQKCTMLDLFLDIDRLLRPEGWIIFRDTPSMIELARTL  646

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPF  359
            A +L+WD R+  +E++ +E++L+C+KPF
Sbjct  647  ATRLRWDVRIVDVEANIDERVLICRKPF  674



>ref|XP_006348706.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Solanum 
tuberosum]
Length=617

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL+   SQ    +C M EL +E+DRILRPEGW+I+ DT+  IE AR  
Sbjct  531  YPRTYDLLHANGLLSHIASQ----KCSMFELLLEMDRILRPEGWIILSDTLGTIEKARTL  586

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFVRK
Sbjct  587  AAQIRWEARVIDLQNGSDQRLLVCQKPFVRK  617



>ref|XP_006348707.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL+   SQ    +C M EL +E+DRILRPEGW+I+ DT+  IE AR  
Sbjct  530  YPRTYDLLHANGLLSHIASQ----KCSMFELLLEMDRILRPEGWIILSDTLGTIEKARTL  585

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFVRK
Sbjct  586  AAQIRWEARVIDLQNGSDQRLLVCQKPFVRK  616



>ref|XP_010066852.1| PREDICTED: probable methyltransferase PMT5 [Eucalyptus grandis]
 gb|KCW64894.1| hypothetical protein EUGRSUZ_G02456 [Eucalyptus grandis]
Length=618

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  S  RC M +L +E+DRILRPEGWV++ D + +IELAR  
Sbjct  532  YPRTYDMLHANGLL----SHLSSERCSMMDLLLEMDRILRPEGWVVLSDRMGVIELARML  587

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFVRK
Sbjct  588  ATQIRWEARVIDLQNGSDQRLLVCQKPFVRK  618



>ref|XP_008372670.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
 ref|XP_008372733.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
Length=695

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 68/94 (72%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA GLL+LE   +   RC + +LF EIDR+LRPEGWVII D   L+E AR  
Sbjct  604  YPRTYDMVHAAGLLSLE--SDHQRRCTILDLFTEIDRLLRPEGWVIIHDKAFLVESARAL  661

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
               LKW+ARV  IES+S+ KLL+CQKPF +K A 
Sbjct  662  TTGLKWEARVVEIESNSDXKLLICQKPFFKKQAN  695



>gb|KJB30458.1| hypothetical protein B456_005G145000 [Gossypium raimondii]
Length=617

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  S  RC + +LFVE+DRILRPEGW ++ D +  IELAR H
Sbjct  531  YPRTYDMLHANGLL----SHLSSERCSLMDLFVEMDRILRPEGWAVLYDKLGAIELARAH  586

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W ARVI  ++ S+++LL+CQKPF+ K
Sbjct  587  ATQIRWGARVIDLQNGSDQRLLICQKPFLTK  617



>ref|XP_008383924.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
 ref|XP_008383925.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
Length=695

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHA GLL+LE   +   RC + +LF EIDR+LRPEGWVI  D   LIE AR  
Sbjct  604  YPRTYDMVHAAGLLSLE--SDHQRRCTILDLFTEIDRLLRPEGWVIFHDKAALIESARAL  661

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVAT  341
               LKW+ARV  IES+S+EKLL+CQK F +K A 
Sbjct  662  TTGLKWEARVVEIESNSDEKLLICQKSFFKKQAN  695



>ref|XP_009631773.1| PREDICTED: probable methyltransferase PMT5 isoform X2 [Nicotiana 
tomentosiformis]
Length=618

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL+   SQ    +C M +L +E+DRILRPEGW+I+ DT+  IE AR  
Sbjct  532  YPRTYDLLHANGLLSHIVSQ----KCSMFQLLLEMDRILRPEGWIILSDTLGPIEKARTL  587

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ SE++LLVCQKPF RK
Sbjct  588  AAQIRWEARVIDLQNGSEQRLLVCQKPFARK  618



>ref|XP_009631772.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Nicotiana 
tomentosiformis]
Length=619

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL+   SQ    +C M +L +E+DRILRPEGW+I+ DT+  IE AR  
Sbjct  533  YPRTYDLLHANGLLSHIVSQ----KCSMFQLLLEMDRILRPEGWIILSDTLGPIEKARTL  588

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ SE++LLVCQKPF RK
Sbjct  589  AAQIRWEARVIDLQNGSEQRLLVCQKPFARK  619



>ref|XP_002316092.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEF02263.1| dehydration-responsive family protein [Populus trichocarpa]
Length=617

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  S  RC M +LF+E+DRILRPEGWVI  D +  IE+AR  
Sbjct  531  YPRTYDMLHANGLL----SHLSSERCAMMDLFLEMDRILRPEGWVIFSDKLGAIEMARAL  586

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A+Q+ W+ARVI  ++ S+++LLVCQKPF++K
Sbjct  587  AMQIHWEARVIDLDNGSDQRLLVCQKPFMKK  617



>ref|XP_006853194.1| hypothetical protein AMTR_s00038p00207680 [Amborella trichopoda]
 gb|ERN14661.1| hypothetical protein AMTR_s00038p00207680 [Amborella trichopoda]
Length=727

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 68/90 (76%), Gaps = 3/90 (3%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA G+++  F   S   C +  LF+E+DRILRPEGWVI+RDT   IE  R  
Sbjct  639  YPRTYDLIHAQGIVS--FQTASRPWCPILNLFLEMDRILRPEGWVILRDTTLSIEAGRTL  696

Query  436  AVQLKWDARVIE-SSSEEKLLVCQKPFVRK  350
            A Q++WDARV+E  ++EE+LL+CQKPF++K
Sbjct  697  AAQMRWDARVVELENNEERLLICQKPFIKK  726



>gb|AES89995.2| methyltransferase PMT16, putative [Medicago truncatula]
Length=606

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL    SQ    RC M +LF+E+DRILRPEGW+I+ DT+  IE+AR  
Sbjct  520  YPRTYDLLHANGLL----SQFISERCSMIDLFLEMDRILRPEGWIILSDTVGTIEMARTL  575

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+AR+I  ++ S+++LLVCQK F++K
Sbjct  576  ATQVRWEARIIDLQNGSDQRLLVCQKLFLKK  606



>ref|XP_003607798.1| hypothetical protein MTR_4g083030 [Medicago truncatula]
Length=628

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL    SQ    RC M +LF+E+DRILRPEGW+I+ DT+  IE+AR  
Sbjct  542  YPRTYDLLHANGLL----SQFISERCSMIDLFLEMDRILRPEGWIILSDTVGTIEMARTL  597

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+AR+I  ++ S+++LLVCQK F++K
Sbjct  598  ATQVRWEARIIDLQNGSDQRLLVCQKLFLKK  628



>ref|XP_011012134.1| PREDICTED: probable methyltransferase PMT5 [Populus euphratica]
 ref|XP_011012142.1| PREDICTED: probable methyltransferase PMT5 [Populus euphratica]
 ref|XP_011012150.1| PREDICTED: probable methyltransferase PMT5 [Populus euphratica]
Length=619

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  S  RC M +LF+E+DRILRPEGWV+  D +  IE+AR  
Sbjct  533  YPRTYDMLHANGLL----SHLSSERCAMMDLFLEMDRILRPEGWVVFSDKLGAIEMARAL  588

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A+Q+ W+ARVI  ++ S+++LLVCQKPF++K
Sbjct  589  AMQIHWEARVIDLDNGSDQRLLVCQKPFMKK  619



>ref|XP_011018345.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Populus 
euphratica]
 ref|XP_011018353.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Populus 
euphratica]
Length=619

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLLT      S  RC M +LF+E+DRILRPEGWVI  D +  IE+A+  
Sbjct  533  YPRTYDLLHANGLLT----HLSSERCSMMDLFLEMDRILRPEGWVIFSDKLGAIEMAQAL  588

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A+Q+ W+ARVI  ++ S+++LLVCQKPF++K
Sbjct  589  AMQIHWEARVIDLDNGSDQRLLVCQKPFLKK  619



>ref|XP_006365135.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Solanum 
tuberosum]
Length=562

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL+   SQ+    C M EL +E+DRILRPEGW+I+ DT+  IE AR  
Sbjct  476  YPRTYDMIHANGLLSHISSQD----CSMLELLLEMDRILRPEGWIILSDTLGPIEKARML  531

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPF RK
Sbjct  532  ATQIRWEARVIDLQNGSDQRLLVCQKPFTRK  562



>emb|CDY45558.1| BnaC09g21520D [Brassica napus]
Length=590

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 72/91 (79%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLTL  S+    RC + +LF+EIDRILRPEGWV+I D + +IE+AR  
Sbjct  504  YPRTYDMLHANELLTLLSSE----RCSLMDLFLEIDRILRPEGWVVISDKLGVIEMARAL  559

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  560  ATRVRWEARVIDLQDGSDQRLLVCQKPFLKK  590



>ref|XP_002512094.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF50763.1| ATP binding protein, putative [Ricinus communis]
Length=620

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  S  RC M +L +E+DRILRPEGWV++ D +  IE+AR  
Sbjct  534  YPRTYDMLHANGLL----SHLSSERCSMMDLLLEMDRILRPEGWVVLSDKLGAIEMARAL  589

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q+ W+ARVI  ++ S+++LLVCQKPFV+K
Sbjct  590  ATQIHWEARVIDLQNGSDQRLLVCQKPFVKK  620



>ref|XP_006365134.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Solanum 
tuberosum]
Length=616

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL+   SQ+    C M EL +E+DRILRPEGW+I+ DT+  IE AR  
Sbjct  530  YPRTYDMIHANGLLSHISSQD----CSMLELLLEMDRILRPEGWIILSDTLGPIEKARML  585

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPF RK
Sbjct  586  ATQIRWEARVIDLQNGSDQRLLVCQKPFTRK  616



>ref|XP_010323873.1| PREDICTED: probable methyltransferase PMT5 [Solanum lycopersicum]
Length=616

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL+   SQ+    C M EL +E+DRILRPEGW+I+ DT+  IE AR  
Sbjct  530  YPRTYDMLHANGLLSHISSQD----CSMLELLLEMDRILRPEGWIILSDTLGPIEKARML  585

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPF RK
Sbjct  586  ATQIRWEARVIDLQNGSDQRLLVCQKPFTRK  616



>ref|XP_004135150.1| PREDICTED: probable methyltransferase PMT4-like [Cucumis sativus]
 gb|KGN51971.1| hypothetical protein Csa_5G606620 [Cucumis sativus]
Length=656

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 68/91 (75%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL    SQ   SRC M  L VE+DRILRPEGWV+ +D +  IE  R  
Sbjct  570  YPRTYDLLHANGLL----SQLLSSRCSMIGLLVEMDRILRPEGWVVFKDKVGPIEKVRML  625

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFV+K
Sbjct  626  ATQIRWEARVIDFQNGSDQRLLVCQKPFVKK  656



>ref|XP_006484179.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Citrus 
sinensis]
 ref|XP_006484180.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Citrus 
sinensis]
 ref|XP_006484181.1| PREDICTED: probable methyltransferase PMT5-like isoform X3 [Citrus 
sinensis]
Length=619

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  S  RC + +LF+E+DRILRPEGWV+I D +  IE+AR  
Sbjct  533  YPRTYDMLHANGLL----SHLSSERCDLMDLFLEMDRILRPEGWVVISDKLGAIEMARMV  588

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              Q++W+ARVI  ++ S+++LLVCQKPF++K
Sbjct  589  VTQMRWEARVIDLQNGSDQRLLVCQKPFLKK  619



>gb|KHN03641.1| Putative methyltransferase PMT4 [Glycine soja]
Length=623

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+G+L    S  +  RC +  LF+E+DRILRPEGWVI+ D +  IE+AR  
Sbjct  537  YPRTYDMLHANGIL----SHLTSERCSLMNLFLEMDRILRPEGWVILSDNMGAIEMARTL  592

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+AR+I  ++ S+++LLVCQKPF++K
Sbjct  593  AAQVRWEARIIDLQNGSDQRLLVCQKPFLKK  623



>ref|XP_006573141.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Glycine 
max]
 ref|XP_006573142.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Glycine 
max]
Length=620

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+G+L    S  +  RC +  LF+E+DRILRPEGWVI+ D +  IE+AR  
Sbjct  534  YPRTYDMLHANGIL----SHLTSERCSLMNLFLEMDRILRPEGWVILSDNMGAIEMARTL  589

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+AR+I  ++ S+++LLVCQKPF++K
Sbjct  590  AAQVRWEARIIDLQNGSDQRLLVCQKPFLKK  620



>gb|KHN29999.1| Putative methyltransferase PMT4 [Glycine soja]
Length=623

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  +  RC +  LF+E+DRILRPEGWVI+ D +  IE+AR  
Sbjct  537  YPRTYDMLHANGLL----SHLTSERCSLVNLFLEMDRILRPEGWVILSDNMGDIEMARTL  592

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI+  + S+++LLVCQKPF++K
Sbjct  593  AAQVRWEARVIDLKNGSDQRLLVCQKPFLKK  623



>ref|XP_006574934.1| PREDICTED: probable methyltransferase PMT4-like isoform X1 [Glycine 
max]
 ref|XP_006574935.1| PREDICTED: probable methyltransferase PMT4-like isoform X2 [Glycine 
max]
 ref|XP_006574936.1| PREDICTED: probable methyltransferase PMT4-like isoform X3 [Glycine 
max]
Length=620

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  +  RC +  LF+E+DRILRPEGWVI+ D +  IE+AR  
Sbjct  534  YPRTYDMLHANGLL----SHLTSERCSLVNLFLEMDRILRPEGWVILSDNMGDIEMARTL  589

Query  436  AVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI+  + S+++LLVCQKPF++K
Sbjct  590  AAQVRWEARVIDLKNGSDQRLLVCQKPFLKK  620



>gb|AAD17428.2| expressed protein [Arabidopsis thaliana]
Length=380

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  294  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKVGVIEMARAL  349

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  350  AARVRWEARVIDLQDGSDQRLLVCQKPFIKK  380



>ref|XP_009802931.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana sylvestris]
Length=616

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 67/91 (74%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL+   SQ     C M EL +E+DRILRPEGW+I+ DT+  IE AR  
Sbjct  530  YPRTYDLLHANGLLSRIASQG----CSMLELLLEMDRILRPEGWIILSDTLGSIEKARML  585

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q+ W+ RVI  ++ SE++LLVCQKPF RK
Sbjct  586  ATQIHWETRVIDLQNGSEQRLLVCQKPFTRK  616



>ref|XP_008446426.1| PREDICTED: probable methyltransferase PMT5 [Cucumis melo]
 ref|XP_008446427.1| PREDICTED: probable methyltransferase PMT5 [Cucumis melo]
Length=649

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL    SQ   SRC M  L +E+DRILRPEGWV+++D +  IE  R  
Sbjct  563  YPRTYDLLHANGLL----SQLLSSRCNMIGLLLEMDRILRPEGWVVLKDKVGPIEKVRML  618

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFV+K
Sbjct  619  ATQIRWEARVIDFQNGSDQRLLVCQKPFVKK  649



>emb|CDP00420.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL+   SQ     C M +L  E+DRILRPEGWVI+ D +  IE AR  
Sbjct  530  YPRTYDLLHANGLLSHIASQG----CSMIDLLFEMDRILRPEGWVILSDKLGPIEKARSL  585

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A+Q++W+ARVI  E+ S+++LL+CQKPF+RK
Sbjct  586  AIQIRWEARVIDLENGSDQRLLLCQKPFLRK  616



>ref|XP_009777411.1| PREDICTED: probable methyltransferase PMT5 isoform X2 [Nicotiana 
sylvestris]
Length=616

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+ LL+   SQ    +C M +L +E+DRILRPEGW+I+ DT+  IE AR  
Sbjct  530  YPRTYDLLHANELLSHIVSQ----KCSMFQLLLEMDRILRPEGWIILSDTLGPIEKARTL  585

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFVRK
Sbjct  586  AAQIRWEARVIDLQNGSDQRLLVCQKPFVRK  616



>ref|XP_009777410.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Nicotiana 
sylvestris]
Length=617

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+ LL+   SQ    +C M +L +E+DRILRPEGW+I+ DT+  IE AR  
Sbjct  531  YPRTYDLLHANELLSHIVSQ----KCSMFQLLLEMDRILRPEGWIILSDTLGPIEKARTL  586

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFVRK
Sbjct  587  AAQIRWEARVIDLQNGSDQRLLVCQKPFVRK  617



>ref|XP_011075591.1| PREDICTED: probable methyltransferase PMT5 [Sesamum indicum]
Length=615

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 68/91 (75%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA GLL    S  +  RC + +L  E+DRILRPEGW+II D +  +E+AR  
Sbjct  529  YPRTYDMLHAKGLL----SHIASGRCSIIDLLFEMDRILRPEGWIIISDKLGPVEIARTL  584

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +L+W+ARVI  ++ S+E+LLVCQKPFVRK
Sbjct  585  ATRLRWEARVIDLQNGSDERLLVCQKPFVRK  615



>emb|CBI27262.3| unnamed protein product [Vitis vinifera]
Length=120

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 66/91 (73%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  +   C +  L +E+DRILRPEGWV++ D +  IE AR  
Sbjct  34   YPRTYDMLHANGLL----SHLTSEGCNIMNLLLEMDRILRPEGWVVLSDNMVAIEKARAL  89

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  +  ++++LLVCQKPF++K
Sbjct  90   ATQIRWEARVIDLQKGTDQRLLVCQKPFLKK  120



>ref|XP_002892777.1| hypothetical protein ARALYDRAFT_471543 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69036.1| hypothetical protein ARALYDRAFT_471543 [Arabidopsis lyrata subsp. 
lyrata]
Length=603

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  517  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKLGVIEMARTF  572

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
            A +++W+ARV  IE  S+++LLVCQKPF++K
Sbjct  573  AARVRWEARVIDIEDGSDQRLLVCQKPFLKK  603



>emb|CAN64162.1| hypothetical protein VITISV_040645 [Vitis vinifera]
Length=148

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 66/91 (73%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S  +   C +  L +E+DRILRPEGWV++ D +  IE AR  
Sbjct  62   YPRTYDMLHANGLL----SHLTSEGCNIMNLLLEMDRILRPEGWVVLSDNMVAIEKARAL  117

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  +  ++++LLVCQKPF++K
Sbjct  118  ATQIRWEARVIDLQKGTDQRLLVCQKPFLKK  148



>ref|XP_009152172.1| PREDICTED: probable methyltransferase PMT5 [Brassica rapa]
Length=620

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV+I D + +IE+AR  
Sbjct  534  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVISDKLGVIEMARAM  589

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  590  ATRVRWEARVIDLQDGSDQRLLVCQKPFLKK  620



>ref|XP_009129088.1| PREDICTED: probable methyltransferase PMT5 [Brassica rapa]
Length=614

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV+I D + +IE+AR  
Sbjct  528  YPRTYDMLHANELLT----HVSSERCSLMDLFLEMDRILRPEGWVVISDKVGVIEMARAL  583

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  584  ATRVRWEARVIDLQDGSDQRLLVCQKPFLKK  614



>ref|XP_010680718.1| PREDICTED: probable methyltransferase PMT5 [Beta vulgaris subsp. 
vulgaris]
Length=623

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 73/91 (80%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA GLL+L  S+    +C M +LF+E+DRILRPEGWVI+ D +  IE+AR H
Sbjct  537  YPRTYDMLHASGLLSLLSSE----KCSMMDLFLEMDRILRPEGWVILSDNVGAIEMARSH  592

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPF+RK
Sbjct  593  ATQIRWEARVIDPQNGSDQRLLVCQKPFLRK  623



>ref|XP_010554289.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
Length=620

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV+I D + +IE+AR  
Sbjct  534  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVISDKLGVIEMARAF  589

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
            A +++W+ARV  I+  S+++LLVCQKPF++K
Sbjct  590  ATRVRWEARVIDIQDGSDQRLLVCQKPFLKK  620



>gb|EMS61645.1| putative pectin methyltransferase QUA2 [Triticum urartu]
Length=730

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 4/82 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHADG L+LE  Q    RC   ++F+E+DRILRPEGW+IIRDT PLIE AR  
Sbjct  362  YPRTYDMVHADGFLSLEKRQKR--RCSTLDIFLEVDRILRPEGWIIIRDTAPLIEAARSV  419

Query  436  AVQLKWDARV--IESSSEEKLL  377
            A QL+WDAR+  ++ +S+EKLL
Sbjct  420  AAQLRWDARILDLDIASDEKLL  441



>gb|AAK63953.1| At2g03480/T4M8.9 [Arabidopsis thaliana]
Length=394

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  294  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKVGVIEMARAL  349

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++ 
Sbjct  350  AARVRWEARVIDLQDGSDQRLLVCQKPFIKN  380



>gb|AAN46794.1| At2g03480/T4M8.9 [Arabidopsis thaliana]
Length=394

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  294  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKVGVIEMARAL  349

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++ 
Sbjct  350  AARVRWEARVIDLQDGSDQRLLVCQKPFIKN  380



>ref|XP_009114154.1| PREDICTED: probable methyltransferase PMT5 [Brassica rapa]
Length=613

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 72/91 (79%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLTL  S+    +C + +LF+E+DRILRPEGWV+I D + +IE+AR  
Sbjct  527  YPRTYDMLHANELLTLLSSE----QCSLMDLFLEMDRILRPEGWVVISDKLGVIEMARAL  582

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  583  ATRVRWEARVIDLQDGSDQRLLVCQKPFLKK  613



>ref|NP_027543.2| QUASIMODO2 like 2 [Arabidopsis thaliana]
 sp|Q3EC77.2|PMT5_ARATH RecName: Full=Probable methyltransferase PMT5 [Arabidopsis thaliana]
 gb|AEC05705.1| QUASIMODO2 like 2 [Arabidopsis thaliana]
Length=606

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  520  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKVGVIEMARAL  575

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  576  AARVRWEARVIDLQDGSDQRLLVCQKPFIKK  606



>ref|NP_973410.1| QUASIMODO2 like 2 [Arabidopsis thaliana]
 gb|AEC05706.1| QUASIMODO2 like 2 [Arabidopsis thaliana]
Length=595

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  509  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKVGVIEMARAL  564

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  565  AARVRWEARVIDLQDGSDQRLLVCQKPFIKK  595



>emb|CDY04154.1| BnaA09g19320D [Brassica napus]
Length=807

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 72/91 (79%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLTL  S+    +C + +LF+E+DRILRPEGWV+I D + +IE+AR  
Sbjct  721  YPRTYDMLHANELLTLLSSE----QCSLMDLFLEMDRILRPEGWVVISDKLGVIEMARAL  776

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  777  ATRVRWEARVIDLQDGSDQRLLVCQKPFLKK  807



>ref|XP_010527954.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
 ref|XP_010527955.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
 ref|XP_010527956.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
 ref|XP_010527957.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
Length=619

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC M +LF+E+DRILRPEGWV++ D + +IE+ R+ 
Sbjct  533  YPRTYDMLHANELLT----HLSSERCSMMDLFLEMDRILRPEGWVVMSDKVGVIEMGREL  588

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  ++++LLVCQKPF++K
Sbjct  589  ATRVRWEARVIDLQGGNDQRLLVCQKPFLKK  619



>ref|XP_006395700.1| hypothetical protein EUTSA_v10003873mg [Eutrema salsugineum]
 ref|XP_006395701.1| hypothetical protein EUTSA_v10003873mg [Eutrema salsugineum]
 gb|ESQ32986.1| hypothetical protein EUTSA_v10003873mg [Eutrema salsugineum]
 gb|ESQ32987.1| hypothetical protein EUTSA_v10003873mg [Eutrema salsugineum]
Length=595

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  509  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKLGVIEMARAL  564

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  565  AARVRWEARVIDLQDGSDQRLLVCQKPFLKK  595



>ref|XP_010476413.1| PREDICTED: probable methyltransferase PMT4 [Camelina sativa]
Length=595

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  509  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKLGVIEMARTL  564

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  565  AARVRWEARVIDLQDGSDQRLLVCQKPFLKK  595



>ref|XP_006307032.1| hypothetical protein CARUB_v10008622mg [Capsella rubella]
 gb|EOA39930.1| hypothetical protein CARUB_v10008622mg [Capsella rubella]
Length=606

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  520  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKLGVIEMARTL  575

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
            A +++W+ARV  I+  S+++LLVCQKPF++K
Sbjct  576  AARVRWEARVIDIQDGSDQRLLVCQKPFLKK  606



>ref|XP_010495624.1| PREDICTED: probable methyltransferase PMT4 [Camelina sativa]
Length=597

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  511  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKLGVIEMARTL  566

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  567  AARVRWEARVIDLQDGSDQRLLVCQKPFLKK  597



>ref|XP_010458849.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT4 
[Camelina sativa]
Length=606

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  520  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKLGVIEMARTL  575

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  576  AARVRWEARVIDLQDGSDQRLLVCQKPFLKK  606



>ref|XP_010942462.1| PREDICTED: probable methyltransferase PMT4 isoform X2 [Elaeis 
guineensis]
 ref|XP_010942463.1| PREDICTED: probable methyltransferase PMT4 isoform X2 [Elaeis 
guineensis]
Length=405

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 67/91 (74%), Gaps = 5/91 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA GLL+   +     +C +  L +E+DRILRPEGWV++ D + +IE AR  
Sbjct  318  YPRTYDLLHAMGLLSHHLTV---EKCNLSALLLEMDRILRPEGWVVLHDKVQVIEKARAL  374

Query  436  AVQLKWDARVIESSSE--EKLLVCQKPFVRK  350
              Q++WDARVIES S+  ++LL+CQKPF++K
Sbjct  375  VTQIRWDARVIESQSDSHQRLLICQKPFLQK  405



>ref|XP_007153532.1| hypothetical protein PHAVU_003G043400g [Phaseolus vulgaris]
 gb|ESW25526.1| hypothetical protein PHAVU_003G043400g [Phaseolus vulgaris]
Length=608

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 66/91 (73%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++H  GLL    S  +  RC M  LF+E+DRILRPEGWVI+ D    IE+AR  
Sbjct  522  YPRTYDMLHGSGLL----SHITSERCSMMNLFLEMDRILRPEGWVILSDDKRTIEMARAL  577

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              Q++W+ARVI  ++ S+++LLVCQKPF++K
Sbjct  578  TAQVRWEARVIDLQNGSDQRLLVCQKPFLKK  608



>ref|XP_010942457.1| PREDICTED: probable methyltransferase PMT4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010942459.1| PREDICTED: probable methyltransferase PMT4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010942460.1| PREDICTED: probable methyltransferase PMT4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010942461.1| PREDICTED: probable methyltransferase PMT4 isoform X1 [Elaeis 
guineensis]
Length=423

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 67/91 (74%), Gaps = 5/91 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA GLL+   +     +C +  L +E+DRILRPEGWV++ D + +IE AR  
Sbjct  336  YPRTYDLLHAMGLLSHHLTVE---KCNLSALLLEMDRILRPEGWVVLHDKVQVIEKARAL  392

Query  436  AVQLKWDARVIESSSE--EKLLVCQKPFVRK  350
              Q++WDARVIES S+  ++LL+CQKPF++K
Sbjct  393  VTQIRWDARVIESQSDSHQRLLICQKPFLQK  423



>ref|XP_009798763.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana sylvestris]
 ref|XP_009798764.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana sylvestris]
 ref|XP_009798765.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana sylvestris]
Length=617

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 67/91 (74%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H +GLL+   SQ     C + EL +E+DRILRPEGWVI+ D +  IE  R  
Sbjct  531  YPRTYDLLHGNGLLSHLASQG----CSIIELLLEMDRILRPEGWVILSDKLGPIEKVRML  586

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFVRK
Sbjct  587  ATQIRWEARVIDLQNGSDQRLLVCQKPFVRK  617



>ref|XP_002875206.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51465.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=619

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  533  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKVGVIEMARAL  588

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A +++W++RVI  +  S+++LLVCQKPF++K
Sbjct  589  AARVRWESRVIDLQDGSDQRLLVCQKPFLKK  619



>ref|XP_006292704.1| hypothetical protein CARUB_v10018950mg [Capsella rubella]
 gb|EOA25602.1| hypothetical protein CARUB_v10018950mg [Capsella rubella]
Length=606

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  +C + +LF+E+DRILRPEGWV+I D + +IE+AR  
Sbjct  520  YPRTYDMLHANELLT----HLSSEQCSLMDLFLEMDRILRPEGWVVISDKVEVIEVARAL  575

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
            A +++W+ARV  I+  S+++LLVCQKPF++K
Sbjct  576  AARVRWEARVIDIQDGSDQRLLVCQKPFLKK  606



>ref|NP_849656.2| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 gb|AEE29074.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
Length=447

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  361  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKLGVIEMARTL  416

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
            A +++W+ARV  I+  S+++LLVCQKP ++K
Sbjct  417  AARVRWEARVIDIQDGSDQRLLVCQKPLLKK  447



>dbj|BAH56871.1| AT1G13860 [Arabidopsis thaliana]
Length=650

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 70/93 (75%), Gaps = 6/93 (6%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  517  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKLGVIEMARTL  572

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRKVA  344
            A +++W+ARV  I+  S+++LLVCQKP ++K+ 
Sbjct  573  AARVRWEARVIDIQDGSDQRLLVCQKPLLKKIT  605



>ref|XP_010425139.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Camelina 
sativa]
 ref|XP_010425140.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Camelina 
sativa]
Length=621

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  535  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKVGVIEMARAL  590

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  591  TARVRWEARVIDLQDGSDQRLLVCQKPFLKK  621



>gb|EYU28853.1| hypothetical protein MIMGU_mgv1a003065mg [Erythranthe guttata]
Length=611

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 64/91 (70%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA GLL    S  +  +C   +L  E+DRILRPEGWVII D +  IE AR  
Sbjct  525  YPRTYDMLHAKGLL----SHLATEKCSTVDLIFEMDRILRPEGWVIISDKVAPIEAARTL  580

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              QL+W+ARVI  +  S+++LLVCQKPFVRK
Sbjct  581  VTQLRWEARVIDLQDGSDQRLLVCQKPFVRK  611



>ref|XP_010425141.1| PREDICTED: probable methyltransferase PMT5 isoform X2 [Camelina 
sativa]
Length=620

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  534  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKVGVIEMARAL  589

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  590  TARVRWEARVIDLQDGSDQRLLVCQKPFLKK  620



>ref|XP_010514117.1| PREDICTED: probable methyltransferase PMT5 [Camelina sativa]
Length=620

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  534  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKVGVIEMARAL  589

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              +++W+ARVI  +  S+++LLVCQKPF++K
Sbjct  590  TARVRWEARVIDLQDGSDQRLLVCQKPFLKK  620



>ref|XP_010906131.1| PREDICTED: probable methyltransferase PMT5 [Elaeis guineensis]
 ref|XP_010906132.1| PREDICTED: probable methyltransferase PMT5 [Elaeis guineensis]
 ref|XP_010906133.1| PREDICTED: probable methyltransferase PMT5 [Elaeis guineensis]
Length=623

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 67/91 (74%), Gaps = 5/91 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA GLL+   +     +C +  L +E+DRILRPEGWV++ D + +IE AR  
Sbjct  536  YPRTYDLLHAMGLLSHYLTL---EKCSLSALLLEMDRILRPEGWVVLHDKVQVIEKARAL  592

Query  436  AVQLKWDARVIESS--SEEKLLVCQKPFVRK  350
              Q++WDARVIES   S+++LL+CQKPF+RK
Sbjct  593  VTQIRWDARVIESQNDSDQRLLICQKPFLRK  623



>ref|XP_008807815.1| PREDICTED: probable methyltransferase PMT5 [Phoenix dactylifera]
Length=623

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 67/91 (74%), Gaps = 5/91 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA GLL+   +     +C +  L +E+DRILRPEGWV++ D + +IE AR  
Sbjct  536  YPRTYDLLHAMGLLSHYLTL---EKCDLSALLLEMDRILRPEGWVVLHDKVQVIEKARAL  592

Query  436  AVQLKWDARVIESSS--EEKLLVCQKPFVRK  350
              Q++WDARVIES S  +++LL+CQKPF+RK
Sbjct  593  VTQIRWDARVIESKSDNDQRLLICQKPFLRK  623



>dbj|BAC42014.1| unknown protein [Arabidopsis thaliana]
Length=603

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  517  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKLGVIEMARTL  572

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
            A +++W+ARV  I+  S+++LLVCQKP ++K
Sbjct  573  AARVRWEARVIDIQDGSDQRLLVCQKPLLKK  603



>ref|NP_172839.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 ref|NP_849657.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 ref|NP_973819.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 sp|Q8GYW9.2|PMT4_ARATH RecName: Full=Probable methyltransferase PMT4 [Arabidopsis thaliana]
 gb|AEE29075.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 gb|AEE29076.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 gb|AEE29077.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
Length=603

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  517  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKLGVIEMARTL  572

Query  436  AVQLKWDARV--IESSSEEKLLVCQKPFVRK  350
            A +++W+ARV  I+  S+++LLVCQKP ++K
Sbjct  573  AARVRWEARVIDIQDGSDQRLLVCQKPLLKK  603



>ref|XP_009590890.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana tomentosiformis]
 ref|XP_009590891.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana tomentosiformis]
 ref|XP_009590893.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana tomentosiformis]
Length=617

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 66/91 (73%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H +GLL+   SQ     C + EL +E+DRILRPEGWVI+ D +  IE  R  
Sbjct  531  YPRTYDLLHGNGLLSHIASQG----CNIIELLLEMDRILRPEGWVILSDKLGPIEKVRTL  586

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVCQKPFV K
Sbjct  587  ATQIRWEARVIDLQNGSDQRLLVCQKPFVGK  617



>ref|XP_010502360.1| PREDICTED: probable methyltransferase PMT5 [Camelina sativa]
 ref|XP_010502361.1| PREDICTED: probable methyltransferase PMT5 [Camelina sativa]
Length=620

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 69/91 (76%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  534  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKVGVIEMARAL  589

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              +++W+ARVI  +  S+++LLVC+KPF++K
Sbjct  590  TARVRWEARVIDLQDGSDQRLLVCEKPFLKK  620



>ref|XP_006837150.1| hypothetical protein AMTR_s00110p00151520 [Amborella trichopoda]
 gb|ERN00004.1| hypothetical protein AMTR_s00110p00151520 [Amborella trichopoda]
Length=607

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 68/92 (74%), Gaps = 7/92 (8%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSR-CGMXELFVEIDRILRPEGWVIIRDTIPLIELARD  440
            YPRTYD++HA GLL    S   H+  C + +LF+E+DRILRPEGWV+I D + +IE AR 
Sbjct  520  YPRTYDMLHARGLL----SHLVHNEGCNILDLFLEMDRILRPEGWVVICDKVQIIERARA  575

Query  439  HAVQLKWDARVIE--SSSEEKLLVCQKPFVRK  350
               Q++WDAR+IE  S + ++LLVCQKPF++K
Sbjct  576  ITTQVRWDARMIELPSDNNQRLLVCQKPFLKK  607



>ref|XP_008797047.1| PREDICTED: probable methyltransferase PMT5 isoform X2 [Phoenix 
dactylifera]
Length=625

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 66/91 (73%), Gaps = 5/91 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA GLL+   +     +C +  L +E+DRILRPEGW+++ D + +IE AR  
Sbjct  538  YPRTYDLLHAMGLLSHHLTL---EKCDLSALLLEMDRILRPEGWIVLHDKVQVIEKARAL  594

Query  436  AVQLKWDARVIESS--SEEKLLVCQKPFVRK  350
              Q++WDARVIES   S+++LL+CQKPF+ K
Sbjct  595  VTQIRWDARVIESQSDSDQRLLICQKPFLWK  625



>ref|XP_010649494.1| PREDICTED: probable methyltransferase PMT5 [Vitis vinifera]
Length=620

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 67/91 (74%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL+   S+     C +  L +E+DRILRPEGWV++ D +  IE AR  
Sbjct  534  YPRTYDMLHANGLLSHLTSEG----CNIMNLLLEMDRILRPEGWVVLSDNMVAIEKARAL  589

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  +  ++++LLVCQKPF++K
Sbjct  590  ATQIRWEARVIDLQKGTDQRLLVCQKPFLKK  620



>ref|XP_008797046.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Phoenix 
dactylifera]
Length=643

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 66/91 (73%), Gaps = 5/91 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA GLL+   +     +C +  L +E+DRILRPEGW+++ D + +IE AR  
Sbjct  556  YPRTYDLLHAMGLLSHHLTL---EKCDLSALLLEMDRILRPEGWIVLHDKVQVIEKARAL  612

Query  436  AVQLKWDARVIESS--SEEKLLVCQKPFVRK  350
              Q++WDARVIES   S+++LL+CQKPF+ K
Sbjct  613  VTQIRWDARVIESQSDSDQRLLICQKPFLWK  643



>ref|XP_006344244.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006344245.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 64/91 (70%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H +GLL+   SQ     C + E+  E+DRILRPEGW+I+ D +  IE  R  
Sbjct  530  YPRTYDLLHGNGLLSHLESQG----CSIVEVLFEMDRILRPEGWIILSDKLGPIEKVRMV  585

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  +  S+++LLVCQK FVRK
Sbjct  586  ATQMRWEARVIDLQDGSDQRLLVCQKSFVRK  616



>ref|XP_004237055.1| PREDICTED: probable methyltransferase PMT5 [Solanum lycopersicum]
 ref|XP_010319469.1| PREDICTED: probable methyltransferase PMT5 [Solanum lycopersicum]
Length=616

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H  GLL+   SQ     C + E+  E+DRILRPEGW+I+ D +  IE  R  
Sbjct  530  YPRTYDLLHGSGLLSHLESQG----CSIVEVLFEMDRILRPEGWIILSDKLGPIEKVRMV  585

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARV+  ++ S+++LLVCQK FVRK
Sbjct  586  ATQMRWEARVVDLQNGSDQRLLVCQKSFVRK  616



>ref|XP_004155297.1| PREDICTED: probable methyltransferase PMT4-like [Cucumis sativus]
Length=653

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL    SQ   SRC M  L VE+DRILRPEGWV+ +D +  IE  R  
Sbjct  570  YPRTYDLLHANGLL----SQLLSSRCSMIGLLVEMDRILRPEGWVVFKDKVGPIEKVRML  625

Query  436  AVQLKWDARVI--ESSSEEKLLVCQK  365
            A Q++W+ARVI  ++ S+++LLVCQ 
Sbjct  626  ATQIRWEARVIDFQNGSDQRLLVCQN  651



>ref|XP_010258081.1| PREDICTED: probable methyltransferase PMT5 [Nelumbo nucifera]
 ref|XP_010258082.1| PREDICTED: probable methyltransferase PMT5 [Nelumbo nucifera]
 ref|XP_010258083.1| PREDICTED: probable methyltransferase PMT5 [Nelumbo nucifera]
Length=621

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 65/91 (71%), Gaps = 6/91 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+GLL    S   +S C +  L +E+DRILRPEGWV++ D + +IE  R  
Sbjct  535  YPRTYDMLHANGLL----SHIINSECDISNLLLEMDRILRPEGWVVLCDKLHVIEKTRAL  590

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
              Q++W+ARVI  ++ ++  LLVCQKPF++K
Sbjct  591  VTQVRWEARVIQLQNDNDRLLLVCQKPFLKK  621



>emb|CDY02989.1| BnaC07g22380D [Brassica napus]
Length=619

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 64/87 (74%), Gaps = 6/87 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV+I D + +IE+AR  
Sbjct  531  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVISDKLGVIEMARAM  586

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKP  362
            A +++W+ARVI  +  S+++LLV + P
Sbjct  587  ATRVRWEARVIDLQDGSDQRLLVSKLP  613



>emb|CDY53946.1| BnaA02g36960D [Brassica napus]
Length=615

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 60/85 (71%), Gaps = 8/85 (9%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV+I D + +IE+AR  
Sbjct  529  YPRTYDMLHANELLT----HVSSERCSLMDLFLEMDRILRPEGWVVISDKVGVIEMARAL  584

Query  436  AVQLKWDARVIESSSEEKLLVCQKP  362
            A +++W+ARVI+       ++C KP
Sbjct  585  ATRVRWEARVIDLQD----VICSKP  605



>ref|XP_008221505.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT5 
[Prunus mume]
Length=372

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 61/91 (67%), Gaps = 19/91 (21%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA+GLL    S  S  RC M +LF+E+DRILRP             E+AR  
Sbjct  299  YPRTYDLLHANGLL----SHLSSERCSMTDLFLEMDRILRP-------------EMARMF  341

Query  436  AVQLKWDARVI--ESSSEEKLLVCQKPFVRK  350
            A Q++W+ARVI  ++ S+++LLVC KPFV+K
Sbjct  342  ATQIRWEARVIDLQNGSDQRLLVCHKPFVKK  372



>gb|AAF79416.1|AC068197_26 F16A14.7 [Arabidopsis thaliana]
Length=724

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 63/92 (68%), Gaps = 6/92 (7%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV++ D + +IE+AR  
Sbjct  517  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVLSDKLGVIEMARTL  572

Query  436  AVQLKWDARVIESSSEEKLLVCQKPFVRKVAT  341
            A +++W+ARVI+   +     C+  F R++ T
Sbjct  573  AARVRWEARVIDIQDDPSTDACR--FWREIKT  602



>emb|CDY37197.1| BnaC02g35050D [Brassica napus]
Length=604

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 55/72 (76%), Gaps = 4/72 (6%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV+I D + +IE+AR  
Sbjct  518  YPRTYDMLHANELLT----HVSSERCSLMDLFLEMDRILRPEGWVVISDKVGVIEMARAL  573

Query  436  AVQLKWDARVIE  401
            A +++W+ARVI+
Sbjct  574  ATRVRWEARVID  585



>emb|CDY51215.1| BnaA06g39940D [Brassica napus]
Length=631

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 55/72 (76%), Gaps = 4/72 (6%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD++HA+ LLT      S  RC + +LF+E+DRILRPEGWV+I D + +IE+AR  
Sbjct  533  YPRTYDMLHANELLT----HLSSERCSLMDLFLEMDRILRPEGWVVISDKLGVIEMARAM  588

Query  436  AVQLKWDARVIE  401
            A +++W+ARVI+
Sbjct  589  ATRVRWEARVID  600



>ref|XP_010109369.1| putative methyltransferase PMT5 [Morus notabilis]
 gb|EXC22074.1| putative methyltransferase PMT5 [Morus notabilis]
Length=579

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = -1

Query  535  MXELFVEIDRILRPEGWVIIRDTIPLIELARDHAVQLKWDARVI--ESSSEEKLLVCQKP  362
            M +LF+E+DRILRPEGWV++ D +  IE+AR  A Q++W+ARVI  ++ S+++LLVCQKP
Sbjct  516  MKDLFLEMDRILRPEGWVVLSDKMGTIEMARMLATQVRWEARVIDLQNGSDQRLLVCQKP  575

Query  361  FVRK  350
            F+RK
Sbjct  576  FLRK  579



>gb|KHN02028.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=51

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  535  MXELFVEIDRILRPEGWVIIRDTIPLIELARDHAVQLKWDARVIESSSE  389
            M +LF+EIDRIL PEGWVIIRDTIPLIE AR    QLKWDARVIE  S+
Sbjct  1    MLDLFIEIDRILHPEGWVIIRDTIPLIESARPLTAQLKWDARVIEIESD  49



>ref|XP_010677437.1| PREDICTED: probable methyltransferase PMT21 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010677438.1| PREDICTED: probable methyltransferase PMT21 [Beta vulgaris subsp. 
vulgaris]
Length=605

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 8/87 (9%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HADGL T E    SH RC M  + +E+DRILRP G+ IIR+    ++  +  
Sbjct  514  YPRTYDLLHADGLFTAE----SH-RCDMKYVLLEMDRILRPNGYAIIRENNYFVDAIKAI  568

Query  436  AVQLKWDARVIES---SSEEKLLVCQK  365
            A  +KWD R  E+   S  EK+LVCQK
Sbjct  569  AKGMKWDCRKEETGYNSENEKILVCQK  595



>ref|XP_001767424.1| predicted protein [Physcomitrella patens]
 gb|EDQ67748.1| predicted protein, partial [Physcomitrella patens]
Length=506

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 57/90 (63%), Gaps = 9/90 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HA GLLT E       RC +  + +E+DRILRP GWV++R+T  ++      
Sbjct  419  YPRTYDLLHAVGLLTQE-----DKRCNIAHIVLEMDRILRPGGWVLVRETNDMVYRVEAL  473

Query  436  AVQLKWDARVIESSS----EEKLLVCQKPF  359
            A  ++W  R++E+ S    ++KLL CQKP 
Sbjct  474  AKSVRWKTRILETESGPFGKDKLLSCQKPL  503



>gb|ABS83492.1| early response to drought 3 [Pinus pinaster]
Length=183

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  90   YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  144

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + +EKLL+CQK
Sbjct  145  ATGMRWNCHQRDTEDANNGDEKLLICQK  172



>gb|AEW70168.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
 gb|AEW70173.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
 gb|AEW70175.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. densiflora]
Length=185

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  92   YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  146

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + +EKLL+CQK
Sbjct  147  AAGMRWNCHQRDTENARNGDEKLLICQK  174



>gb|AHY28780.1| early response to drought 3, partial [Pinus taeda]
Length=124

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  31   YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  85

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + ++KLL+CQK
Sbjct  86   ATGMRWNCHQRDTEDAKNGDQKLLICQK  113



>gb|AIF75711.1| early response to drought 3, partial [Pinus hwangshanensis]
Length=188

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  95   YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  149

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + +EKLL+CQK
Sbjct  150  AAGMRWNCHQRDTEDAKNGDEKLLICQK  177



>gb|AEW70174.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. ussuriensis]
 gb|AEW70178.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. ussuriensis]
 gb|AEW70181.1| early responsive to dehydration 3, partial [Pinus densiflora]
 gb|AEW70182.1| early responsive to dehydration 3, partial [Pinus densiflora]
Length=185

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  92   YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  146

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + +EKLL+CQK
Sbjct  147  AAGMRWNCHQRDTEDAKNGDEKLLICQK  174



>gb|AEW70176.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. densiflora]
 gb|AEW70179.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. ussuriensis]
 gb|AEW70180.1| early responsive to dehydration 3, partial [Pinus densiflora]
Length=185

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  92   YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  146

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + +EKLL+CQK
Sbjct  147  AAGMRWNCHQRDTEDAKNGDEKLLICQK  174



>gb|AEW70171.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
Length=185

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  92   YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  146

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + +EKLL+CQK
Sbjct  147  AAGMRWNCHQRDTEDARNGDEKLLICQK  174



>gb|AIF75714.1| early response to drought 3, partial [Pinus hwangshanensis]
Length=188

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  95   YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  149

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + +EKLL+CQK
Sbjct  150  AAGMRWNCHQRDTEDAKNGDEKLLICQK  177



>gb|AIF75712.1| early response to drought 3, partial [Pinus hwangshanensis]
 gb|AIF75713.1| early response to drought 3, partial [Pinus hwangshanensis]
 gb|AIF75715.1| early response to drought 3, partial [Pinus hwangshanensis]
Length=188

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  95   YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  149

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + +EKLL+CQK
Sbjct  150  AAGMRWNCHQRDTEDAKNGDEKLLICQK  177



>gb|AEW70169.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
 gb|AEW70170.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
 gb|AEW70172.1| early responsive to dehydration 3, partial [Pinus sylvestris 
var. mongolica]
Length=185

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  92   YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  146

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + +EKLL+CQK
Sbjct  147  AAGMRWNCHQRDTEDAKNGDEKLLICQK  174



>ref|XP_003580350.1| PREDICTED: probable methyltransferase PMT13 [Brachypodium distachyon]
Length=583

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 5/98 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTL-EFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARD  440
            YPRTYDL+HADG+ +L    ++  SRC + ++ +E+DRILRPEG  +IRD+  +IE A  
Sbjct  485  YPRTYDLIHADGINSLITDPKSGKSRCDLFDVMLEMDRILRPEGTTVIRDSPDVIEKAVH  544

Query  439  HAVQLKWDARV----IESSSEEKLLVCQKPFVRKVATS  338
             A  ++W A+V     ES S EK+LV  K F +   TS
Sbjct  545  VAQSIRWIAQVHDSEPESGSTEKILVATKTFWKVPLTS  582



>ref|XP_008802976.1| PREDICTED: probable methyltransferase PMT21 isoform X1 [Phoenix 
dactylifera]
Length=640

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/87 (45%), Positives = 54/87 (62%), Gaps = 7/87 (8%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DG  T E    SHSRC M  + +E+DRILRP G+ IIR+    I+     
Sbjct  551  YPRTYDLLHLDGFFTAE----SHSRCEMKYVLLEMDRILRPNGYAIIRENNYFIDAIATI  606

Query  436  AVQLKWDARVIESS---SEEKLLVCQK  365
            A  ++W+ +  ++     +EKLL+CQK
Sbjct  607  ARGMRWNCQKHDTEYNVEKEKLLICQK  633



>gb|AEW70177.1| early responsive to dehydration 3, partial [Pinus densiflora 
var. densiflora]
Length=185

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  92   YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  146

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + +EKLL+CQK
Sbjct  147  AAGMRWNRHQRDTEDAKNGDEKLLICQK  174



>gb|ACO57101.1| early responsive to dehydration 3 [Pinus halepensis]
Length=201

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  108  YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  162

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + +EKLL+CQK
Sbjct  163  ATGMRWNCHQRDTEDAKNGDEKLLICQK  190



>ref|XP_008802979.1| PREDICTED: probable methyltransferase PMT21 isoform X3 [Phoenix 
dactylifera]
Length=621

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/87 (45%), Positives = 54/87 (62%), Gaps = 7/87 (8%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DG  T E    SHSRC M  + +E+DRILRP G+ IIR+    I+     
Sbjct  532  YPRTYDLLHLDGFFTAE----SHSRCEMKYVLLEMDRILRPNGYAIIRENNYFIDAIATI  587

Query  436  AVQLKWDARVIESS---SEEKLLVCQK  365
            A  ++W+ +  ++     +EKLL+CQK
Sbjct  588  ARGMRWNCQKHDTEYNVEKEKLLICQK  614



>ref|XP_010063906.1| PREDICTED: probable methyltransferase PMT25 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010063907.1| PREDICTED: probable methyltransferase PMT25 isoform X2 [Eucalyptus 
grandis]
 gb|KCW71194.1| hypothetical protein EUGRSUZ_F04285 [Eucalyptus grandis]
Length=825

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 50/88 (57%), Gaps = 5/88 (6%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YDL+HAD L +     +   RC +  +F E+DRILRPEG +I+RD    I      
Sbjct  731  YPRSYDLLHADNLFS-----SLKKRCNLMPVFAEVDRILRPEGILIVRDNAATIAEIESI  785

Query  436  AVQLKWDARVIESSSEEKLLVCQKPFVR  353
            A  L+WD R  +S   E LL  QK F R
Sbjct  786  AKSLQWDVRFTDSKDNEGLLSVQKTFWR  813



>ref|XP_002993743.1| hypothetical protein SELMODRAFT_137575 [Selaginella moellendorffii]
 gb|EFJ05162.1| hypothetical protein SELMODRAFT_137575 [Selaginella moellendorffii]
Length=626

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YDL++A  LL+ E  +     C +  + +E+DRILRPEGWV+++D   +IE AR  
Sbjct  539  YPRSYDLLYARSLLSQELQKPKP--CTLAVIVLEMDRILRPEGWVLLQDETQVIETARSL  596

Query  436  AVQLKWDARVIE--SSSEEKLLVCQK  365
             VQ++W+AR+IE     +++LLV QK
Sbjct  597  LVQIRWEARIIEIPGHGDQRLLVGQK  622



>gb|AHY28778.1| early response to drought 3, partial [Pinus elliottii]
Length=171

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  78   YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  132

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + ++KLL+CQK
Sbjct  133  ATGMRWNCHQRDTEDAKNGDQKLLICQK  160



>gb|AHY28777.1| early response to drought 3, partial [Pinus echinata]
 gb|AHY28779.1| early response to drought 3, partial [Pinus palustris]
Length=188

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  95   YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  149

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + ++KLL+CQK
Sbjct  150  ATGMRWNCHQRDTEDAKNGDQKLLICQK  177



>gb|ACB59070.1| early response to drought 3, partial [Pinus elliottii]
Length=207

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 58/88 (66%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   ++  ++ 
Sbjct  114  YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVDSVKNL  168

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + ++KLL+CQK
Sbjct  169  ATGMRWNCHQRDTEDAKNGDQKLLICQK  196



>gb|AAW72877.1| early response to drought 3, partial [Pinus taeda]
Length=207

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 58/88 (66%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  114  YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  168

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    ++++KLL+CQK
Sbjct  169  ATGMRWNCHQRDTEDAKNADQKLLICQK  196



>gb|AAW72852.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72853.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72854.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72855.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72856.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72857.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72858.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72859.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72860.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72861.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72862.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72863.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72864.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72865.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72866.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72867.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72869.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72870.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72871.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72872.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72873.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72874.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72875.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72876.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72878.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72879.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72880.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72881.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72882.1| early response to drought 3, partial [Pinus taeda]
 gb|AAW72883.1| early response to drought 3, partial [Pinus taeda]
 gb|ACB59068.1| early response to drought 3, partial [Pinus radiata]
 gb|ACB59069.1| early response to drought 3, partial [Pinus radiata]
 gb|ACB59071.1| early response to drought 3, partial [Pinus elliottii]
Length=207

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  114  YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  168

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + ++KLL+CQK
Sbjct  169  ATGMRWNCHQRDTEDAKNGDQKLLICQK  196



>emb|CDX98606.1| BnaA03g43910D [Brassica napus]
Length=664

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 40/87 (46%), Positives = 53/87 (61%), Gaps = 8/87 (9%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL T E       RC M  + +E+DRILRP G+ IIR++   ++     
Sbjct  570  YPRTYDLLHVDGLFTSE-----SQRCEMKYVMLEMDRILRPNGYAIIRESSYFVDNIASV  624

Query  436  AVQLKWDARVIESSSE---EKLLVCQK  365
            A  L+W  R  ++ SE   EKLL+CQK
Sbjct  625  AKGLRWSCRKEQTESESENEKLLICQK  651



>gb|AAW72868.1| early response to drought 3, partial [Pinus taeda]
Length=207

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL    FS  SH RC M  + +E+DRILRP G+VI+R++   +   ++ 
Sbjct  114  YPRTYDLLHVDGL----FSAESH-RCEMKYVLLEMDRILRPAGYVIMRESPHFVNSVKNL  168

Query  436  AVQLKWDARVIES----SSEEKLLVCQK  365
            A  ++W+    ++    + ++KLL+CQK
Sbjct  169  ATGMRWNCHQRDTEDAKNGDQKLLICQK  196



>gb|KHG22120.1| hypothetical protein F383_28461 [Gossypium arboreum]
Length=834

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYD+VHAD L +     +   RC +  + VE+DRILRPEG +I+RD +  I      
Sbjct  740  YPRTYDVVHADHLFS-----SIKKRCKLVAVIVEVDRILRPEGKLIVRDNLETISEVESM  794

Query  436  AVQLKWDARVIESSSEEKLLVCQKPFVR  353
            A  L+W+ R+I S   E LL  +K F R
Sbjct  795  AKSLQWEIRMIYSKDNEGLLCVRKTFWR  822



>emb|CDY01583.1| BnaC07g35730D [Brassica napus]
Length=657

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 40/87 (46%), Positives = 53/87 (61%), Gaps = 8/87 (9%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL T E       RC M  + +E+DRILRP G+ IIR++   ++     
Sbjct  563  YPRTYDLLHVDGLFTSE-----SQRCEMKYVMLEMDRILRPNGYAIIRESSYFVDNIASV  617

Query  436  AVQLKWDARVIESSSE---EKLLVCQK  365
            A  L+W  R  ++ SE   EKLL+CQK
Sbjct  618  AKGLRWSCRKEQTESESENEKLLICQK  644



>ref|XP_008802371.1| PREDICTED: probable methyltransferase PMT19 [Phoenix dactylifera]
Length=623

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 9/85 (11%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HADGL ++  +     +C + ++ +E+DRILRP+G VIIRD + ++   +  
Sbjct  534  YPRTYDLIHADGLFSMYMN-----KCDIVDILLEMDRILRPDGAVIIRDHVDVVVKTKRA  588

Query  436  AVQLKWDARVIESSS----EEKLLV  374
            A QL+W +R++ S +     EKLL+
Sbjct  589  AEQLRWQSRIVHSENGPFHPEKLLI  613



>ref|XP_011022921.1| PREDICTED: probable methyltransferase PMT26 [Populus euphratica]
Length=840

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 5/88 (6%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YDL+HAD L +         RC M  +F E+DRILRPEG +I+RD +  I    + 
Sbjct  746  YPRSYDLLHADHLFS-----KVKKRCSMVAVFAEVDRILRPEGKLIVRDNVETINELENM  800

Query  436  AVQLKWDARVIESSSEEKLLVCQKPFVR  353
            A  ++W+ R+  S  +E LL  QK   R
Sbjct  801  ARSMQWEVRMTYSKDKEGLLCVQKSMWR  828



>dbj|BAJ96685.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=580

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 61/98 (62%), Gaps = 5/98 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTL-EFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARD  440
            YPRTYDL+HADG+ +L    ++  SRC + ++ +E+DRILRPEG  +IRD+  +I  A  
Sbjct  482  YPRTYDLIHADGINSLISDPKSGKSRCDLFDVMLEMDRILRPEGTAVIRDSPDVINKAVQ  541

Query  439  HAVQLKWDARV----IESSSEEKLLVCQKPFVRKVATS  338
             A  ++W  +V     ES S EK+LV  K F +   TS
Sbjct  542  VAQSIRWTTQVHDSEPESGSAEKILVATKTFWKLPLTS  579



>ref|XP_002867953.1| early-responsive to dehydration 3 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44212.1| early-responsive to dehydration 3 [Arabidopsis lyrata subsp. 
lyrata]
Length=600

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 54/87 (62%), Gaps = 8/87 (9%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+H DGL T E       RC M  + +E+DRILRP G+ IIR++   ++     
Sbjct  506  YPRTYDLLHVDGLFTSE-----SQRCDMKYVMLEMDRILRPNGYAIIRESSYFVDTIASV  560

Query  436  AVQLKWDARVIESSSE---EKLLVCQK  365
            A +L+W  R  ++ SE   EKLL+CQK
Sbjct  561  AKELRWSCRKEQTESESANEKLLICQK  587



>ref|XP_002987768.1| hypothetical protein SELMODRAFT_426562 [Selaginella moellendorffii]
 gb|EFJ11071.1| hypothetical protein SELMODRAFT_426562 [Selaginella moellendorffii]
Length=682

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YDL++A  LL+ E  +     C +  + +E+DRILRPEGWV+++D   ++E AR  
Sbjct  595  YPRSYDLLYARSLLSQELQKPKP--CTLAVIVLEMDRILRPEGWVLLQDETQVVETARSL  652

Query  436  AVQLKWDARVIE--SSSEEKLLVCQK  365
             VQ++W+AR+IE     +++LL+ QK
Sbjct  653  LVQIRWEARIIEIPGHGDQRLLIGQK  678



>gb|AIU48591.1| quasimodo 3, partial [Brachypodium distachyon]
Length=505

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 59/88 (67%), Gaps = 5/88 (6%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPRTYDL+HADG+ ++   ++  SRC + ++ +E+DRILRPEG  +IRD+  +IE A   
Sbjct  418  YPRTYDLIHADGINSIT-DKSGKSRCDLFDVMLEMDRILRPEGTTVIRDSPDVIEKAVHV  476

Query  436  AVQLKWDARV----IESSSEEKLLVCQK  365
            A  ++W A+V     ES S EK+LV  K
Sbjct  477  AQSIRWIAQVHDSEPESGSTEKILVATK  504



>ref|XP_002306259.2| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE93255.2| dehydration-responsive family protein [Populus trichocarpa]
Length=796

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = -1

Query  616  YPRTYDLVHADGLLTLEFSQNSHSRCGMXELFVEIDRILRPEGWVIIRDTIPLIELARDH  437
            YPR+YDL+HAD L +         RC +  +F E+DRILRPEG +I+RD + +I    + 
Sbjct  702  YPRSYDLLHADHLFS-----KVKKRCNLAAVFAEVDRILRPEGKLIVRDKVEIINELENM  756

Query  436  AVQLKWDARVIESSSEEKLLVCQKPFVR  353
            A  ++W+ R+  S  +E LL  QK   R
Sbjct  757  ARSMQWEVRMTYSKDKEGLLCVQKSMWR  784



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090