BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF044J21

Length=584
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617529.1|  PREDICTED: uncharacterized protein LOC104109859    277   3e-85   Nicotiana tomentosiformis
ref|XP_009773068.1|  PREDICTED: uncharacterized protein LOC104223342    274   2e-84   Nicotiana sylvestris
ref|XP_002279803.1|  PREDICTED: uncharacterized protein LOC100264112    272   2e-83   Vitis vinifera
emb|CAN71280.1|  hypothetical protein VITISV_027089                     271   4e-83   Vitis vinifera
gb|KDO86848.1|  hypothetical protein CISIN_1g039497mg                   270   5e-83   Citrus sinensis [apfelsine]
ref|XP_006492392.1|  PREDICTED: uncharacterized protein LOC102621537    271   6e-83   
ref|XP_006444588.1|  hypothetical protein CICLE_v10019102mg             271   7e-83   
ref|XP_006355827.1|  PREDICTED: uncharacterized protein LOC102591696    269   2e-82   Solanum tuberosum [potatoes]
ref|XP_004240561.1|  PREDICTED: uncharacterized protein LOC101263710    268   6e-82   Solanum lycopersicum
gb|KCW58166.1|  hypothetical protein EUGRSUZ_H00884                     266   2e-81   Eucalyptus grandis [rose gum]
ref|XP_010069735.1|  PREDICTED: uncharacterized protein LOC104456605    267   2e-81   Eucalyptus grandis [rose gum]
ref|XP_002515212.1|  conserved hypothetical protein                     260   3e-79   Ricinus communis
ref|XP_007051240.1|  TolB protein-related isoform 1                     260   7e-79   
ref|XP_009382467.1|  PREDICTED: uncharacterized protein LOC103970421    258   2e-78   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW58167.1|  hypothetical protein EUGRSUZ_H008852                    247   2e-78   Eucalyptus grandis [rose gum]
ref|XP_006396377.1|  hypothetical protein EUTSA_v10029281mg             256   5e-78   
ref|XP_008461387.1|  PREDICTED: uncharacterized protein LOC103499982    256   9e-78   Cucumis melo [Oriental melon]
ref|XP_002872871.1|  hypothetical protein ARALYDRAFT_490390             255   2e-77   
ref|XP_010270927.1|  PREDICTED: uncharacterized protein LOC104607107    256   2e-77   
gb|EYU46868.1|  hypothetical protein MIMGU_mgv1a002606mg                255   3e-77   Erythranthe guttata [common monkey flower]
ref|XP_004240512.1|  PREDICTED: uncharacterized protein LOC101247825    254   4e-77   Solanum lycopersicum
ref|XP_006366666.1|  PREDICTED: uncharacterized protein LOC102589112    254   4e-77   Solanum tuberosum [potatoes]
ref|NP_192096.1|  tolB-related protein                                  254   5e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011467073.1|  PREDICTED: uncharacterized protein LOC105352244    255   5e-77   Fragaria vesca subsp. vesca
gb|AAM13860.1|  unknown protein                                         254   5e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289995.1|  hypothetical protein CARUB_v10003625mg             254   5e-77   Capsella rubella
ref|XP_010422681.1|  PREDICTED: uncharacterized protein LOC104707922    254   5e-77   Camelina sativa [gold-of-pleasure]
gb|KCW45418.1|  hypothetical protein EUGRSUZ_L00886                     254   6e-77   Eucalyptus grandis [rose gum]
ref|XP_010428858.1|  PREDICTED: uncharacterized protein LOC104713446    253   2e-76   Camelina sativa [gold-of-pleasure]
gb|KDP28318.1|  hypothetical protein JCGZ_14089                         253   5e-76   Jatropha curcas
ref|XP_010921344.1|  PREDICTED: uncharacterized protein LOC105044938    251   9e-76   Elaeis guineensis
gb|KFK30736.1|  hypothetical protein AALP_AA6G020600                    251   1e-75   Arabis alpina [alpine rockcress]
ref|XP_004135965.1|  PREDICTED: uncharacterized protein LOC101214858    250   1e-75   Cucumis sativus [cucumbers]
ref|XP_010091406.1|  hypothetical protein L484_013861                   251   2e-75   
emb|CDP01464.1|  unnamed protein product                                251   2e-75   Coffea canephora [robusta coffee]
ref|XP_010522850.1|  PREDICTED: uncharacterized protein LOC104801322    249   4e-75   Tarenaya hassleriana [spider flower]
gb|KJB09508.1|  hypothetical protein B456_001G146700                    248   2e-74   Gossypium raimondii
emb|CDX74396.1|  BnaA03g26510D                                          246   5e-74   
ref|XP_009134471.1|  PREDICTED: uncharacterized protein LOC103858800    246   1e-73   Brassica rapa
ref|XP_008653395.1|  PREDICTED: uncharacterized protein LOC103633477    243   2e-72   Zea mays [maize]
ref|XP_003562594.1|  PREDICTED: uncharacterized protein LOC100822199    243   2e-72   Brachypodium distachyon [annual false brome]
ref|NP_001060406.1|  Os07g0638100                                       242   3e-72   
ref|XP_002461097.1|  hypothetical protein SORBIDRAFT_02g040640          240   2e-71   Sorghum bicolor [broomcorn]
ref|XP_007221548.1|  hypothetical protein PRUPE_ppa002534mg             239   2e-71   
ref|XP_011079490.1|  PREDICTED: uncharacterized protein LOC105162997    239   2e-71   Sesamum indicum [beniseed]
ref|XP_004958463.1|  PREDICTED: uncharacterized protein LOC101757241    239   3e-71   Setaria italica
gb|EAZ04851.1|  hypothetical protein OsI_27029                          239   5e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_008781198.1|  PREDICTED: uncharacterized protein LOC103701039    238   7e-71   Phoenix dactylifera
ref|XP_008227800.1|  PREDICTED: uncharacterized protein LOC103327273    237   4e-70   Prunus mume [ume]
dbj|BAJ89339.1|  predicted protein                                      236   4e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008343202.1|  PREDICTED: uncharacterized protein LOC103405949    234   2e-69   
dbj|BAJ94262.1|  predicted protein                                      234   2e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009367159.1|  PREDICTED: uncharacterized protein LOC103956844    233   2e-68   Pyrus x bretschneideri [bai li]
ref|XP_010679438.1|  PREDICTED: uncharacterized protein LOC104894805    230   1e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006840287.1|  hypothetical protein AMTR_s00045p00058330          221   1e-64   
ref|XP_007153254.1|  hypothetical protein PHAVU_003G019700g             219   2e-63   Phaseolus vulgaris [French bean]
ref|XP_003529216.2|  PREDICTED: uncharacterized protein LOC100814036    218   4e-63   Glycine max [soybeans]
ref|XP_004498256.1|  PREDICTED: uncharacterized protein LOC101515113    217   6e-63   Cicer arietinum [garbanzo]
ref|XP_010456117.1|  PREDICTED: uncharacterized protein LOC104737601    211   2e-62   
gb|AJD80981.1|  ABA-activated 1 protein                                 214   7e-62   Lupinus luteus
gb|EPS68684.1|  hypothetical protein M569_06083                         207   1e-59   Genlisea aurea
ref|XP_003637686.1|  Protein tolB                                       206   9e-59   
ref|XP_006840288.1|  hypothetical protein AMTR_s00045p00058890          204   5e-58   Amborella trichopoda
ref|XP_002515210.1|  conserved hypothetical protein                     197   9e-56   
ref|XP_003637684.1|  Protein tolB                                       194   2e-54   
gb|EAZ40813.1|  hypothetical protein OsJ_25290                          179   4e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002985152.1|  hypothetical protein SELMODRAFT_121622             171   6e-46   
gb|ABR17080.1|  unknown                                                 151   6e-39   Picea sitchensis
ref|XP_002993240.1|  hypothetical protein SELMODRAFT_136782             150   1e-38   Selaginella moellendorffii
ref|XP_002993781.1|  hypothetical protein SELMODRAFT_187603             150   1e-38   
dbj|BAJ88545.1|  predicted protein                                      150   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003630471.1|  Protein tolB                                       149   4e-38   
ref|XP_007137456.1|  hypothetical protein PHAVU_009G128300g             147   2e-37   Phaseolus vulgaris [French bean]
ref|XP_007019162.1|  DPP6 N-terminal domain-like protein                147   2e-37   
ref|XP_006434259.1|  hypothetical protein CICLE_v10000425mg             147   3e-37   Citrus clementina [clementine]
ref|XP_003527947.1|  PREDICTED: uncharacterized protein LOC100791865    147   3e-37   Glycine max [soybeans]
ref|XP_003562684.2|  PREDICTED: uncharacterized protein LOC100824160    147   3e-37   
gb|KFK44274.1|  hypothetical protein AALP_AA1G237000                    146   4e-37   Arabis alpina [alpine rockcress]
ref|XP_008644344.1|  PREDICTED: uncharacterized protein LOC103625729    145   7e-37   Zea mays [maize]
gb|KDO80522.1|  hypothetical protein CISIN_1g004971mg                   145   1e-36   Citrus sinensis [apfelsine]
ref|XP_006304666.1|  hypothetical protein CARUB_v10011878mg             145   1e-36   Capsella rubella
ref|XP_006472827.1|  PREDICTED: uncharacterized protein LOC102617553    145   1e-36   Citrus sinensis [apfelsine]
emb|CDY08186.1|  BnaA06g15400D                                          144   1e-36   Brassica napus [oilseed rape]
emb|CDX84088.1|  BnaC08g07650D                                          144   1e-36   
emb|CDY04662.1|  BnaC05g17000D                                          144   2e-36   
emb|CDP10971.1|  unnamed protein product                                144   2e-36   Coffea canephora [robusta coffee]
ref|XP_010477409.1|  PREDICTED: uncharacterized protein LOC104756505    144   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_004981111.1|  PREDICTED: uncharacterized protein LOC101776730    144   2e-36   Setaria italica
gb|KJB29176.1|  hypothetical protein B456_005G088400                    144   2e-36   Gossypium raimondii
ref|XP_009149686.1|  PREDICTED: uncharacterized protein LOC103873010    144   2e-36   Brassica rapa
emb|CBI18981.3|  unnamed protein product                                142   3e-36   Vitis vinifera
ref|XP_010521281.1|  PREDICTED: uncharacterized protein LOC104800...    144   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_010521282.1|  PREDICTED: uncharacterized protein LOC104800...    144   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_006351203.1|  PREDICTED: uncharacterized protein LOC102604753    143   5e-36   Solanum tuberosum [potatoes]
ref|XP_002890452.1|  hypothetical protein ARALYDRAFT_472406             143   5e-36   
ref|XP_004502520.1|  PREDICTED: uncharacterized protein LOC101497096    142   6e-36   Cicer arietinum [garbanzo]
ref|NP_564147.1|  DPP6 N-terminal domain-like protein                   143   6e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010270269.1|  PREDICTED: uncharacterized protein LOC104606655    142   8e-36   Nelumbo nucifera [Indian lotus]
gb|EAZ29242.1|  hypothetical protein OsJ_13305                          142   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051846.1|  Os03g0840200                                       142   1e-35   
ref|XP_006416277.1|  hypothetical protein EUTSA_v10009943mg             142   2e-35   Eutrema salsugineum [saltwater cress]
ref|XP_002520326.1|  conserved hypothetical protein                     142   2e-35   Ricinus communis
ref|XP_011027475.1|  PREDICTED: uncharacterized protein LOC105127763    141   2e-35   Populus euphratica
ref|XP_011027472.1|  PREDICTED: uncharacterized protein LOC105127760    141   3e-35   Populus euphratica
ref|XP_006386357.1|  hypothetical protein POPTR_0002s08010g             141   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010672499.1|  PREDICTED: uncharacterized protein LOC104889058    140   4e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002285876.2|  PREDICTED: uncharacterized protein LOC100267814    140   5e-35   Vitis vinifera
emb|CAN73514.1|  hypothetical protein VITISV_037210                     140   5e-35   Vitis vinifera
ref|XP_002466125.1|  hypothetical protein SORBIDRAFT_01g001880          140   5e-35   Sorghum bicolor [broomcorn]
gb|KDP32822.1|  hypothetical protein JCGZ_12114                         140   6e-35   Jatropha curcas
emb|CDP10970.1|  unnamed protein product                                140   9e-35   Coffea canephora [robusta coffee]
ref|XP_009411896.1|  PREDICTED: uncharacterized protein LOC103993528    139   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY92514.1|  hypothetical protein OsI_14253                          139   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_010498624.1|  PREDICTED: uncharacterized protein LOC104776288    139   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_011069633.1|  PREDICTED: uncharacterized protein LOC105155456    138   2e-34   Sesamum indicum [beniseed]
ref|XP_008466749.1|  PREDICTED: uncharacterized protein LOC103504088    139   2e-34   Cucumis melo [Oriental melon]
ref|XP_004249849.1|  PREDICTED: uncharacterized protein LOC101257324    138   2e-34   Solanum lycopersicum
ref|XP_010269111.1|  PREDICTED: uncharacterized protein LOC104605872    137   3e-34   Nelumbo nucifera [Indian lotus]
ref|XP_009593179.1|  PREDICTED: uncharacterized protein LOC104089880    137   5e-34   Nicotiana tomentosiformis
ref|XP_001780675.1|  predicted protein                                  137   7e-34   
ref|XP_009796392.1|  PREDICTED: uncharacterized protein LOC104242978    137   7e-34   Nicotiana sylvestris
ref|XP_007223068.1|  hypothetical protein PRUPE_ppa003730mg             135   1e-33   
ref|XP_010911317.1|  PREDICTED: uncharacterized protein LOC105037336    137   1e-33   Elaeis guineensis
ref|XP_009343980.1|  PREDICTED: uncharacterized protein LOC103935890    136   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_010063935.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    136   2e-33   Eucalyptus grandis [rose gum]
gb|EYU32510.1|  hypothetical protein MIMGU_mgv1a026619mg                136   2e-33   Erythranthe guttata [common monkey flower]
ref|XP_004290903.2|  PREDICTED: uncharacterized protein LOC101292474    135   6e-33   Fragaria vesca subsp. vesca
ref|XP_004160721.1|  PREDICTED: protein TolB-like                       134   6e-33   
ref|XP_004149439.1|  PREDICTED: protein TolB-like                       134   6e-33   Cucumis sativus [cucumbers]
ref|XP_010095431.1|  hypothetical protein L484_013388                   134   1e-32   
ref|XP_008338671.1|  PREDICTED: uncharacterized protein LOC103401727    132   3e-32   
ref|XP_008219596.1|  PREDICTED: uncharacterized protein LOC103319783    132   4e-32   Prunus mume [ume]
gb|EAY93383.1|  hypothetical protein OsI_15178                          129   1e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_002520327.1|  conserved hypothetical protein                     125   3e-30   
ref|XP_010539663.1|  PREDICTED: uncharacterized protein LOC104813673    121   2e-28   Tarenaya hassleriana [spider flower]
gb|EMT16880.1|  hypothetical protein F775_15390                         113   3e-26   
ref|XP_010477408.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    115   3e-26   
ref|XP_006652005.1|  PREDICTED: uncharacterized protein LOC102702184    112   8e-26   
ref|NP_001173830.1|  Os04g0278101                                       110   2e-25   
ref|XP_010488216.1|  PREDICTED: uncharacterized protein LOC104766097    108   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010466456.1|  PREDICTED: uncharacterized protein LOC104746...    108   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010510815.1|  PREDICTED: uncharacterized protein LOC104787018    108   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010466457.1|  PREDICTED: uncharacterized protein LOC104746...    108   1e-23   
ref|NP_564146.1|  uncharacterized protein                               107   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890451.1|  hypothetical protein ARALYDRAFT_472405             106   7e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_006416278.1|  hypothetical protein EUTSA_v10006965mg             101   4e-21   Eutrema salsugineum [saltwater cress]
ref|XP_005646452.1|  tricorn protease N-terminal domain-containin...    100   7e-21   Coccomyxa subellipsoidea C-169
gb|EMS54560.1|  hypothetical protein TRIUR3_19354                     94.0    1e-20   Triticum urartu
gb|KFK44273.1|  hypothetical protein AALP_AA1G236600                  99.4    2e-20   Arabis alpina [alpine rockcress]
emb|CDY04661.1|  BnaC05g16990D                                        98.2    4e-20   
emb|CDY08187.1|  BnaA06g15390D                                        96.7    2e-19   Brassica napus [oilseed rape]
ref|XP_009149685.1|  PREDICTED: uncharacterized protein LOC103873008  96.7    2e-19   Brassica rapa
ref|XP_002467956.1|  hypothetical protein SORBIDRAFT_01g037140        92.8    4e-18   
gb|ABJ88479.1|  WD40 domain protein beta Propeller                    88.2    9e-17   Candidatus Solibacter usitatus Ellin6076
ref|WP_041858684.1|  hypothetical protein                             88.2    1e-16   
ref|XP_004960704.1|  PREDICTED: uncharacterized protein LOC101777811  86.7    4e-16   Setaria italica
ref|XP_010676032.1|  PREDICTED: uncharacterized protein LOC104891942  85.9    7e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT08438.1|  hypothetical protein F775_30261                       85.1    2e-15   
gb|AFK45973.1|  unknown                                               76.6    1e-14   Medicago truncatula
gb|EAY89757.1|  hypothetical protein OsI_11300                        81.6    2e-14   Oryza sativa Indica Group [Indian rice]
gb|EJL34752.1|  periplasmic component of the Tol biopolymer trans...  81.3    2e-14   Caulobacter sp. AP07
ref|NP_001049934.1|  Os03g0314500                                     81.3    3e-14   
emb|CAE05101.3|  OSJNBa0009K15.21                                     76.3    5e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002437598.1|  hypothetical protein SORBIDRAFT_10g030220        80.1    7e-14   Sorghum bicolor [broomcorn]
gb|KFY12538.1|  hypothetical protein V491_06750                       79.7    9e-14   Pseudogymnoascus sp. VKM F-3775
ref|WP_035092853.1|  hypothetical protein                             79.3    9e-14   Caulobacter henricii
ref|WP_035205184.1|  hypothetical protein                             79.0    1e-13   Acidovorax
gb|EJE50504.1|  periplasmic component of the Tol biopolymer trans...  79.0    1e-13   Acidovorax sp. CF316
ref|XP_002446045.1|  hypothetical protein SORBIDRAFT_06g000930        78.6    2e-13   Sorghum bicolor [broomcorn]
ref|XP_010676033.1|  PREDICTED: uncharacterized protein LOC104891943  78.6    2e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010087211.1|  hypothetical protein L484_006140                 78.6    2e-13   Morus notabilis
ref|XP_004963491.1|  PREDICTED: uncharacterized protein LOC101774581  78.2    3e-13   Setaria italica
ref|WP_020604165.1|  hypothetical protein                             77.8    3e-13   Spirosoma spitsbergense
ref|XP_010102639.1|  hypothetical protein L484_010931                 78.2    3e-13   Morus notabilis
gb|KFY42678.1|  hypothetical protein V495_04387                       78.2    3e-13   Pseudogymnoascus sp. VKM F-4514 (FW-929)
ref|XP_010675829.1|  PREDICTED: uncharacterized protein LOC104891772  78.2    3e-13   Beta vulgaris subsp. vulgaris [field beet]
gb|KFY81759.1|  hypothetical protein V500_11119                       77.8    3e-13   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_002519807.1|  conserved hypothetical protein                   77.8    3e-13   
gb|KFZ03462.1|  hypothetical protein V502_10931                       77.8    3e-13   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
dbj|BAJ92843.1|  predicted protein                                    77.8    4e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFY02373.1|  hypothetical protein O988_02191                       77.8    4e-13   Pseudogymnoascus sp. VKM F-3808
gb|KFX90155.1|  hypothetical protein V490_06619                       77.0    7e-13   Pseudogymnoascus sp. VKM F-3557
ref|XP_002519802.1|  conserved hypothetical protein                   77.0    7e-13   Ricinus communis
ref|XP_010091904.1|  hypothetical protein L484_001053                 73.6    8e-13   
ref|XP_010675836.1|  PREDICTED: uncharacterized protein LOC104891779  76.6    9e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004980674.1|  PREDICTED: uncharacterized protein LOC101756594  76.6    1e-12   Setaria italica
ref|WP_006298539.1|  hypothetical protein                             75.9    1e-12   
gb|EMT19136.1|  hypothetical protein F775_12749                       75.9    2e-12   
gb|EAY90391.1|  hypothetical protein OsI_11968                        75.9    2e-12   Oryza sativa Indica Group [Indian rice]
ref|WP_029915040.1|  hypothetical protein                             75.5    2e-12   Caulobacter sp. UNC358MFTsu5.1
gb|KFY15902.1|  hypothetical protein V492_01680                       75.5    2e-12   Pseudogymnoascus sp. VKM F-4246
gb|EMT14934.1|  hypothetical protein F775_30553                       75.5    2e-12   
ref|XP_008662981.1|  PREDICTED: uncharacterized protein LOC103641407  75.5    2e-12   Zea mays [maize]
gb|KFY39698.1|  hypothetical protein V494_03875                       75.1    3e-12   Pseudogymnoascus sp. VKM F-4513 (FW-928)
ref|XP_002524160.1|  conserved hypothetical protein                   74.7    3e-12   Ricinus communis
gb|EMT29283.1|  hypothetical protein F775_17496                       75.1    4e-12   
gb|EAZ27259.1|  hypothetical protein OsJ_11196                        74.3    5e-12   Oryza sativa Japonica Group [Japonica rice]
gb|KFY74302.1|  hypothetical protein V499_05663                       74.3    6e-12   Pseudogymnoascus sp. VKM F-103
ref|WP_030901696.1|  hypothetical protein                             73.9    6e-12   Streptomyces sp. NRRL F-5126
gb|KCW71232.1|  hypothetical protein EUGRSUZ_F04330                   73.9    6e-12   Eucalyptus grandis [rose gum]
ref|NP_001050324.1|  Os03g0403400                                     73.9    7e-12   
gb|EMS49561.1|  hypothetical protein TRIUR3_11240                     73.6    7e-12   Triticum urartu
ref|XP_003575792.1|  PREDICTED: uncharacterized protein LOC100821131  73.9    8e-12   Brachypodium distachyon [annual false brome]
gb|KFZ05841.1|  hypothetical protein V501_07970                       73.6    9e-12   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
ref|XP_002524154.1|  conserved hypothetical protein                   73.6    9e-12   Ricinus communis
ref|XP_003574472.1|  PREDICTED: uncharacterized protein LOC100838501  73.2    1e-11   Brachypodium distachyon [annual false brome]
gb|ENH85242.1|  WD40 domain protein beta propeller                    71.6    4e-11   
ref|XP_010235117.1|  PREDICTED: uncharacterized protein LOC100846313  71.2    5e-11   
ref|XP_010105408.1|  hypothetical protein L484_008562                 70.1    7e-11   
ref|XP_010097467.1|  hypothetical protein L484_024672                 70.9    8e-11   
ref|XP_010675830.1|  PREDICTED: uncharacterized protein LOC104891773  70.9    9e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010094534.1|  hypothetical protein L484_024827                 67.4    1e-10   Morus notabilis
ref|XP_010675837.1|  PREDICTED: uncharacterized protein LOC104891780  70.1    1e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|AHI25037.1|  hypothetical protein H845_1092                        69.7    1e-10   Komagataeibacter xylinus E25
ref|WP_025438063.1|  hypothetical protein                             69.7    1e-10   Komagataeibacter xylinus
emb|CDM86908.1|  unnamed protein product                              70.1    1e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001545913.1|  hypothetical protein BC1G_15641                  69.3    2e-10   Botrytis cinerea B05.10
emb|CBH22796.1|  TolB protein precursor                               68.9    3e-10   Salinibacter ruber M8
dbj|BAK07068.1|  predicted protein                                    68.9    3e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010097483.1|  hypothetical protein L484_024689                 68.9    3e-10   Morus notabilis
ref|XP_010102640.1|  hypothetical protein L484_010932                 68.2    5e-10   Morus notabilis
gb|EMT06488.1|  hypothetical protein F775_06751                       67.8    6e-10   
ref|XP_010097765.1|  hypothetical protein L484_023906                 67.8    7e-10   Morus notabilis
ref|WP_019091574.1|  hypothetical protein                             67.8    7e-10   Komagataeibacter europaeus
ref|WP_035035180.1|  hypothetical protein                             67.4    8e-10   
dbj|GAA89133.1|  tat pathway signal sequence domain-containing pr...  67.4    8e-10   Aspergillus kawachii IFO 4308
ref|XP_007798560.1|  putative tat pathway signal sequence domain-...  67.4    9e-10   
ref|WP_019086650.1|  hypothetical protein                             67.4    9e-10   Komagataeibacter europaeus
ref|WP_010509656.1|  hypothetical protein                             67.4    1e-09   Komagataeibacter europaeus
ref|XP_007914327.1|  putative tat pathway signal sequence domain-...  66.6    2e-09   Phaeoacremonium minimum UCRPA7
ref|XP_001395414.2|  hypothetical protein ANI_1_1672104               66.6    2e-09   Aspergillus niger CBS 513.88
gb|EHA25732.1|  hypothetical protein ASPNIDRAFT_50375                 66.2    2e-09   Aspergillus niger ATCC 1015
ref|WP_034400879.1|  translocation protein TolB                       65.5    2e-09   
gb|ETI58852.1|  hypothetical protein C100_22665                       65.1    5e-09   Sphingobium sp. C100
ref|WP_031310342.1|  hypothetical protein                             65.1    5e-09   Sphingobium sp. C100
gb|KEQ78669.1|  tricorn protease N-terminal domain-containing pro...  64.7    6e-09   Aureobasidium pullulans EXF-150
ref|WP_027978304.1|  hypothetical protein                             64.7    6e-09   
dbj|GAD95313.1|  hypothetical protein ANI_1_1672104                   64.7    6e-09   Byssochlamys spectabilis No. 5
ref|XP_007595649.1|  TOXD                                             64.7    7e-09   
ref|WP_043436880.1|  hypothetical protein                             64.7    7e-09   Streptomyces nodosus
gb|EKG10177.1|  Six-bladed beta-propeller TolB-like protein           64.3    9e-09   Macrophomina phaseolina MS6
ref|WP_041532010.1|  translocation protein TolB                       63.5    1e-08   
sp|Q3A097.2|TOLB_PELCD  RecName: Full=Protein TolB; Flags: Precursor  63.5    1e-08   Pelobacter carbinolicus DSM 2380
gb|KGO45093.1|  WD40-like Beta Propeller                              63.5    1e-08   Penicillium expansum
gb|ESZ89568.1|  hypothetical protein SBOR_10048                       63.5    1e-08   Sclerotinia borealis F-4128
gb|KGO53636.1|  WD40-like Beta Propeller                              63.5    1e-08   Penicillium expansum
gb|EKV04294.1|  hypothetical protein PDIP_88020                       63.5    2e-08   Penicillium digitatum Pd1
ref|XP_007835900.1|  hypothetical protein PFICI_09128                 63.5    2e-08   Pestalotiopsis fici W106-1
ref|WP_043399319.1|  tolB protein precursor protein                   62.8    2e-08   
ref|XP_007588104.1|  putative tat pathway signal sequence domain-...  63.2    2e-08   
dbj|GAM35983.1|  hypothetical protein TCE0_018f04727                  63.5    2e-08   Talaromyces cellulolyticus
ref|WP_037486764.1|  hypothetical protein                             63.2    2e-08   
emb|CAK46110.1|  unnamed protein product                              63.2    2e-08   Aspergillus niger
gb|EJK81239.1|  periplasmic component of the Tol biopolymer trans...  63.2    2e-08   Sphingobium sp. AP49
emb|CDM26673.1|  Six-bladed beta-propeller, TolB-like                 63.2    2e-08   Penicillium roqueforti FM164
gb|KEZ20905.1|  Periplasmic component of the Tol biopolymer trans...  63.2    2e-08   Sphingobium yanoikuyae
ref|WP_037517431.1|  hypothetical protein                             63.2    2e-08   Sphingobium yanoikuyae
gb|EQB54739.1|  hypothetical protein CGLO_05391                       62.8    2e-08   Colletotrichum gloeosporioides Cg-14
gb|KIL85442.1|  hypothetical protein FAVG1_11399                      62.8    3e-08   Fusarium avenaceum
ref|WP_025306923.1|  translocation protein TolB                       62.4    3e-08   Bdellovibrio bacteriovorus
ref|XP_007275047.1|  WD40 domain protein beta propeller               62.4    4e-08   
gb|EYE99209.1|  TolB, C-terminal domain-containing protein            62.4    4e-08   Aspergillus ruber CBS 135680
ref|WP_006403962.1|  hypothetical protein                             62.4    4e-08   Burkholderia multivorans
ref|WP_039218915.1|  hypothetical protein                             62.4    4e-08   Burkholderia multivorans
ref|WP_035954400.1|  hypothetical protein                             62.4    4e-08   Burkholderia multivorans
ref|WP_006399669.1|  hypothetical protein                             62.4    4e-08   Burkholderia multivorans
gb|KGO75694.1|  WD40-like Beta Propeller                              62.0    6e-08   Penicillium italicum
ref|WP_043262479.1|  hypothetical protein                             61.6    6e-08   Streptomyces sp. e14
gb|KIN05407.1|  hypothetical protein OIDMADRAFT_39656                 61.6    6e-08   Oidiodendron maius Zn
ref|WP_012872428.1|  peptidase S9 prolyl oligopeptidase active si...  61.6    7e-08   Sphaerobacter thermophilus
gb|EFF88542.1|  tat pathway signal sequence domain-containing pro...  61.6    7e-08   Streptomyces sp. e14
ref|WP_020475332.1|  hypothetical protein                             60.5    7e-08   Zavarzinella formosa
ref|WP_038036308.1|  translocation protein TolB                       61.2    8e-08   
gb|EKD68537.1|  Periplasmic component of the Tol biopolymer trans...  61.2    8e-08   uncultured bacterium
dbj|GAK58097.1|  WD40-like Beta Propeller                             61.2    8e-08   Candidatus Vecturithrix granuli
ref|XP_007828048.1|  hypothetical protein PFICI_01276                 61.2    9e-08   Pestalotiopsis fici W106-1
ref|WP_033378529.1|  MULTISPECIES: hypothetical protein               60.1    1e-07   
gb|EMS66234.1|  hypothetical protein TRIUR3_20351                     60.8    1e-07   Triticum urartu
gb|AHG92466.1|  WD40-like beta Propeller containing protein           60.8    1e-07   Gemmatirosa kalamazoonesis
ref|WP_040498617.1|  translocation protein TolB                       60.5    1e-07   
ref|XP_008082401.1|  DPP6 N-terminal                                  60.5    1e-07   
emb|CAI78611.1|  tolB protein                                         60.1    2e-07   
ref|WP_020383555.1|  hypothetical protein                             59.7    2e-07   
ref|WP_015838788.1|  translocation protein TolB                       60.1    2e-07   
ref|XP_003040341.1|  hypothetical protein NECHADRAFT_34811            60.1    2e-07   
ref|WP_012115032.1|  beta-propeller repeat-containing to-pal syst...  59.7    2e-07   
ref|WP_041872499.1|  translocation protein TolB                       59.7    2e-07   
ref|WP_015250253.1|  Tol biopolymer transport system periplasmic ...  59.3    3e-07   
ref|WP_015828440.1|  hypothetical protein                             59.7    3e-07   
ref|WP_020383554.1|  hypothetical protein                             59.3    3e-07   
ref|XP_002559211.1|  Pc13g07820                                       59.7    3e-07   
ref|WP_020383615.1|  hypothetical protein                             59.3    3e-07   
ref|WP_015754374.1|  translocation protein TolB                       58.9    3e-07   
ref|WP_041576117.1|  translocation protein TolB                       58.9    4e-07   
gb|AGH96540.1|  adventurous gliding motility protein W                58.9    4e-07   
gb|AIO73947.1|  hypothetical protein DM80_3777                        58.9    4e-07   
ref|WP_043201552.1|  hypothetical protein                             58.9    4e-07   
ref|WP_042305737.1|  hypothetical protein                             58.9    5e-07   
ref|WP_035474624.1|  hypothetical protein                             58.9    5e-07   
ref|WP_040198549.1|  translocation protein TolB                       58.5    5e-07   
gb|EDT09480.1|  hypothetical protein BgramDRAFT_3858                  58.9    5e-07   
ref|WP_044021394.1|  hypothetical protein                             58.9    5e-07   
dbj|GAK52271.1|  WD40-like Beta Propeller                             58.5    6e-07   
ref|WP_038454721.1|  hypothetical protein                             58.5    6e-07   
ref|WP_029968882.1|  hypothetical protein                             58.5    6e-07   
ref|XP_007912965.1|  putative peptidase s9 prolyl oligopeptidase ...  58.2    6e-07   
ref|WP_029877303.1|  translocation protein TolB                       58.2    7e-07   
ref|WP_029557867.1|  translocation protein TolB                       58.2    7e-07   
ref|WP_026842125.1|  translocation protein TolB                       58.2    7e-07   
ref|WP_035513763.1|  hypothetical protein                             58.5    7e-07   
ref|WP_015351870.1|  tolB protein                                     58.2    8e-07   
ref|WP_036514540.1|  translocation protein TolB                       58.2    8e-07   
ref|WP_027716026.1|  translocation protein TolB                       58.2    8e-07   
ref|WP_035992689.1|  hypothetical protein                             58.2    1e-06   
ref|XP_002378780.1|  hypothetical protein AFLA_060360                 55.8    1e-06   
emb|CBE67573.1|  Protein tolB precursor                               57.8    1e-06   
dbj|GAK49571.1|  WD40-like Beta Propeller                             57.4    1e-06   
ref|WP_041305462.1|  hypothetical protein                             55.5    1e-06   
ref|WP_043390602.1|  translocation protein TolB                       57.4    1e-06   
ref|WP_019872746.1|  hypothetical protein                             57.4    1e-06   
ref|WP_044595669.1|  hypothetical protein                             57.4    1e-06   
ref|WP_027818119.1|  hypothetical protein                             57.4    1e-06   
ref|WP_025779649.1|  hypothetical protein                             55.8    2e-06   
ref|WP_039744998.1|  translocation protein TolB                       57.0    2e-06   
ref|WP_036486026.1|  translocation protein TolB                       57.0    2e-06   
ref|XP_001827031.1|  hypothetical protein AOR_1_786034                57.0    2e-06   
gb|EIT83259.1|  hypothetical protein Ao3042_11485                     57.0    2e-06   
ref|WP_027211084.1|  hypothetical protein                             57.0    2e-06   
ref|XP_002385007.1|  conserved hypothetical protein                   56.6    2e-06   
ref|WP_012820041.1|  translocation protein TolB                       56.6    3e-06   
dbj|GAA92300.1|  tat pathway signal sequence domain-containing pr...  56.6    3e-06   
gb|EJQ51187.1|  hypothetical protein IEQ_02127                        53.9    3e-06   
ref|WP_041970151.1|  translocation protein TolB                       56.6    3e-06   
ref|WP_011582484.1|  translocation protein TolB                       56.2    3e-06   
gb|KCW45417.1|  hypothetical protein EUGRSUZ_L00885                   56.2    3e-06   
ref|WP_041318015.1|  translocation protein TolB                       56.2    3e-06   
ref|WP_043949727.1|  translocation protein TolB                       56.2    3e-06   
ref|WP_012632085.1|  translocation protein TolB                       56.2    4e-06   
dbj|GAK58088.1|  WD40-like Beta Propeller                             55.8    4e-06   
ref|WP_015089363.1|  adventurous gliding motility protein W           55.8    4e-06   
ref|WP_011162787.1|  translocation protein TolB                       55.8    4e-06   
ref|WP_038321358.1|  hypothetical protein                             55.8    4e-06   
gb|AHB48417.1|  translocation protein TolB                            55.8    4e-06   
ref|WP_040479380.1|  translocation protein TolB                       55.8    4e-06   
gb|EMS34061.1|  tolB protein precursor, periplasmic protein invol...  55.8    4e-06   
ref|WP_012814216.1|  WD40 domain-containing protein beta Propeller    55.5    4e-06   
ref|WP_029131120.1|  translocation protein TolB                       55.8    5e-06   
ref|XP_001391151.1|  hypothetical protein ANI_1_1414064               55.8    5e-06   
ref|WP_019387844.1|  hypothetical protein                             55.5    5e-06   
ref|WP_011419718.1|  translocation protein TolB                       55.8    5e-06   
ref|WP_026091053.1|  translocation protein TolB                       55.5    5e-06   
gb|KGO38400.1|  WD40-like Beta Propeller                              55.8    5e-06   
gb|EPX63167.1|  tolB protein precursor, periplasmic protein           55.5    5e-06   
gb|EHA23695.1|  hypothetical protein ASPNIDRAFT_180130                55.8    6e-06   
ref|WP_043429512.1|  translocation protein TolB                       55.5    6e-06   
gb|EYE95611.1|  dipeptidyl peptidase IV/CD26, N-terminal domain-c...  55.8    6e-06   
ref|WP_037237294.1|  translocation protein TolB                       55.5    6e-06   
ref|WP_004513696.1|  translocation protein TolB                       55.5    6e-06   
ref|WP_015718924.1|  translocation protein TolB                       55.1    6e-06   
gb|EQB62921.1|  hypothetical protein RBG1_1C00001G0500                55.5    6e-06   
ref|WP_029638152.1|  translocation protein TolB                       55.5    7e-06   
ref|WP_033198113.1|  WD40 domain protein beta propeller               54.7    7e-06   
ref|WP_012169055.1|  twin-arginine translocation pathway signal       55.1    7e-06   
ref|WP_030890272.1|  amidohydrolase                                   55.5    7e-06   
ref|WP_013942199.1|  translocation protein TolB                       55.1    7e-06   
gb|ABX03625.1|  WD40 domain protein beta Propeller                    54.7    8e-06   
ref|WP_043623202.1|  translocation protein TolB                       55.1    8e-06   
ref|WP_034806253.1|  translocation protein TolB                       55.1    8e-06   
ref|WP_002638920.1|  translocation protein TolB                       55.1    8e-06   
ref|WP_028198811.1|  MULTISPECIES: translocation protein TolB         55.1    8e-06   
ref|WP_012524762.1|  translocation protein TolB                       55.1    8e-06   
gb|EKG09397.1|  Six-bladed beta-propeller TolB-like protein           55.1    9e-06   
ref|WP_012531942.1|  translocation protein TolB                       54.7    1e-05   
ref|WP_038249710.1|  translocation protein TolB precursor             54.7    1e-05   
ref|WP_013561503.1|  hypothetical protein                             52.4    1e-05   
ref|WP_020384321.1|  hypothetical protein                             54.3    1e-05   
ref|WP_012913049.1|  biopolymer transporter Tol                       54.3    1e-05   
ref|WP_027677959.1|  translocation protein TolB                       54.7    1e-05   
ref|WP_018288388.1|  hypothetical protein                             54.3    1e-05   
emb|CDM38061.1|  Peptidase S41A/B                                     54.7    1e-05   
ref|XP_002556702.1|  Pc06g00930                                       54.7    1e-05   
emb|CDW55127.1|  M28 family aminopeptidase                            54.3    1e-05   
ref|WP_033712222.1|  hypothetical protein                             52.0    1e-05   
ref|WP_042817046.1|  hypothetical protein                             52.4    1e-05   
ref|WP_020384320.1|  hypothetical protein                             53.9    2e-05   
ref|WP_013216379.1|  Tol-Pal system beta propeller repeat protein...  54.3    2e-05   
ref|WP_038283157.1|  translocation protein TolB                       54.3    2e-05   
dbj|BAE62265.1|  unnamed protein product                              53.9    2e-05   
ref|WP_012831477.1|  hypothetical protein                             53.9    2e-05   
gb|EGL66673.1|  translocation protein                                 53.9    2e-05   
ref|WP_024976357.1|  translocation protein TolB                       53.9    2e-05   
dbj|GAK32694.1|  protein TolB                                         53.9    2e-05   
ref|WP_042084170.1|  translocation protein TolB                       53.9    2e-05   
ref|WP_013226661.1|  translocation protein TolB                       54.3    2e-05   
ref|WP_010973273.1|  MULTISPECIES: translocation protein TolB         53.9    2e-05   
gb|EMD82160.1|  TolB protein precursor                                53.9    2e-05   
dbj|BAL54994.1|  TolB protein                                         53.5    2e-05   
ref|WP_036339033.1|  peptidase S9                                     54.3    2e-05   
ref|WP_041540340.1|  hypothetical protein                             53.9    2e-05   
ref|WP_000615434.1|  hypothetical protein                             53.5    2e-05   
ref|WP_041128605.1|  hypothetical protein                             53.9    2e-05   
gb|ACU72811.1|  WD40 domain protein beta Propeller                    53.9    2e-05   
ref|WP_013965468.1|  biopolymer transporter Tol                       53.5    2e-05   
gb|EME43010.1|  hypothetical protein DOTSEDRAFT_153255                53.9    2e-05   
ref|WP_039630763.1|  amidohydrolase                                   53.9    2e-05   
gb|KFB74184.1|  translocation protein TolB                            53.5    2e-05   
ref|WP_031079260.1|  hypothetical protein                             53.5    2e-05   
gb|EKD48773.1|  WD40 protein                                          52.4    2e-05   
ref|WP_007678383.1|  TolB protein                                     52.4    2e-05   
dbj|GAM34283.1|  hypothetical protein TCE0_015r01756                  53.9    2e-05   
ref|WP_035459582.1|  translocation protein TolB                       53.5    2e-05   
ref|WP_013647916.1|  biopolymer transporter Tol                       53.5    3e-05   
ref|WP_043415676.1|  translocation protein TolB                       52.0    3e-05   
ref|WP_009208751.1|  tolB protein, periplasmic component, biopoly...  53.5    3e-05   
ref|WP_025547701.1|  MULTISPECIES: amidohydrolase                     53.9    3e-05   
ref|WP_022563044.1|  Protein tolB precursor                           53.5    3e-05   
ref|WP_020258740.1|  hypothetical protein                             53.1    3e-05   
ref|WP_041978883.1|  hypothetical protein                             53.1    3e-05   
ref|WP_017593807.1|  hypothetical protein                             53.5    3e-05   
ref|WP_015598832.1|  translocation protein TolB                       53.5    3e-05   
emb|CDM66426.1|  periplasmic component of the Tol biopolymer tran...  53.1    3e-05   
ref|WP_024348846.1|  translocation protein TolB                       53.5    3e-05   
ref|WP_030046841.1|  amidohydrolase                                   53.5    3e-05   
gb|KEQ90378.1|  hypothetical protein AUEXF2481DRAFT_48749             53.5    3e-05   
ref|WP_011634434.1|  biopolymer transporter Tol                       53.1    3e-05   
ref|WP_006697167.1|  MULTISPECIES: translocation protein TolB         53.1    3e-05   
ref|WP_034909284.1|  hypothetical protein                             53.1    3e-05   
ref|WP_004445729.1|  MULTISPECIES: tol-pal system beta propeller ...  53.1    3e-05   
ref|WP_022730350.1|  translocation protein TolB                       53.1    3e-05   
gb|EKD55533.1|  WD40-like protein Beta Propeller                      53.5    3e-05   
ref|WP_023399162.1|  periplasmic component of the Tol biopolymer ...  53.1    3e-05   
ref|WP_003511387.1|  MULTISPECIES: translocation protein TolB         53.1    3e-05   
ref|WP_044195994.1|  translocation protein TolB                       53.1    4e-05   
ref|WP_010301185.1|  translocation protein TolB                       53.1    4e-05   
ref|WP_018430011.1|  translocation protein TolB                       53.1    4e-05   
ref|WP_028462212.1|  biopolymer transporter Tol                       52.8    4e-05   
gb|ABK16453.1|  TolB, N-terminal domain protein                       53.1    4e-05   
ref|WP_041569562.1|  hypothetical protein                             52.8    4e-05   
gb|ADY66818.1|  protein tolB precursor                                53.1    4e-05   
ref|WP_021327580.1|  Periplasmic component of the Tol biopolymer ...  52.8    4e-05   
ref|WP_041441646.1|  hypothetical protein                             52.8    4e-05   
ref|WP_026310348.1|  translocation protein TolB                       52.8    4e-05   
ref|WP_020402308.1|  hypothetical protein                             53.1    4e-05   
ref|WP_020381447.1|  hypothetical protein                             52.8    4e-05   
ref|XP_001402352.2|  hypothetical protein ANI_1_2284184               52.8    4e-05   
ref|WP_028318597.1|  hypothetical protein                             52.8    4e-05   
ref|WP_044188701.1|  tolB protein precursor protein                   52.8    4e-05   
ref|WP_026364039.1|  MULTISPECIES: translocation protein TolB         52.8    5e-05   
ref|WP_003506242.1|  translocation protein TolB                       52.8    5e-05   
ref|WP_003523242.1|  translocation protein TolB                       52.8    5e-05   
gb|AFE10511.1|  beta-propeller repeat-containing to-pal system pr...  52.8    5e-05   
ref|WP_043322405.1|  tolB protein precursor protein                   52.8    5e-05   
ref|WP_036546999.1|  hypothetical protein                             52.0    5e-05   
gb|AIE98934.1|  WD40-like beta propeller repeat-containing protei...  52.8    5e-05   
ref|WP_011644353.1|  TolB domain-containing protein                   52.8    5e-05   
ref|WP_036348216.1|  translocation protein TolB                       52.8    5e-05   
ref|WP_022817416.1|  translocation protein TolB                       53.1    5e-05   
ref|WP_009206534.1|  translocation protein TolB                       52.8    5e-05   
ref|WP_034773558.1|  acyl-peptide hydrolase                           52.8    5e-05   
ref|WP_006923442.1|  protein tolB                                     52.8    5e-05   
ref|WP_007068778.1|  translocation protein TolB precursor             52.8    5e-05   
gb|KFL22228.1|  Tol-Pal system beta propeller repeat protein TolB     52.4    5e-05   
ref|WP_043539896.1|  translocation protein TolB                       52.8    5e-05   
ref|WP_028033593.1|  translocation protein TolB                       52.4    6e-05   
gb|EMS64086.1|  hypothetical protein TRIUR3_16989                     50.8    6e-05   
gb|AEP11793.1|  Periplasmic component of the Tol biopolymer trans...  52.4    6e-05   
ref|WP_021195229.1|  translocation protein TolB                       52.4    6e-05   
emb|CAK39055.1|  unnamed protein product                              52.8    6e-05   
ref|WP_044582157.1|  amidohydrolase                                   52.8    6e-05   
emb|CDR12943.1|  amidohydrolase                                       52.8    6e-05   
ref|WP_011555707.1|  translocation protein TolB                       52.4    6e-05   
ref|WP_004629511.1|  MULTISPECIES: translocation protein TolB         52.4    7e-05   
ref|WP_018387689.1|  translocation protein TolB                       52.4    7e-05   
ref|WP_031076728.1|  hypothetical protein                             52.4    7e-05   
ref|WP_006726830.1|  translocation protein TolB                       52.4    7e-05   
ref|WP_041691535.1|  hypothetical protein                             52.0    7e-05   
ref|WP_024973366.1|  translocation protein TolB                       52.4    7e-05   
ref|WP_040974366.1|  translocation protein TolB                       52.4    7e-05   
ref|WP_009238839.1|  MULTISPECIES: translocation protein TolB         52.4    7e-05   
ref|WP_012761463.1|  translocation protein TolB                       52.4    7e-05   
ref|WP_020383553.1|  hypothetical protein                             52.0    7e-05   
ref|WP_021939782.1|  hypothetical protein                             52.4    7e-05   
ref|WP_035715065.1|  translocation protein TolB                       52.4    7e-05   
ref|WP_004294074.1|  peptidase S41                                    52.4    7e-05   
ref|WP_004288342.1|  peptidase S41                                    52.4    7e-05   
gb|ACC98829.1|  Putative component of the Tol biopolymer transpor...  52.4    7e-05   
ref|WP_039597900.1|  translocation protein TolB                       52.0    7e-05   
ref|WP_041870461.1|  hypothetical protein                             52.0    7e-05   
ref|WP_031448221.1|  translocation protein TolB                       52.0    7e-05   
gb|ABF42485.1|  WD40-like beta Propeller                              52.0    7e-05   
ref|WP_035022023.1|  MULTISPECIES: translocation protein TolB         52.0    8e-05   
ref|WP_041856891.1|  hypothetical protein                             52.0    8e-05   
ref|WP_022307748.1|  uncharacterized protein                          52.4    8e-05   
ref|WP_029661797.1|  hypothetical protein                             52.0    8e-05   
ref|WP_041726769.1|  hypothetical protein                             51.6    8e-05   
gb|KJF66339.1|  translocation protein TolB                            52.0    8e-05   
ref|WP_040095900.1|  translocation protein TolB                       52.0    9e-05   
ref|WP_039939491.1|  amidohydrolase                                   51.6    9e-05   
ref|WP_035047731.1|  translocation protein TolB                       52.0    9e-05   
gb|KJF73262.1|  translocation protein TolB                            52.0    9e-05   



>ref|XP_009617529.1| PREDICTED: uncharacterized protein LOC104109859 [Nicotiana tomentosiformis]
Length=700

 Score =   277 bits (708),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 149/171 (87%), Gaps = 4/171 (2%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            EL+GG I QLT+G WIDTMPSWSPDGKLIAFSSNRHNP N  CFSIYVV PDGTGLRRIH
Sbjct  531  ELEGGEICQLTEGPWIDTMPSWSPDGKLIAFSSNRHNPDNITCFSIYVVHPDGTGLRRIH  590

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            VAG EGS+EV++ERLNHVCFS D EW+LFTANLGGVTAEPVS+PNQ+QPYGDLY+++LDG
Sbjct  591  VAGPEGSDEVDKERLNHVCFSKDCEWLLFTANLGGVTAEPVSLPNQYQPYGDLYLVKLDG  650

Query  224  TGLQGLTWNGYENGTPAWHPKA--EVDLARLSLGKSGEKLRGKFDEPLWIN  78
            +GLQ LTWNGYENGTPAWHP A   VD+ R  L   G+KLRG+FD+ LW+N
Sbjct  651  SGLQRLTWNGYENGTPAWHPSATITVDVKRSLL--VGDKLRGEFDDVLWMN  699



>ref|XP_009773068.1| PREDICTED: uncharacterized protein LOC104223342 [Nicotiana sylvestris]
Length=663

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            EL+GG IRQLT G WIDTMPSWSPDGKLIAFSSNRHNP N  CFSIYVV PDGTGLRRI+
Sbjct  494  ELEGGEIRQLTKGPWIDTMPSWSPDGKLIAFSSNRHNPDNITCFSIYVVHPDGTGLRRIY  553

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            VAG EGS+E ++ERLNHVCFS D EW+LFTANLGGVTAEPVS+PNQ+QPYGDLY+++LDG
Sbjct  554  VAGPEGSDEADKERLNHVCFSKDCEWLLFTANLGGVTAEPVSLPNQYQPYGDLYLVKLDG  613

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            +GLQ LTWNGYENGTPAWHP A   +        G+KLRG+FD+ LW+N
Sbjct  614  SGLQRLTWNGYENGTPAWHPSATTTVEVKRSLLVGDKLRGEFDDVLWMN  662



>ref|XP_002279803.1| PREDICTED: uncharacterized protein LOC100264112 [Vitis vinifera]
Length=677

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GGIRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N + FSIYV+RPDG+ LRR++VAG+
Sbjct  509  GGIRQLTEGPWIDTMPSWSPDGKLIAFSSNRHNPDNLNAFSIYVIRPDGSDLRRVYVAGS  568

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS +V+RER+NHVCFS+D EW+LF ANLGG+TAEP+S+PNQFQPYGDL+++RLDG+GL+
Sbjct  569  EGSVDVDRERINHVCFSADCEWLLFAANLGGMTAEPISLPNQFQPYGDLFVVRLDGSGLK  628

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLG-KSGEKLRGKFDEPLWINSDF  69
             LTWNGYENGTPAWH   EVD+ R+ LG ++G+KL G+FDEPLWI+ + 
Sbjct  629  RLTWNGYENGTPAWHTGNEVDMGRMCLGSENGDKLTGEFDEPLWISCEL  677



>emb|CAN71280.1| hypothetical protein VITISV_027089 [Vitis vinifera]
Length=677

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GGIRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N + FSIYV+RPDG+ LRR++VAG+
Sbjct  509  GGIRQLTEGXWIDTMPSWSPDGKLIAFSSNRHNPDNLNAFSIYVIRPDGSDLRRVYVAGS  568

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS +V+RER+NHVCFS+D EW+LF ANLGG TAEP+S+PNQFQPYGDL+++RLDG+GL+
Sbjct  569  EGSVDVDRERINHVCFSADCEWLLFAANLGGXTAEPISLPNQFQPYGDLFVVRLDGSGLK  628

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLG-KSGEKLRGKFDEPLWINSDF  69
             LTWNGYENGTPAWH   EVD+ R+ LG ++G+KL G+FDEPLWI+ + 
Sbjct  629  RLTWNGYENGTPAWHTGNEVDMGRMCLGSENGDKLTGEFDEPLWISCEL  677



>gb|KDO86848.1| hypothetical protein CISIN_1g039497mg [Citrus sinensis]
Length=642

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            G IRQLTDG WIDTMPSWSP G LIAFSSNRHNP N + FS+YV++PDG+GLRRIHVAG 
Sbjct  474  GDIRQLTDGPWIDTMPSWSPKGDLIAFSSNRHNPDNVEAFSLYVIKPDGSGLRRIHVAGP  533

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS +V+RER+NHVCFS+D EW+LFTANLG V AEPVS PNQFQPYGDLY+++LDG+GL+
Sbjct  534  EGSGDVDRERINHVCFSADGEWLLFTANLGAVMAEPVSWPNQFQPYGDLYVVKLDGSGLR  593

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFDEPLWINSDF  69
             LTWNGYENGTPAWHP  ++DL +L L    G+KLRG+FDEPLWI+ DF
Sbjct  594  RLTWNGYENGTPAWHPGNQLDLGKLRLEDDIGDKLRGQFDEPLWISCDF  642



>ref|XP_006492392.1| PREDICTED: uncharacterized protein LOC102621537 [Citrus sinensis]
Length=700

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            G IRQLTDG WIDTMPSWSP G LIAFSSNRHNP N + FS+YV++PDG+GLRRIHVAG 
Sbjct  532  GDIRQLTDGPWIDTMPSWSPKGDLIAFSSNRHNPDNVEAFSLYVIKPDGSGLRRIHVAGP  591

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS +V+RER+NHVCFS+D EW+LFTANLG V AEPVS PNQFQPYGDLY+++LDG+GL+
Sbjct  592  EGSGDVDRERINHVCFSADGEWLLFTANLGAVMAEPVSWPNQFQPYGDLYVVKLDGSGLR  651

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFDEPLWINSDF  69
             LTWNGYENGTPAWHP  ++DL +L L    G+KLRG+FDEPLWI+ DF
Sbjct  652  RLTWNGYENGTPAWHPGNQLDLGKLRLEDDIGDKLRGQFDEPLWISCDF  700



>ref|XP_006444588.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
 gb|ESR57828.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
Length=700

 Score =   271 bits (692),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            G IRQLTDG WIDTMPSWSP G LIAFSSNRHNP N + FS+YV++PDG+GLRRIHVAG 
Sbjct  532  GDIRQLTDGPWIDTMPSWSPKGDLIAFSSNRHNPDNVEAFSLYVIKPDGSGLRRIHVAGP  591

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS +V+RER+NHVCFS+D EW+LFTANLG V AEPVS PNQFQPYGDLY+++LDG+GL+
Sbjct  592  EGSGDVDRERINHVCFSADGEWLLFTANLGAVMAEPVSWPNQFQPYGDLYVVKLDGSGLR  651

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFDEPLWINSDF  69
             LTWNGYENGTPAWHP  ++DL +L L    G+KLRG+FDEPLWI+ DF
Sbjct  652  RLTWNGYENGTPAWHPGNQLDLGKLRLEDDIGDKLRGQFDEPLWISCDF  700



>ref|XP_006355827.1| PREDICTED: uncharacterized protein LOC102591696 [Solanum tuberosum]
Length=698

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 149/172 (87%), Gaps = 4/172 (2%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            EL+GGGIRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N  CFSIYV+ P+GTGLRRIH
Sbjct  527  ELEGGGIRQLTEGPWIDTMPSWSPDGKLIAFSSNRHNPDNVTCFSIYVIHPNGTGLRRIH  586

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            VAG EGS+EV++ERLNHVCFS D EW+LFT NLGGVTAEPVS+PNQ+QPYGDLY+++LDG
Sbjct  587  VAGPEGSDEVDKERLNHVCFSKDCEWLLFTGNLGGVTAEPVSLPNQYQPYGDLYLVKLDG  646

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSLGKS---GEKLRGKFDEPLWIN  78
            +GL+ LT N YENGTPAWHP A + +  L + ++   G+KLRG+FD+ LW+N
Sbjct  647  SGLRRLTCNAYENGTPAWHPSA-MPMTALDIERNVIVGDKLRGEFDDVLWMN  697



>ref|XP_004240561.1| PREDICTED: uncharacterized protein LOC101263710 [Solanum lycopersicum]
Length=697

 Score =   268 bits (686),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 147/173 (85%), Gaps = 6/173 (3%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            EL+GGGIRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N  CFSIYV+ P+GTGLRRIH
Sbjct  526  ELEGGGIRQLTEGPWIDTMPSWSPDGKLIAFSSNRHNPDNVTCFSIYVIHPNGTGLRRIH  585

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            VAG EGS+EV++ERLNHVCFS D EW+LFT NLGGVTAEPVS+PNQ+QPYGDLY+++LDG
Sbjct  586  VAGPEGSDEVDKERLNHVCFSKDCEWLLFTGNLGGVTAEPVSLPNQYQPYGDLYLVKLDG  645

Query  224  TGLQGLTWNGYENGTPAWHPK----AEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            +GL+ LT N YENGTPAWHP       +D+ R  +   G+KLRG+FD+ LW+N
Sbjct  646  SGLRQLTCNAYENGTPAWHPSGTPMTALDIERNVI--VGDKLRGEFDDVLWMN  696



>gb|KCW58166.1| hypothetical protein EUGRSUZ_H00884 [Eucalyptus grandis]
Length=658

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 147/172 (85%), Gaps = 4/172 (2%)
 Frame = -1

Query  575  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  396
            GGGIRQLTDG WIDTMPSWSP+G LIAFSSNRHNP N + FSIY+++PDG+GLRR+HVAG
Sbjct  486  GGGIRQLTDGPWIDTMPSWSPNGDLIAFSSNRHNPDNVNAFSIYLIKPDGSGLRRVHVAG  545

Query  395  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  216
             EGS EV+RER+NHVCFS D EW+LFTANLGGVTAEPVS PNQFQPYG+LY++RLDG+GL
Sbjct  546  PEGSPEVDRERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQFQPYGELYVVRLDGSGL  605

Query  215  QGLTWNGYENGTPAWHPKAEVDLARLSLGKS----GEKLRGKFDEPLWINSD  72
            Q LTWNG+ENGTPAWH   +V  + L  G S    G+KLRG+F+EPLWI+ D
Sbjct  606  QRLTWNGFENGTPAWHSSDDVSPSDLRSGISEDWDGDKLRGQFEEPLWISCD  657



>ref|XP_010069735.1| PREDICTED: uncharacterized protein LOC104456605 [Eucalyptus grandis]
Length=702

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 147/172 (85%), Gaps = 4/172 (2%)
 Frame = -1

Query  575  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  396
            GGGIRQLTDG WIDTMPSWSP+G LIAFSSNRHNP N + FSIY+++PDG+GLRR+HVAG
Sbjct  530  GGGIRQLTDGPWIDTMPSWSPNGDLIAFSSNRHNPDNVNAFSIYLIKPDGSGLRRVHVAG  589

Query  395  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  216
             EGS EV+RER+NHVCFS D EW+LFTANLGGVTAEPVS PNQFQPYG+LY++RLDG+GL
Sbjct  590  PEGSPEVDRERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQFQPYGELYVVRLDGSGL  649

Query  215  QGLTWNGYENGTPAWHPKAEVDLARLSLGKS----GEKLRGKFDEPLWINSD  72
            Q LTWNG+ENGTPAWH   +V  + L  G S    G+KLRG+F+EPLWI+ D
Sbjct  650  QRLTWNGFENGTPAWHSSDDVSPSDLRSGISEDWDGDKLRGQFEEPLWISCD  701



>ref|XP_002515212.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47196.1| conserved hypothetical protein [Ricinus communis]
Length=666

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GGIRQLT+G WIDTMPSWSP G LIAFSSNRHNP N + FSIYV+RPDG+GL+RIHVAG+
Sbjct  498  GGIRQLTEGPWIDTMPSWSPKGDLIAFSSNRHNPNNVNAFSIYVIRPDGSGLKRIHVAGS  557

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS E  R R+NHVCFS D EW+LFT NLG VTAEPVS PNQFQPYGDL++ RLDG+GL 
Sbjct  558  EGSSEGERGRINHVCFSRDGEWLLFTGNLGSVTAEPVSWPNQFQPYGDLHVTRLDGSGLS  617

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLGKSGE-KLRGKFDEPLWINSD  72
             LTWNG+ENGTPAWHP++E++L  L L +  E KL G+FD+PLWIN D
Sbjct  618  RLTWNGFENGTPAWHPRSELELDSLCLDEDVEDKLTGQFDDPLWINCD  665



>ref|XP_007051240.1| TolB protein-related isoform 1 [Theobroma cacao]
 gb|EOX95397.1| TolB protein-related isoform 1 [Theobroma cacao]
Length=704

 Score =   260 bits (665),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GGIR+LTDG WIDTMPSWSP G LIAFSSN HNP   D FSIYV++PDG+ LRRI VAG 
Sbjct  535  GGIRKLTDGPWIDTMPSWSPSGDLIAFSSNMHNPDRVDAFSIYVIKPDGSDLRRIFVAGP  594

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
             GS +V+RER+NHVCFS D EW+LF  N+GGVT EPVS PNQFQPYGDLY++RLDG+GL+
Sbjct  595  RGSSDVDRERINHVCFSQDGEWLLFATNIGGVTVEPVSWPNQFQPYGDLYVVRLDGSGLR  654

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLG-KSGEKLRGKFDEPLWINSDF  69
             LTWNG+ENGTPAWHP +E+D+ RL LG ++G KL+G F+EPLWI  DF
Sbjct  655  RLTWNGFENGTPAWHPWSELDMGRLCLGNEAGVKLKGDFEEPLWITCDF  703



>ref|XP_009382467.1| PREDICTED: uncharacterized protein LOC103970421 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E  GGG+R+LT+G WIDTMP WSPDG+LIAFSSNRH+P N D F IY+VRPDGTGLRR+H
Sbjct  483  ETSGGGVRRLTEGEWIDTMPVWSPDGELIAFSSNRHDPSNPDVFGIYLVRPDGTGLRRVH  542

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            VAG  GS EV RERLNHVCFS DS W++F ANLG VTAEPVS+PN FQPYGDLY  RLDG
Sbjct  543  VAGPPGSAEVGRERLNHVCFSPDSRWLVFAANLGAVTAEPVSLPNHFQPYGDLYACRLDG  602

Query  224  TGLQGLTWNGYENGTPAWHPKAEV-DLARLSLGKS-GEKLRGKFDEPLWINSD  72
            TGL  LT+N YENGTP WH   +V  L  LSLG   GEKLRG+FDEPLWI  D
Sbjct  603  TGLTRLTYNCYENGTPTWHSGGDVPSLGSLSLGPHVGEKLRGQFDEPLWITFD  655



>gb|KCW58167.1| hypothetical protein EUGRSUZ_H008852, partial [Eucalyptus grandis]
Length=276

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GGIRQLTDG WIDTMPSWSP+  LIAFSSNRHN G+A  FSIY++RPDG+ LRR+H+AG 
Sbjct  105  GGIRQLTDGPWIDTMPSWSPNNDLIAFSSNRHNSGDASTFSIYLIRPDGSDLRRVHLAGP  164

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS EV+RER+NHVCFS D EW+LFTANLGGVTAEPVS PNQFQPYG+LY+ RLDG+GL+
Sbjct  165  EGSPEVDRERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQFQPYGELYVARLDGSGLK  224

Query  212  GLTWNGYENGTPAWHPKAEVDL----ARLSLGKSGEKLRGKFDEPLWINSDF  69
             LTWNG+ENGTPAWH    V L    +    G   +KLRG+F+EPLWI+ + 
Sbjct  225  RLTWNGFENGTPAWHSTHAVGLGDPWSATGEGWDEDKLRGQFEEPLWISCNI  276



>ref|XP_006396377.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
 gb|ESQ37830.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
Length=601

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -1

Query  569  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  390
            GIR+LTDG WIDTMP WSP G LI FSSNRHNP N + F +YVVRPDG+GLRRI VAG E
Sbjct  434  GIRRLTDGPWIDTMPCWSPKGDLIGFSSNRHNPANTEAFGVYVVRPDGSGLRRIQVAGPE  493

Query  389  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQG  210
            GSEE  RER+NHV F+ D +W++FTANLGGV AEPV++PNQFQPYG+LY+++LDGTGL+ 
Sbjct  494  GSEEAARERVNHVSFNKDGDWLVFTANLGGVMAEPVAMPNQFQPYGELYVVKLDGTGLRR  553

Query  209  LTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  69
            LTWNGYENGTP WH   +VDL++LSL G+ G+KL G+F+EPLWI+ D 
Sbjct  554  LTWNGYENGTPTWHTVDDVDLSQLSLNGQDGDKLEGQFEEPLWISCDI  601



>ref|XP_008461387.1| PREDICTED: uncharacterized protein LOC103499982 [Cucumis melo]
Length=647

 Score =   256 bits (654),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            G +R+LTDGAWIDTMP+WSP G LI FSSN HNP N + FSIYV+RPDG+GLRR++VAG 
Sbjct  479  GELRRLTDGAWIDTMPNWSPRGDLIVFSSNMHNPKNTEAFSIYVIRPDGSGLRRVYVAGP  538

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS EV+RER+NHVCFS D +W+LFTANL GVTAEPVS PNQFQPYGDL+++RLDGTGL 
Sbjct  539  EGSSEVDRERINHVCFSRDGKWLLFTANLSGVTAEPVSWPNQFQPYGDLFVVRLDGTGLS  598

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLGKS--GEKLRGKFDEPLWINSD  72
             LTWNGYENGTP W+  +EV L+ LSL     GEKL+G FDEPLWI  D
Sbjct  599  RLTWNGYENGTPTWYYGSEVALSGLSLKDEVVGEKLKGNFDEPLWITFD  647



>ref|XP_002872871.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49130.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
Length=652

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 144/173 (83%), Gaps = 1/173 (1%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E +GGGIR+LT+G WIDTMP WSP G LI FSSNRHNP N D F  YVVRPDG+GLRRI 
Sbjct  480  ESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPANIDAFGAYVVRPDGSGLRRIL  539

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            ++G EGSEE  RER+NHV F+ D +W++FTANL G+TAEPV++PNQFQPYGDLY+++LDG
Sbjct  540  ISGPEGSEEAARERVNHVSFNKDGDWLVFTANLCGITAEPVAMPNQFQPYGDLYVVKLDG  599

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  69
            TGL+ LTWNGYE+GTP WH   E+DL+R+SL G+ G+KL G+F+EPLWI+ D 
Sbjct  600  TGLRRLTWNGYEDGTPTWHTADELDLSRMSLNGQDGDKLDGQFEEPLWISCDI  652



>ref|XP_010270927.1| PREDICTED: uncharacterized protein LOC104607107, partial [Nelumbo 
nucifera]
Length=715

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 143/171 (84%), Gaps = 4/171 (2%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GGIRQLTDG WIDTMP+WSPDGKLI FSSNRHNP N + FSIY++RPDGT LRR++VAG 
Sbjct  544  GGIRQLTDGPWIDTMPNWSPDGKLIVFSSNRHNPSNVEAFSIYLIRPDGTDLRRVYVAGV  603

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS E  RER+NHVCFS DS W++FTANLGGV  EPVS+PNQFQPYGDLY++RLDG+GL+
Sbjct  604  EGSAEAERERINHVCFSPDSLWLVFTANLGGVLTEPVSMPNQFQPYGDLYVVRLDGSGLK  663

Query  212  GLTWNGYENGTPAWHP---KAEVDLARLSLGK-SGEKLRGKFDEPLWINSD  72
             LTWNGYENGTP W+    + ++D+ RLS+    G++L G+FDEPLWI+ D
Sbjct  664  RLTWNGYENGTPTWNSTTGEMDMDMDRLSVETVVGDRLMGQFDEPLWISCD  714



>gb|EYU46868.1| hypothetical protein MIMGU_mgv1a002606mg [Erythranthe guttata]
Length=654

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 144/175 (82%), Gaps = 7/175 (4%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            EL+GG +RQLTDG WIDTMPSWSPDGKLIAFSSNRHNP N   F IY+V P+G G+RR+ 
Sbjct  484  ELEGGMVRQLTDGNWIDTMPSWSPDGKLIAFSSNRHNPENEGAFGIYLVEPNGKGVRRVQ  543

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            VA  E  EE  RERLNHVCFS+D EW+LFT+NLGGVTAEPVSIPNQFQPYGD+Y++RLDG
Sbjct  544  VAVIE--EE--RERLNHVCFSADGEWLLFTSNLGGVTAEPVSIPNQFQPYGDMYLVRLDG  599

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSL--GKSGE-KLRGKFDEPLWINSDF  69
            +GLQ LTWNGYENGTPAWHP   + L+ LSL   K GE KL+G+FDEPLWI  D 
Sbjct  600  SGLQRLTWNGYENGTPAWHPTPGLSLSALSLEGNKDGEDKLKGQFDEPLWILCDL  654



>ref|XP_004240512.1| PREDICTED: uncharacterized protein LOC101247825 [Solanum lycopersicum]
Length=660

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 146/176 (83%), Gaps = 12/176 (7%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E++GG +RQLT+GAWIDTMP+WSPDGKLIAFSSNRHNP + + FSIYVV PDG+GLRRI+
Sbjct  487  EMEGGEVRQLTNGAWIDTMPNWSPDGKLIAFSSNRHNPNDINRFSIYVVHPDGSGLRRIY  546

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            VAG EGSEEV++ERLNHVCFS DSEW+LFT NL GVTAEPVS+PNQFQPYGDLY+++LDG
Sbjct  547  VAGPEGSEEVDKERLNHVCFSKDSEWLLFTGNLSGVTAEPVSLPNQFQPYGDLYVVKLDG  606

Query  224  TGLQGLTWNGYENGTPAWHPKA--------EVDLARLSLGKSGEKLRGKFDEPLWI  81
            +GL+ LT NGYENGTPAWHP          E + + L     GEKL+G+FD+ LW+
Sbjct  607  SGLRRLTCNGYENGTPAWHPSTMPMETTAGETERSVL----VGEKLKGEFDDLLWM  658



>ref|XP_006366666.1| PREDICTED: uncharacterized protein LOC102589112 [Solanum tuberosum]
Length=658

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 146/174 (84%), Gaps = 8/174 (5%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E++GG IRQLT+GAWIDTMP+WSPDGKLIAFSSN HNP + +CFSIYVV PDG+GLRRI+
Sbjct  485  EMEGGEIRQLTNGAWIDTMPNWSPDGKLIAFSSNMHNPDDINCFSIYVVHPDGSGLRRIY  544

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            VAG EGSEEV++ERLNHVCFS DSEW+LFT NL GVTAEPVS+PNQFQPYGDLY+++LDG
Sbjct  545  VAGPEGSEEVDKERLNHVCFSKDSEWLLFTGNLSGVTAEPVSLPNQFQPYGDLYVVKLDG  604

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSLGKS------GEKLRGKFDEPLWI  81
            +GL+ LT NGYENGTPAWH  +       + G++      GEKL+G+FD+ LW+
Sbjct  605  SGLRRLTCNGYENGTPAWH--SSTMPMETTTGETERNVLVGEKLKGEFDDVLWM  656



>ref|NP_192096.1| tolB-related protein [Arabidopsis thaliana]
 gb|AAD22649.1|AC007138_13 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB80680.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAP04154.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99158.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82088.1| tolB-related protein [Arabidopsis thaliana]
Length=652

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E +GGGIR+LTDG WIDTMP WSP G LI FSSNRHNP N   F  YVVRPDGTGLRRI 
Sbjct  480  ESNGGGIRRLTDGPWIDTMPCWSPKGDLIGFSSNRHNPENTAVFGAYVVRPDGTGLRRIQ  539

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            ++G EGSEE  RER+NHV F+ D +W++F ANL GVTAEPV++PNQFQPYGDLY+++LDG
Sbjct  540  ISGPEGSEEAARERVNHVSFNKDGDWLVFAANLSGVTAEPVTMPNQFQPYGDLYVVKLDG  599

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  69
            TGL+ LTWNGYE+GTP WH   E+DL++L+L G+ G+KL G+F+EPLWI+ D 
Sbjct  600  TGLRRLTWNGYEDGTPTWHTADELDLSQLNLNGQDGDKLEGQFEEPLWISCDI  652



>ref|XP_011467073.1| PREDICTED: uncharacterized protein LOC105352244 [Fragaria vesca 
subsp. vesca]
Length=685

 Score =   255 bits (651),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 142/171 (83%), Gaps = 7/171 (4%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GGI +LT+G  IDTMPSWSP G LIAFSSNRH P +A  FSIYV++PDG+GLRRIHVAG 
Sbjct  519  GGIHRLTEGPCIDTMPSWSPKGDLIAFSSNRHKPEDAAVFSIYVIKPDGSGLRRIHVAG-  577

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
               ++V+RER+NHVCFS+D EW+LFTANLGGVTAEPVS PNQFQPYGDLY MRLDG+GL 
Sbjct  578  ---DDVDRERINHVCFSNDGEWLLFTANLGGVTAEPVSFPNQFQPYGDLYTMRLDGSGLT  634

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLGKS---GEKLRGKFDEPLWINSDF  69
             LTWNGYENGTP WH   +VDL RL LG++   G+KL+G+FDEPLWI+ D 
Sbjct  635  RLTWNGYENGTPTWHTGDDVDLGRLRLGEACEVGDKLKGQFDEPLWISCDI  685



>gb|AAM13860.1| unknown protein [Arabidopsis thaliana]
Length=657

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E +GGGIR+LTDG WIDTMP WSP G LI FSSNRHNP N   F  YVVRPDGTGLRRI 
Sbjct  485  ESNGGGIRRLTDGPWIDTMPCWSPKGDLIGFSSNRHNPENTAVFGAYVVRPDGTGLRRIQ  544

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            ++G EGSEE  RER+NHV F+ D +W++F ANL GVTAEPV++PNQFQPYGDLY+++LDG
Sbjct  545  ISGPEGSEEAARERVNHVSFNKDGDWLVFAANLSGVTAEPVTMPNQFQPYGDLYVVKLDG  604

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  69
            TGL+ LTWNGYE+GTP WH   E+DL++L+L G+ G+KL G+F+EPLWI+ D 
Sbjct  605  TGLRRLTWNGYEDGTPTWHTADELDLSQLNLNGQDGDKLEGQFEEPLWISCDI  657



>ref|XP_006289995.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
 gb|EOA22893.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
Length=650

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E DGG IR+LT+G WIDTMP WSP G LI FSSNRHNP +   F  YVVRPDG+GLRRI 
Sbjct  478  ESDGGEIRRLTEGEWIDTMPCWSPKGDLIGFSSNRHNPADTSAFGAYVVRPDGSGLRRIQ  537

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            +AG EGSEE  RER+NHV F+ D +W++FTANL G+TAEPV++PNQFQPYGDLY+++LDG
Sbjct  538  IAGPEGSEEAARERVNHVSFNKDGDWLVFTANLCGITAEPVAMPNQFQPYGDLYVVKLDG  597

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  69
            TGL+ LTWNGYE+GTP WH   E+DL+RLSL G+ G+KL G+F+EPLWI+ D 
Sbjct  598  TGLRRLTWNGYEDGTPTWHTVDELDLSRLSLNGQDGDKLEGQFEEPLWISCDI  650



>ref|XP_010422681.1| PREDICTED: uncharacterized protein LOC104707922 [Camelina sativa]
Length=651

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E +GGGIR+LT+G WIDTMP WSP G LI FSSNRHNP N   F  YVVRPDG+GLRRI 
Sbjct  479  ESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPENTAAFGAYVVRPDGSGLRRIQ  538

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            +AG EGSEE  RER+NHV F+ D +W++FTANL G+TAEPV+IPNQFQPYGDLY++++DG
Sbjct  539  IAGPEGSEEAARERVNHVSFNKDGDWLVFTANLCGITAEPVAIPNQFQPYGDLYIVKVDG  598

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  69
            TGL+ LTWNGYE+GTP WH   E+DL RLSL G+ G+KL G+F+EPLWI+ D 
Sbjct  599  TGLRRLTWNGYEDGTPTWHTVDELDLTRLSLNGQDGDKLGGQFEEPLWISCDI  651



>gb|KCW45418.1| hypothetical protein EUGRSUZ_L00886 [Eucalyptus grandis]
Length=648

 Score =   254 bits (649),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 142/171 (83%), Gaps = 4/171 (2%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GGIRQLTDG WIDTMPSWSP+  LIAFSSNRHNPG+A  FSIY++RPDG+ LRR+H+AG 
Sbjct  477  GGIRQLTDGPWIDTMPSWSPNNDLIAFSSNRHNPGDASTFSIYLIRPDGSDLRRVHLAGP  536

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS EV+RER+NHVCFS D EW+LFTANLGGVTAEPVS PNQFQPYG+LY++RLDG+GL+
Sbjct  537  EGSPEVDRERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQFQPYGELYVVRLDGSGLK  596

Query  212  GLTWNGYENGTPAWHPKAEVDL----ARLSLGKSGEKLRGKFDEPLWINSD  72
             LTWNG+ENGTPAWH    V L    +    G   +KLRG+F+EPLWI+ D
Sbjct  597  RLTWNGFENGTPAWHSMHAVGLGDPWSATGEGWDEDKLRGQFEEPLWISCD  647



>ref|XP_010428858.1| PREDICTED: uncharacterized protein LOC104713446 [Camelina sativa]
Length=651

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E +GGGIR+LT+G WIDTMP WSP G LI FSSNRHNP N   F  YVVRPDG+GLRRI 
Sbjct  479  ESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPENTAAFGAYVVRPDGSGLRRIQ  538

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            +AG EGSEE  RER+NHV F+ + +W++FTANL G+TAEPV+IPNQFQPYGDLY++++DG
Sbjct  539  IAGPEGSEEAARERVNHVSFNKEGDWIVFTANLCGITAEPVAIPNQFQPYGDLYVVKVDG  598

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  69
            TGL+ LTWNGYE+GTP WH   E+DL +LSL G+ G+KL G+F+EPLWI+ D 
Sbjct  599  TGLRRLTWNGYEDGTPTWHTVDELDLTQLSLNGQDGDKLEGQFEEPLWISCDI  651



>gb|KDP28318.1| hypothetical protein JCGZ_14089 [Jatropha curcas]
Length=703

 Score =   253 bits (646),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            G +RQLT+GAWIDTMPSWSP G LIAFSSNRHNP N   FSIYV++PDG+ LRRIHVAGA
Sbjct  535  GTVRQLTNGAWIDTMPSWSPKGDLIAFSSNRHNPDNPAVFSIYVIKPDGSDLRRIHVAGA  594

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS EV RER+NHVCFS D EW+LF +NL  VTAEPVS  NQFQPYGDL+++RLDG+GL+
Sbjct  595  EGSSEVVRERINHVCFSKDGEWLLFASNLDSVTAEPVSWANQFQPYGDLHVVRLDGSGLR  654

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFDEPLWINSDF  69
             LT NGYENGTPAW    E+DL RLSL K  G+KL G+FDEPLWI+ D 
Sbjct  655  RLTCNGYENGTPAWFSGNELDLDRLSLDKQVGDKLTGQFDEPLWISCDL  703



>ref|XP_010921344.1| PREDICTED: uncharacterized protein LOC105044938 [Elaeis guineensis]
Length=656

 Score =   251 bits (641),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 141/175 (81%), Gaps = 3/175 (2%)
 Frame = -1

Query  584  ELDGG-GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI  408
            E DGG GIRQLT+G W DTMP+WSPDG+LIAFSSNRH P N D FSIY++RPDGTGLRR+
Sbjct  482  ESDGGEGIRQLTEGKWTDTMPTWSPDGELIAFSSNRHAPSNPDVFSIYLIRPDGTGLRRV  541

Query  407  HVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLD  228
            HVAG  GS  V+RER+NHVCFS DS+W+LFTANLG VT+EPVS PNQFQPYGDLY+ RLD
Sbjct  542  HVAGPAGSSYVDRERINHVCFSPDSKWLLFTANLGSVTSEPVSWPNQFQPYGDLYVCRLD  601

Query  227  GTGLQGLTWNGYENGTPAWHPK-AEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  69
            GTGL+ LT   YENGTPAW  +    DL  LSL   +G+KLRG+FDEPLWI  D 
Sbjct  602  GTGLRRLTCGSYENGTPAWSSRGGPDDLGSLSLRSPTGDKLRGQFDEPLWITCDI  656



>gb|KFK30736.1| hypothetical protein AALP_AA6G020600 [Arabis alpina]
Length=648

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = -1

Query  575  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  396
            G GIR+LT+G WIDTMP WSP G LI FSSNRHNP N + F  YVVRPDG+GLRRI +AG
Sbjct  479  GDGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPTNTEAFGAYVVRPDGSGLRRIEIAG  538

Query  395  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  216
             EGSEE  RER+NHV F+ D +W++FTANLGG+TAEPV+IPNQFQPYGDLY++++DGTGL
Sbjct  539  PEGSEEAARERVNHVSFNKDGDWLVFTANLGGITAEPVTIPNQFQPYGDLYVVKVDGTGL  598

Query  215  QGLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  69
            + LTWNGYE+GTP WH   ++DL+ LSL G+ G+KL G+F+EPLWI  D 
Sbjct  599  KRLTWNGYEDGTPTWHSVDDLDLSGLSLNGQDGDKLEGQFEEPLWITCDI  648



>ref|XP_004135965.1| PREDICTED: uncharacterized protein LOC101214858 [Cucumis sativus]
 ref|XP_004158170.1| PREDICTED: uncharacterized protein LOC101226808 [Cucumis sativus]
 gb|KGN45063.1| hypothetical protein Csa_7G419590 [Cucumis sativus]
Length=642

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 138/169 (82%), Gaps = 2/169 (1%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            G +RQLTDG WIDTMP+WSP G LI FSSN HNP N + FSIYV+RPDG+GLRR++VAG 
Sbjct  474  GELRQLTDGPWIDTMPNWSPRGDLIVFSSNMHNPKNTEAFSIYVIRPDGSGLRRVYVAGP  533

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS EV+RER+NHVCFS D  W+LFTANL GVTAEPVS+PNQFQPYGDL+++RLDGTGL+
Sbjct  534  EGSSEVDRERINHVCFSRDGNWLLFTANLSGVTAEPVSLPNQFQPYGDLFVVRLDGTGLR  593

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLGKS--GEKLRGKFDEPLWINSD  72
             LT N YENGTP W+  +E+ L+ LSL     GEKL+G FDEPLWI  D
Sbjct  594  RLTCNAYENGTPTWYYGSELALSGLSLKDEVVGEKLKGDFDEPLWIKFD  642



>ref|XP_010091406.1| hypothetical protein L484_013861 [Morus notabilis]
 gb|EXB44443.1| hypothetical protein L484_013861 [Morus notabilis]
Length=662

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 142/178 (80%), Gaps = 6/178 (3%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E DGG +RQLTDG WIDTMP WSP G LIAFSSNRHNP + + F+IYV+  DG+ LRRI+
Sbjct  485  EFDGGSLRQLTDGPWIDTMPCWSPKGDLIAFSSNRHNPDDVNAFNIYVITSDGSELRRIY  544

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            +AG EGS + +RER+NHVCFS D EW+LFTANLGGVTAEPV+ PNQFQPYGDLYM+RLDG
Sbjct  545  LAGPEGSGDADRERINHVCFSEDGEWLLFTANLGGVTAEPVTWPNQFQPYGDLYMVRLDG  604

Query  224  TGLQGLTWNGYENGTPAWHP--KAEVDLARLSLGKS----GEKLRGKFDEPLWINSDF  69
            +GL+ LTWNGYENGTPAW    + +VD+  LSL       GE+LRG+FDEPLWI  D 
Sbjct  605  SGLRRLTWNGYENGTPAWKNFGRDDVDMGPLSLAGDDRLVGEELRGQFDEPLWITCDI  662



>emb|CDP01464.1| unnamed protein product [Coffea canephora]
Length=719

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 147/176 (84%), Gaps = 7/176 (4%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E +GG IR+LTDG WIDTMPSWSPDGK IAFSSN HNP + + FSIYV+  DG+GLRRI 
Sbjct  544  EFNGGSIRRLTDGPWIDTMPSWSPDGKWIAFSSNMHNPDDVEHFSIYVIGADGSGLRRIR  603

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            +AG EGS  ++RERLNHVC+S+D EW+LFTANLGGVTAEPVS+PNQFQPYGDLYM+R+DG
Sbjct  604  IAGNEGSGRLDRERLNHVCWSADCEWLLFTANLGGVTAEPVSLPNQFQPYGDLYMVRVDG  663

Query  224  TGLQGLTWNGYENGTPAWHPK---AEVDLARL-SLGKS---GEKLRGKFDEPLWIN  78
            TGL+ LTWNGYENGTPAW+P     E+D+ RL +L +S   G+KL+G F EPLW++
Sbjct  664  TGLRRLTWNGYENGTPAWYPTGGDVELDMGRLMNLKRSETVGDKLKGDFIEPLWLH  719



>ref|XP_010522850.1| PREDICTED: uncharacterized protein LOC104801322 [Tarenaya hassleriana]
Length=649

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GGIR+LT+G WIDTMP WSP G LIAFSSNRHN GN + F  YVVRPDG+G+RRI VA
Sbjct  478  ESGGIRRLTEGPWIDTMPCWSPKGDLIAFSSNRHNQGNTEGFGAYVVRPDGSGVRRIKVA  537

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G EGSEE  RER+NH+ FS D EW++FTANLGGVT EPV++PNQFQPYG++Y++R+DGTG
Sbjct  538  GTEGSEEAERERINHLSFSKDGEWLVFTANLGGVTVEPVAVPNQFQPYGEVYVVRVDGTG  597

Query  218  LQGLTWNGYENGTPAWH-PKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  69
            L+ LTWNGYE+GTP WH    E+DL RLSL G+ G+KL G+ DEPLWI+ D 
Sbjct  598  LRRLTWNGYEDGTPTWHTADDELDLTRLSLDGQDGDKLTGQIDEPLWISCDL  649



>gb|KJB09508.1| hypothetical protein B456_001G146700 [Gossypium raimondii]
Length=710

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = -1

Query  569  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  390
            GIR+LT G WIDTMPSWSP+G LIAFSSN HNP N D FSIYV++PDG+ LRRI+ AG +
Sbjct  542  GIRKLTAGPWIDTMPSWSPNGDLIAFSSNMHNPNNVDAFSIYVIKPDGSDLRRIYAAGPK  601

Query  389  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQG  210
            GS +V+ ER+NHVCFS + EW++F AN+GGVTAEPVS PNQFQPYGDLY+MRLDG+GL+ 
Sbjct  602  GSSDVDMERINHVCFSPNGEWLVFAANIGGVTAEPVSFPNQFQPYGDLYVMRLDGSGLRR  661

Query  209  LTWNGYENGTPAWHPKAEVDLARLSLGK-SGEKLRGKFDEPLWINSDF  69
            LT +GYENGTP WH   E+D+ RL LG  +G +L G FDEPLWI SDF
Sbjct  662  LTCDGYENGTPTWHFGGELDMRRLCLGNDAGVELTGGFDEPLWITSDF  709



>emb|CDX74396.1| BnaA03g26510D [Brassica napus]
Length=650

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 139/170 (82%), Gaps = 1/170 (1%)
 Frame = -1

Query  575  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  396
            G GIR+LT+GAWIDTMP WSP G LI FSSNRH+P N   F  YVVRPDG+GLRRI +AG
Sbjct  481  GEGIRRLTEGAWIDTMPCWSPKGDLIGFSSNRHDPSNDAAFGAYVVRPDGSGLRRIEIAG  540

Query  395  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  216
             EGSEE  RER+NHV F+ D +W++FTANLGG+TAEPV+IPNQFQPYGDLY+++LDGTGL
Sbjct  541  PEGSEEAARERVNHVSFNKDGDWLVFTANLGGITAEPVAIPNQFQPYGDLYVVKLDGTGL  600

Query  215  QGLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  69
            + LTWNGYE+GTP WH   ++ L+ LSL G+ G+KL G+F+EPLWI  D 
Sbjct  601  RRLTWNGYEDGTPTWHTVDDLGLSGLSLNGQDGDKLEGQFEEPLWITCDI  650



>ref|XP_009134471.1| PREDICTED: uncharacterized protein LOC103858800 [Brassica rapa]
Length=650

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 138/170 (81%), Gaps = 1/170 (1%)
 Frame = -1

Query  575  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  396
            G GIR+LT+G WIDTMP WSP G LI FSSNRH+P N   F  YVVRPDG+GLRRI +AG
Sbjct  481  GEGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHDPSNDAAFGAYVVRPDGSGLRRIEIAG  540

Query  395  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  216
             EGSEE  RER+NHV F+ D +W++FTANLGG+TAEPV+IPNQFQPYGDLY+++LDGTGL
Sbjct  541  PEGSEEAARERVNHVSFNKDGDWIVFTANLGGITAEPVAIPNQFQPYGDLYVVKLDGTGL  600

Query  215  QGLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  69
            + LTWNGYE+GTP WH   ++ L+ LSL G+ G+KL G+F+EPLWI  D 
Sbjct  601  RRLTWNGYEDGTPTWHTVDDLGLSGLSLNGQDGDKLEGQFEEPLWITCDI  650



>ref|XP_008653395.1| PREDICTED: uncharacterized protein LOC103633477 [Zea mays]
 tpg|DAA63832.1| TPA: putative WD40-like beta propeller repeat family protein 
[Zea mays]
Length=667

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 137/169 (81%), Gaps = 2/169 (1%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GG+R+LT+G WIDTMPSWSPDG LIAFSSNRH+P N   FSIY+VRPDG+GLRR++VAGA
Sbjct  498  GGVRRLTEGEWIDTMPSWSPDGSLIAFSSNRHDPANPAVFSIYLVRPDGSGLRRVYVAGA  557

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS E ++ER+NHVCFS DS+W+LFTANLG V AEP+S PNQFQPYGDLY+ RLDG+ L+
Sbjct  558  EGSAEADKERINHVCFSPDSQWLLFTANLGSVVAEPISGPNQFQPYGDLYVCRLDGSDLR  617

Query  212  GLTWNGYENGTPAWHP-KAEVDLARLSLG-KSGEKLRGKFDEPLWINSD  72
             LT N YENGTP W P  A + L  LS+G  SGE   G+FDEPLW+  D
Sbjct  618  RLTCNAYENGTPVWGPASAGLGLESLSMGPPSGEDALGQFDEPLWLTCD  666



>ref|XP_003562594.1| PREDICTED: uncharacterized protein LOC100822199 [Brachypodium 
distachyon]
Length=674

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 135/168 (80%), Gaps = 3/168 (2%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  387
            I++LTDG WIDTMP W+PDGKL+AFSSNRH+PGNA  FSIY+VRPDGTGLRR+HVAG  G
Sbjct  506  IQRLTDGEWIDTMPCWAPDGKLVAFSSNRHDPGNAAVFSIYLVRPDGTGLRRVHVAGPPG  565

Query  386  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGL  207
            SEE ++ER+NHVCFS D EW+LFTANLGGV AEPVS PNQFQPYGDLY+ RLDG+GL  L
Sbjct  566  SEEADKERINHVCFSPDGEWLLFTANLGGVNAEPVSGPNQFQPYGDLYVCRLDGSGLVRL  625

Query  206  TWNGYENGTPAWHPKAEVDLARLSLG---KSGEKLRGKFDEPLWINSD  72
            T N YENGTPAW P  +++    SLG    + E   G+FDEPLW+  D
Sbjct  626  TCNAYENGTPAWGPALDLEDGVGSLGLGNPAAEDSLGEFDEPLWLTCD  673



>ref|NP_001060406.1| Os07g0638100 [Oryza sativa Japonica Group]
 dbj|BAC45195.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22320.1| Os07g0638100 [Oryza sativa Japonica Group]
Length=659

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 134/170 (79%), Gaps = 3/170 (2%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            G IR+LTDG WIDTMPSWSPDG LIAFSSNRH+P NA  FSIY+VRPDG+GLRR+HVAG 
Sbjct  489  GTIRRLTDGEWIDTMPSWSPDGSLIAFSSNRHDPTNAAVFSIYLVRPDGSGLRRVHVAGP  548

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
             GS   +RER+NHVCFS DS W+LFTAN GGV AEP+S PNQFQPYGDLY+ RLDG+GL 
Sbjct  549  AGSAAADRERINHVCFSPDSRWLLFTANFGGVMAEPISAPNQFQPYGDLYVCRLDGSGLV  608

Query  212  GLTWNGYENGTPAWHPKAE--VDLARLSLGK-SGEKLRGKFDEPLWINSD  72
             LT N YENGTPAW P +     L  LSLG  +G++  G+FDEPLW+  D
Sbjct  609  RLTCNAYENGTPAWGPASSPAAGLESLSLGPGAGDESLGEFDEPLWLTCD  658



>ref|XP_002461097.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
 gb|EER97618.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
Length=669

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 137/169 (81%), Gaps = 2/169 (1%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GG+ +LT+G WIDTMPSWSPDG LIAFSSNRH+P N   FSIY+VRPDG+GLRR++VAG 
Sbjct  500  GGVLRLTEGEWIDTMPSWSPDGSLIAFSSNRHDPANPAVFSIYLVRPDGSGLRRVYVAGP  559

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS E ++ER+NHVCFS DS+W+LFTANLG V AEP+S PNQFQPYGDLY+ RLDG+GL+
Sbjct  560  EGSAEADKERINHVCFSPDSQWLLFTANLGSVVAEPISGPNQFQPYGDLYVCRLDGSGLR  619

Query  212  GLTWNGYENGTPAWHP-KAEVDLARLSLG-KSGEKLRGKFDEPLWINSD  72
             LT N YENGTPAW P  A + L  L++G  +GE   G+FDEPLW+  D
Sbjct  620  RLTCNAYENGTPAWGPASAGLGLESLAIGPPAGEDALGQFDEPLWLTCD  668



>ref|XP_007221548.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
 gb|EMJ22747.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
Length=661

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 138/171 (81%), Gaps = 7/171 (4%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            G  R+LT+G  IDTMPSWSP G LIAFSSNRHNP +   F IYV++PDG+GLRR+H AG 
Sbjct  495  GDARRLTEGQCIDTMPSWSPKGDLIAFSSNRHNPDDVAVFGIYVIKPDGSGLRRVHAAG-  553

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
               ++V RER+NHVCFS D EW+LFTANLGGVTAEPVS+PNQFQPYGDLY++RLDG+GL+
Sbjct  554  ---DDVERERINHVCFSKDGEWLLFTANLGGVTAEPVSLPNQFQPYGDLYVVRLDGSGLR  610

Query  212  GLTWNGYENGTPAWHPKAE-VDLARLSLGKS--GEKLRGKFDEPLWINSDF  69
             LTWNGYENGTPAW    E VD+ RL L     G+KL+G+F+EPLWI+ DF
Sbjct  611  RLTWNGYENGTPAWLEGDEVVDMGRLRLENEVGGDKLKGRFEEPLWISCDF  661



>ref|XP_011079490.1| PREDICTED: uncharacterized protein LOC105162997 [Sesamum indicum]
Length=659

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 140/177 (79%), Gaps = 13/177 (7%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GGIRQLT+G WIDTMPSWSP+G+LIAFSSNRHNP N D F IY+++PDGTGLRR+ VA  
Sbjct  487  GGIRQLTEGPWIDTMPSWSPNGELIAFSSNRHNPDNVDAFGIYLIKPDGTGLRRVKVA--  544

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            E  EE  RERLNHVCFS D EW+LF ANLGGVT EPV++PN FQPYGDLY++RLDG+GL+
Sbjct  545  EFEEE--RERLNHVCFSGDGEWLLFAANLGGVTVEPVALPNHFQPYGDLYLVRLDGSGLR  602

Query  212  GLTWNGYENGTPAWHPK------AEVDLARLSLGKSG---EKLRGKFDEPLWINSDF  69
             LTWNGYENGTPAWHP        E+ L  LSLG      E+L+G+FDEPLWI  DF
Sbjct  603  RLTWNGYENGTPAWHPNRVLGGAEELKLCGLSLGGGKKGEEELKGQFDEPLWIKCDF  659



>ref|XP_004958463.1| PREDICTED: uncharacterized protein LOC101757241 [Setaria italica]
Length=666

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 135/169 (80%), Gaps = 2/169 (1%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
              +R+LT+G WIDTMPSWSPDG LIAFSSNRH+P N   FSIY+VRPDG+ LRR++VAG 
Sbjct  497  AAVRRLTEGEWIDTMPSWSPDGSLIAFSSNRHDPANPAVFSIYLVRPDGSRLRRVYVAGP  556

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            EGS E ++ER+NHVCFS DS W+LFTANLGGV AEPVS PNQFQPYGDLY+ RLDG+GLQ
Sbjct  557  EGSAEADKERINHVCFSPDSRWLLFTANLGGVMAEPVSGPNQFQPYGDLYVCRLDGSGLQ  616

Query  212  GLTWNGYENGTPAWHP-KAEVDLARLSLGK-SGEKLRGKFDEPLWINSD  72
             LT N YENGTPAW P  A + +  +SLG  +GE   G+FDEPLW+  D
Sbjct  617  RLTCNAYENGTPAWGPSSAGLGVEAMSLGAPAGEDPMGQFDEPLWLTCD  665



>gb|EAZ04851.1| hypothetical protein OsI_27029 [Oryza sativa Indica Group]
Length=659

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 133/170 (78%), Gaps = 3/170 (2%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            G IR+LTDG WIDTMPSWSPDG LIAFSSNRH+P NA  FSIY+VRPDG+GLRR+HVAG 
Sbjct  489  GTIRRLTDGEWIDTMPSWSPDGSLIAFSSNRHDPTNAAVFSIYLVRPDGSGLRRVHVAGP  548

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
             GS   +RER+NHVCFS DS W+LFTAN GGV AEP+S PNQFQPYGDLY+ RLDG+GL 
Sbjct  549  AGSAAADRERINHVCFSPDSRWLLFTANFGGVMAEPISAPNQFQPYGDLYVCRLDGSGLV  608

Query  212  GLTWNGYENGTPAWHPKAE--VDLARLSLGK-SGEKLRGKFDEPLWINSD  72
             LT N YENGTPAW P +     L  LSL   +G++  G+FDEPLW+  D
Sbjct  609  RLTCNAYENGTPAWGPASSPAAGLESLSLVPGAGDESLGEFDEPLWLTCD  658



>ref|XP_008781198.1| PREDICTED: uncharacterized protein LOC103701039 [Phoenix dactylifera]
Length=656

 Score =   238 bits (608),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 136/169 (80%), Gaps = 2/169 (1%)
 Frame = -1

Query  569  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  390
            GIR+LT+G W DTMP WSPDG+LIAFSSNRH P + D FSIY++RPDGTGLRR+HVAG  
Sbjct  488  GIRRLTEGEWTDTMPCWSPDGELIAFSSNRHAPTSPDVFSIYLIRPDGTGLRRVHVAGPA  547

Query  389  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQG  210
            GS  V++ER+NHVCFS DS+W+LFTANLG VTAEPVS PN FQPYGDL++ RLDGTGL+ 
Sbjct  548  GSCYVDKERVNHVCFSQDSKWLLFTANLGSVTAEPVSWPNHFQPYGDLFLCRLDGTGLRR  607

Query  209  LTWNGYENGTPAWHPK-AEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  69
            LT + YENGTPAW  +    DL  LSL   +G+KL+G+FDEPLWI  D 
Sbjct  608  LTCDPYENGTPAWSSRGGPDDLETLSLRSPTGDKLQGQFDEPLWITCDI  656



>ref|XP_008227800.1| PREDICTED: uncharacterized protein LOC103327273 [Prunus mume]
Length=712

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 137/171 (80%), Gaps = 7/171 (4%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            G  R+LT+G  IDTMPSWSP G LIAFSSNRHNP +   F IYV++PDG+GLRR++ AG 
Sbjct  546  GDARRLTEGQCIDTMPSWSPKGDLIAFSSNRHNPDDVAVFGIYVIKPDGSGLRRVYAAG-  604

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
               ++V RER+NHVCFS D EW+LFTANLGGV AEPVS+PNQFQPYGDLY++RLDG+GL+
Sbjct  605  ---DDVERERINHVCFSKDGEWLLFTANLGGVIAEPVSLPNQFQPYGDLYVVRLDGSGLR  661

Query  212  GLTWNGYENGTPAW-HPKAEVDLARLSLGKS--GEKLRGKFDEPLWINSDF  69
             LTWNGYENGTPAW     EVD+ RL L     G+KL+G+F+EPLWI+ DF
Sbjct  662  RLTWNGYENGTPAWLEGDEEVDMGRLRLDNEVGGDKLKGQFEEPLWISCDF  712



>dbj|BAJ89339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 132/166 (80%), Gaps = 3/166 (2%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  387
            IR++TDG WIDTMPSWSPDG+LIAFSSNRH P NA  FSIY+VRPDGTGLRR+HVAG  G
Sbjct  490  IRRVTDGEWIDTMPSWSPDGELIAFSSNRHEPANAAVFSIYLVRPDGTGLRRVHVAGPAG  549

Query  386  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGL  207
            S E ++ER+NHVCFS D +W+LFTANLGGV AEP+S PNQFQPYGDLY+ RLDG+G+  L
Sbjct  550  SAEADKERINHVCFSPDGQWLLFTANLGGVMAEPISGPNQFQPYGDLYVCRLDGSGVLRL  609

Query  206  TWNGYENGTPAWHPKAEVDLARLSLGK-SGEKLRGKFDEPLWINSD  72
            T N YENGTP W P   VD   LSLG  + +   G+FDEPLW+  +
Sbjct  610  TCNAYENGTPTWGPALGVD--SLSLGAPAADDSLGQFDEPLWLTCN  653



>ref|XP_008343202.1| PREDICTED: uncharacterized protein LOC103405949 [Malus domestica]
Length=661

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 136/171 (80%), Gaps = 7/171 (4%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            G +RQLT+G  IDTMPSWSP G LIAFSSNRHNP +A  F IYVV+PDGTGLRRI VAG 
Sbjct  495  GSVRQLTEGPCIDTMPSWSPKGDLIAFSSNRHNPDDAAVFGIYVVKPDGTGLRRIPVAGN  554

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
            E     +RER+NHVCFS D EW+LFTANL GV AEPVS+PNQFQPYGDLY++R DG+GL+
Sbjct  555  ES----HRERINHVCFSKDXEWLLFTANLSGVIAEPVSLPNQFQPYGDLYVVRXDGSGLR  610

Query  212  GLTWNGYENGTPAWHPKA-EVDLARLSLGKS--GEKLRGKFDEPLWINSDF  69
             LTWNGYENGTPAWH    E+D+  L LG    G++L+G+F++P WI+ DF
Sbjct  611  RLTWNGYENGTPAWHEGGDELDMGGLRLGNEVGGDELKGQFEDPHWISCDF  661



>dbj|BAJ94262.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 131/166 (79%), Gaps = 3/166 (2%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  387
            IR++TDG WIDTMPSWSPDG+LIAFSSNRH P NA  FSIY+VRPDGTGLRR+HVAG  G
Sbjct  490  IRRVTDGEWIDTMPSWSPDGELIAFSSNRHEPANAAVFSIYLVRPDGTGLRRVHVAGPAG  549

Query  386  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGL  207
            S E ++ER+NHVCFS D +W+LFTA LGGV AEP+S PNQFQPYGDLY+ RLDG+G+  L
Sbjct  550  SAEADKERINHVCFSPDGQWLLFTATLGGVMAEPISGPNQFQPYGDLYVCRLDGSGVLRL  609

Query  206  TWNGYENGTPAWHPKAEVDLARLSLGK-SGEKLRGKFDEPLWINSD  72
            T N YENGTP W P   VD   LSLG  + +   G+FDEPLW+  +
Sbjct  610  TCNAYENGTPTWGPALGVD--SLSLGAPAADDSLGQFDEPLWLTCN  653



>ref|XP_009367159.1| PREDICTED: uncharacterized protein LOC103956844 [Pyrus x bretschneideri]
Length=715

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 135/169 (80%), Gaps = 7/169 (4%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  387
            +RQLT+G  IDTMPSWSP G LI FSSNRHNP +A  F IYVV+PDGT LRRI VAG E 
Sbjct  551  VRQLTEGPCIDTMPSWSPKGDLIVFSSNRHNPDDAAVFGIYVVKPDGTDLRRIPVAGNES  610

Query  386  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGL  207
                +RER+NHVCFS D EW+LFTANL GVTAEPVS PNQFQPYG+LY++RLDG+GL+ L
Sbjct  611  ----HRERINHVCFSKDGEWLLFTANLSGVTAEPVSWPNQFQPYGELYVVRLDGSGLRRL  666

Query  206  TWNGYENGTPAWHPKA-EVDLARLSLGKS--GEKLRGKFDEPLWINSDF  69
            TWNGYENGTPAWH    E+D+  L LG    G++L+G+F+EPLWI+ DF
Sbjct  667  TWNGYENGTPAWHEGGDELDMGGLRLGNEVGGDELKGRFEEPLWISCDF  715



>ref|XP_010679438.1| PREDICTED: uncharacterized protein LOC104894805 [Beta vulgaris 
subsp. vulgaris]
Length=668

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 134/182 (74%), Gaps = 18/182 (10%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            D   IRQLT+G WIDTMPSWSPDGKLIAFSSNRH+P N   F IY+V  DG+ L+R+HV+
Sbjct  493  DSNNIRQLTNGPWIDTMPSWSPDGKLIAFSSNRHDPSNMVTFGIYLVAVDGSDLKRVHVS  552

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                  +V  ER+NHVCFS + EW+LFTAN+GGVTAEPVS PNQFQPYGDL++ +LDGTG
Sbjct  553  ------DVAMERINHVCFSPNGEWLLFTANMGGVTAEPVSFPNQFQPYGDLFIAKLDGTG  606

Query  218  LQGLTWNGYENGTPAWHPKAEVDLARLSLGKSG------------EKLRGKFDEPLWINS  75
            L+ LTW+GYENGTPAWH +  +D+   +L   G            +KL+GKFDEPLWI  
Sbjct  607  LRRLTWSGYENGTPAWHSRQLLDIPLGNLSLEGIEKADAHHQVDADKLKGKFDEPLWITC  666

Query  74   DF  69
            DF
Sbjct  667  DF  668



>ref|XP_006840287.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
 gb|ERN01962.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
Length=642

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 126/167 (75%), Gaps = 6/167 (4%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GGIRQLT+G WIDTMPSWSPDGK IAFSSNRH+P N + F IYV+ PDGTGLRR+HVA
Sbjct  479  EDGGIRQLTEGPWIDTMPSWSPDGKFIAFSSNRHSPENTEVFGIYVIHPDGTGLRRVHVA  538

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                 E+++  R NHVCFS DS+W+LFTAN G V+AEP+S+PNQFQPYGDLY+  L+GT 
Sbjct  539  -----EDMDMVRTNHVCFSPDSKWLLFTANFGAVSAEPISLPNQFQPYGDLYVCGLEGTH  593

Query  218  LQGLTWNGYENGTPAWHP-KAEVDLARLSLGKSGEKLRGKFDEPLWI  81
            L+ LT N YENGTPAWH      D+  L L   GE L+G F EP W+
Sbjct  594  LKRLTCNAYENGTPAWHSGDGGPDIGSLCLNDVGEDLKGDFGEPHWL  640



>ref|XP_007153254.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
 gb|ESW25248.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
Length=687

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 130/171 (76%), Gaps = 9/171 (5%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA-G  396
            GGIR+LT+GAWIDTMP WSP G LIAFSSNRH P N++ F IY+VRPDG+GLRR+ VA G
Sbjct  521  GGIRRLTEGAWIDTMPCWSPKGDLIAFSSNRHEPKNSEVFGIYLVRPDGSGLRRVEVAMG  580

Query  395  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  216
             EG     RERLNHV FS D EW++FTANLGGVTAEP+ +PNQFQPYGDLY++R+DG+GL
Sbjct  581  VEGG----RERLNHVSFSGDGEWLVFTANLGGVTAEPIGLPNQFQPYGDLYVVRVDGSGL  636

Query  215  QGLTWNGYENGTPAWHPKAEVDLARLSLGKSGE---KLRGKFDEPLWINSD  72
            + LT N YENGTP WH   ++ L  +     GE   KL+ +F EPLWI  D
Sbjct  637  RRLTCNAYENGTPTWH-NGDLVLCHVDGDGEGENWDKLKAEFAEPLWITCD  686



>ref|XP_003529216.2| PREDICTED: uncharacterized protein LOC100814036 [Glycine max]
Length=704

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 132/176 (75%), Gaps = 15/176 (9%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA-G  396
            GGIR+LT+G WIDTMP WSP G LIAFSSNRH+P N++ F IY+V P+G+GLRR+ VA G
Sbjct  536  GGIRRLTEGEWIDTMPCWSPKGDLIAFSSNRHDPKNSEVFGIYLVGPNGSGLRRVEVAKG  595

Query  395  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  216
             EG     +ERLNHVCFS D EW+LFTANLGGV+AEPV +PNQFQPYGDLY++RLDG+GL
Sbjct  596  VEGM----KERLNHVCFSRDGEWLLFTANLGGVSAEPVGLPNQFQPYGDLYVVRLDGSGL  651

Query  215  QGLTWNGYENGTPAWHPKAEVDLARLSL-------GKSGEKLRGKFDEPLWINSDF  69
            + LT N YENGTP WH     DLA  +        G+  +KL+G+F EPLWI  D 
Sbjct  652  RRLTCNAYENGTPTWH---HGDLALCAPREDDGEGGQDWDKLKGEFQEPLWITCDI  704



>ref|XP_004498256.1| PREDICTED: uncharacterized protein LOC101515113 [Cicer arietinum]
Length=652

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 130/174 (75%), Gaps = 9/174 (5%)
 Frame = -1

Query  581  LDG---GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRR  411
            LDG   GG+R+LT+G WIDTMP WSP G  IAFSSNRH+ GN++ F IYVVRPDG+ LRR
Sbjct  484  LDGEFNGGLRRLTEGEWIDTMPCWSPKGDWIAFSSNRHDAGNSEVFGIYVVRPDGSDLRR  543

Query  410  IHV-AGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMR  234
            + V  G +G     RERLNHVCFS D EW+LFTANLGGV AEPVS+PNQFQPYGDL+++R
Sbjct  544  VEVGKGVDGE----RERLNHVCFSGDGEWLLFTANLGGVMAEPVSMPNQFQPYGDLFVVR  599

Query  233  LDGTGLQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINSD  72
            LDG+GL+ LT N YENGTP WH +    L R   G   + L+G F+EPLWI  +
Sbjct  600  LDGSGLKRLTCNAYENGTPMWHAREGAALLRSGKGDE-DVLKGGFEEPLWITCE  652



>ref|XP_010456117.1| PREDICTED: uncharacterized protein LOC104737601 [Camelina sativa]
Length=426

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E +GGGIR+LT+G WIDTMP WSP G LI FSSNRHNP N   F  YVVRPDG+GLRRI 
Sbjct  281  ESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPENTAAFGAYVVRPDGSGLRRIQ  340

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            +AG EGSEE  RER+NHV F+ D +W +FTANL G+TAEPV+IPNQFQPYGDLY++++DG
Sbjct  341  IAGLEGSEEAARERVNHVSFNKDGDWTVFTANLCGITAEPVAIPNQFQPYGDLYVVKVDG  400

Query  224  TGLQGLTWNGYENGT  180
            TGL+ LTWNGYE+GT
Sbjct  401  TGLRRLTWNGYEDGT  415



>gb|AJD80981.1| ABA-activated 1 protein [Lupinus luteus]
Length=647

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 125/169 (74%), Gaps = 8/169 (5%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            G +R+LT+G WIDTMP WSP G +IAFSSN HNP N + F IYVV PDG GLRRI VA  
Sbjct  481  GSLRRLTEGNWIDTMPCWSPKGDVIAFSSNMHNPENGEGFGIYVVGPDGNGLRRIEVAKG  540

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
                E  RERLNHVCFS D EW+LFTANLGGV AEPVS+PNQFQPYGDLY++RLDG+GL+
Sbjct  541  V---EAERERLNHVCFSGDGEWLLFTANLGGVQAEPVSLPNQFQPYGDLYVVRLDGSGLR  597

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLGKSG--EKLRGKFDEPLWINSD  72
             LT N YENGTP WH +   DL   S    G  +K++G+F EPLWI  +
Sbjct  598  RLTCNSYENGTPTWHDR---DLVLCSGDGDGDRDKVKGEFQEPLWITCE  643



>gb|EPS68684.1| hypothetical protein M569_06083, partial [Genlisea aurea]
Length=638

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 125/169 (74%), Gaps = 15/169 (9%)
 Frame = -1

Query  575  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  396
            GG IRQLTDG WIDTMP WSPDGKLIAFSSNRH       F IY++  DG+GLRR+  AG
Sbjct  479  GGDIRQLTDGPWIDTMPCWSPDGKLIAFSSNRHT-SKEGAFGIYLINSDGSGLRRVKFAG  537

Query  395  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  216
            ++  EE  RERLNHVCFS DSEW+LFT+N  GVTAEPVS+PN FQPYGDLY  RLDG+GL
Sbjct  538  SD--EE--RERLNHVCFSPDSEWLLFTSNFAGVTAEPVSLPNHFQPYGDLYTARLDGSGL  593

Query  215  QGLTWNGYENGTPAWHPKAEVDLARLSLGKSG----EKLRGKFDEPLWI  81
            + LT+NGYENGTPAW      D   L + K      ++L G+F+EPLW+
Sbjct  594  RRLTFNGYENGTPAW------DREFLQVSKRHAADEDELEGQFEEPLWL  636



>ref|XP_003637686.1| Protein tolB [Medicago truncatula]
 gb|KEH40586.1| translocation protein TolB [Medicago truncatula]
 gb|KEH40614.1| translocation protein TolB [Medicago truncatula]
Length=650

 Score =   206 bits (523),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 126/175 (72%), Gaps = 9/175 (5%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E+DGG +R+LT+G WIDTMP WSP G LIAFSSNRH+  N++ F IYVV  DG+G+RR+ 
Sbjct  480  EVDGG-LRRLTEGEWIDTMPCWSPKGDLIAFSSNRHDAKNSEVFGIYVVNVDGSGVRRVE  538

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            +      E   RERLNHVCFS D EW+LFTANLGGV+AEPV +PNQFQPYGDL++++LDG
Sbjct  539  IGKGVDGE---RERLNHVCFSGDGEWLLFTANLGGVSAEPVGLPNQFQPYGDLFVVKLDG  595

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLA----RLSLGKSGEKLRGKFDEPLWINSD  72
            +GL+ LT N YENGTP WH   E+ L             +KL+G F EPLWI  D
Sbjct  596  SGLRRLTCNAYENGTPTWH-HGELLLCNDGDEDGDNGDWDKLKGAFQEPLWITCD  649



>ref|XP_006840288.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
 gb|ERN01963.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
Length=652

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 128/178 (72%), Gaps = 11/178 (6%)
 Frame = -1

Query  581  LDG--GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI  408
            +DG  G IR+LT+G WIDTMP WSPDGK IAFSSNR +P +   FS+Y+  PDGT L  +
Sbjct  476  IDGEDGSIRRLTEGPWIDTMPHWSPDGKYIAFSSNRESPKSTQGFSVYLTNPDGTDLHHV  535

Query  407  HVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLD  228
            HV  A    E+ +ER+NHVCFS DS+++LFTANLG V AE +S+PNQFQPYGDLY+  LD
Sbjct  536  HVTAASAFNEMAKERINHVCFSPDSKFLLFTANLGAVNAEAISLPNQFQPYGDLYICGLD  595

Query  227  GTGLQGLTWNGYENGTPAWH-----PKAEVDLARLSLGKSGEKLRGKFDEPLWINSDF  69
            G+GL+ LT N YE+GTPAW+     P+    L  +     GE+L+G+F+EPLW+ S F
Sbjct  596  GSGLRRLTCNAYEDGTPAWNSGWWGPEPGSSLEDV----VGEELKGEFEEPLWLGSTF  649



>ref|XP_002515210.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47194.1| conserved hypothetical protein [Ricinus communis]
Length=618

 Score =   197 bits (501),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 114/139 (82%), Gaps = 3/139 (2%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            G IR LT+GA IDTMP WSP G LIAFSSNRH P +A+ FSIYV++PDG+GLRRIH+ G+
Sbjct  426  GDIRPLTEGACIDTMPCWSPKGDLIAFSSNRHKPEHANPFSIYVIKPDGSGLRRIHLEGS  485

Query  392  EGSEEVNR---ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGT  222
            E   E  R   ER+NHV FSSD EW+LFTANLGG++AEPV++P Q QPYGD+Y+ RLDG+
Sbjct  486  ERLSEEEREWMERINHVTFSSDGEWLLFTANLGGLSAEPVAVPRQIQPYGDIYVARLDGS  545

Query  221  GLQGLTWNGYENGTPAWHP  165
            GL+ LTWNGYENGTP W+P
Sbjct  546  GLRRLTWNGYENGTPVWYP  564



>ref|XP_003637684.1| Protein tolB [Medicago truncatula]
 gb|KEH40612.1| translocation protein TolB [Medicago truncatula]
Length=657

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 120/174 (69%), Gaps = 11/174 (6%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GG+R+LT+G WIDTMP WSP G LIAFSSNRH+ GN+  F IYVVR DG+GLRR+ V   
Sbjct  484  GGLRRLTEGEWIDTMPCWSPKGDLIAFSSNRHDGGNSQAFGIYVVRVDGSGLRRVEVGKG  543

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
               E   RE LNHV FS D EW+LFT NL G+TAEP SIPNQ+QPYGDL++++LDG+GL+
Sbjct  544  VDGE---REMLNHVRFSGDGEWLLFTGNLVGLTAEPASIPNQYQPYGDLFVVKLDGSGLR  600

Query  212  GLTWNGYENGTPAWH--------PKAEVDLARLSLGKSGEKLRGKFDEPLWINS  75
             LT N YENGTPAWH           + D          +KL+G F+E LWI +
Sbjct  601  RLTCNAYENGTPAWHYGDLLLSNDDDDDDDDDDGDACDWDKLKGAFEESLWITT  654



>gb|EAZ40813.1| hypothetical protein OsJ_25290 [Oryza sativa Japonica Group]
Length=594

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 108/158 (68%), Gaps = 16/158 (10%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  357
            D  P+ SP GK +              F IY+VRPDG+GLRR+HVAG  GS   +RER+N
Sbjct  449  DAFPAVSPCGKWV-------------VFRIYLVRPDGSGLRRVHVAGPAGSAAADRERIN  495

Query  356  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGTP  177
            HVCFS DS W+LFTAN GGV AEP+S PNQFQPYGDLY+ RLDG+GL  LT N YENGTP
Sbjct  496  HVCFSPDSRWLLFTANFGGVMAEPISAPNQFQPYGDLYVCRLDGSGLVRLTCNAYENGTP  555

Query  176  AWHPKAE--VDLARLSLGK-SGEKLRGKFDEPLWINSD  72
            AW P +     L  LSLG  +G++  G+FDEPLW+  D
Sbjct  556  AWGPASSPAAGLESLSLGPGAGDESLGEFDEPLWLTCD  593



>ref|XP_002985152.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
 gb|EFJ13646.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
Length=669

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 114/168 (68%), Gaps = 10/168 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GGIR LT+G W+DTMP WSPDG  IAFSS+R  P N + F+IY+V PDG+ L R+   
Sbjct  501  EDGGIRALTEGPWVDTMPCWSPDGNWIAFSSSRDGPSN-EFFAIYLVHPDGSELHRVF--  557

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                 E   R R NHVCFS DS+ +LFTA+ GG++AEPVS+ NQFQPYG+L+  +LDG+ 
Sbjct  558  ----PESSTRGRCNHVCFSPDSQTLLFTADCGGISAEPVSLANQFQPYGELFSCKLDGSE  613

Query  218  LQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINS  75
            L+  T N YE+GTP W P   + L   S+ K G++L   F + LW+++
Sbjct  614  LRRWTHNAYEDGTPCWGP---LRLDPSSISKQGQELHANFQDCLWLSA  658



>gb|ABR17080.1| unknown [Picea sitchensis]
Length=714

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 114/169 (67%), Gaps = 11/169 (7%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GG+ QLT+G W DTM +WSPDG+ IAF+S+R +PG+   F++Y + P+GTGL R+ 
Sbjct  545  EGEEGGLWQLTEGPWTDTMCNWSPDGEWIAFASDRDSPGSGG-FAMYFIHPNGTGLHRVL  603

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +   G       R+NH  FS DS+ ++FT++  GV+AEP+S+P+QFQPYG+++M R+DG
Sbjct  604  NSSTAG-------RVNHPWFSPDSKSLVFTSDYAGVSAEPISVPHQFQPYGEIFMARVDG  656

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            + LQ LT N YE+GTP+W     + +A   L   GE ++  FD+  W+ 
Sbjct  657  SELQRLTHNAYEDGTPSW---GRIFIAASDLTGEGESVKCDFDDDHWLQ  702



>ref|XP_002993240.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
 gb|EFJ05661.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
Length=717

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 106/163 (65%), Gaps = 11/163 (7%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  387
            +R+LT+GAW DTM SWS DG+ IAFSS+RHNPG    F +Y VRPDG+ L R+  +   G
Sbjct  562  LRRLTEGAWTDTMASWSHDGEWIAFSSDRHNPGGG-SFQLYFVRPDGSQLHRVLNSSTGG  620

Query  386  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGL  207
                   R+NH  FS DS  ++FT +  GV+A+P+++P QFQPYG+++M R+DG+ L  L
Sbjct  621  -------RVNHPFFSPDSRSLVFTTDYAGVSADPIAVPAQFQPYGEIFMARIDGSELVRL  673

Query  206  TWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            T N YE+GTP+W P   V L   +L   G+K R  F +  W+ 
Sbjct  674  THNAYEDGTPSWGP---VKLDSSALTGEGKKARCGFRDTRWLK  713



>ref|XP_002993781.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
 gb|EFJ05147.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
Length=722

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 106/163 (65%), Gaps = 11/163 (7%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  387
            +R+LT+GAW DTM SWS DG+ IAFSS+RHNPG    F +Y VRPDG+ L R+  +   G
Sbjct  562  LRRLTEGAWTDTMASWSHDGEWIAFSSDRHNPGGG-SFQLYFVRPDGSQLHRVLNSSTGG  620

Query  386  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGL  207
                   R+NH  FS DS  ++FT +  GV+A+P+++P QFQPYG+++M R+DG+ L  L
Sbjct  621  -------RVNHPFFSPDSRSLVFTTDYAGVSADPIAVPAQFQPYGEIFMARIDGSELVRL  673

Query  206  TWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            T N YE+GTP+W P   V L   +L   G+K R  F +  W+ 
Sbjct  674  THNAYEDGTPSWGP---VKLDSSALTGEGKKARCGFRDTRWLK  713



>dbj|BAJ88545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=706

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 103/140 (74%), Gaps = 8/140 (6%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GGIR+LTDG W DTM +WSPDG+ IAF+S+RHNPG    F+IY+V P+ TGLRR+ 
Sbjct  525  EGEAGGIRRLTDGPWTDTMCNWSPDGEWIAFASDRHNPGGG-SFAIYMVHPNSTGLRRV-  582

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
            V  A+G       R NH  FS DS+ ++FT++L  V+AEP+S P+ +QPYG+++ + +DG
Sbjct  583  VHSADGG------RTNHPWFSPDSKRMVFTSDLAAVSAEPISNPHHYQPYGEIFTINIDG  636

Query  224  TGLQGLTWNGYENGTPAWHP  165
            +GLQ LT N +E+GTP+W P
Sbjct  637  SGLQRLTHNSFEDGTPSWTP  656



>ref|XP_003630471.1| Protein tolB [Medicago truncatula]
 gb|KEH35326.1| DPP6 amino-terminal domain protein [Medicago truncatula]
Length=684

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 114/168 (68%), Gaps = 11/168 (7%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            +  G+++LT+G W DTM +WSPDG+ IAF+S+RH+PG+   F IY++ PDGTGLR++  +
Sbjct  512  EKNGLKRLTEGPWSDTMCNWSPDGEWIAFASDRHDPGSG-SFEIYLIHPDGTGLRKLIHS  570

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G+ G       R NH  FS D + ++FT++  G++AEP+S P+ +QPYG+++ +RLDG+G
Sbjct  571  GSGG-------RTNHPYFSPDGKSMVFTSDYAGISAEPISNPHHYQPYGEIFTVRLDGSG  623

Query  218  LQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINS  75
            L  LT N YE+GTPAW PK  +    + + K G      F++  W+N+
Sbjct  624  LTRLTHNSYEDGTPAWSPKY-IKPVNVEMPKGGPYC--SFEDCHWLNN  668



>ref|XP_007137456.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
 gb|ESW09450.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
Length=683

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 100/136 (74%), Gaps = 8/136 (6%)
 Frame = -1

Query  569  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  390
            G+R+LT+G W DTM +WSPDGK IAF+S+RH PG+   F++Y++  DG+GLR++  +G+ 
Sbjct  521  GLRRLTEGPWTDTMCNWSPDGKWIAFASDRHAPGSG-SFALYLIEADGSGLRKVFESGSG  579

Query  389  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQG  210
            G       R NH  FS D + + FT++  G++AEP+S P+ +QPYG+++ +RLDG+G+Q 
Sbjct  580  G-------RTNHPYFSPDGKSLTFTSDYAGISAEPISNPHHYQPYGEIFSVRLDGSGIQR  632

Query  209  LTWNGYENGTPAWHPK  162
            LT N YE+GTPAW PK
Sbjct  633  LTHNSYEDGTPAWSPK  648



>ref|XP_007019162.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
 gb|EOY16387.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
Length=710

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 100/140 (71%), Gaps = 8/140 (6%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GG+R+LT+G W DTM +WSPDG  IAF+S+R NPG+   F +Y++ P+GTGLRR+ 
Sbjct  533  EGEAGGLRRLTEGPWTDTMCNWSPDGDWIAFASDRDNPGSG-SFELYLIHPNGTGLRRLV  591

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G+ G       R NH  FS D  +V+FT++  G++AEP+S P+ +QPYG+++ ++LDG
Sbjct  592  KSGSAG-------RANHPSFSPDGTYVVFTSDFAGISAEPISNPHHYQPYGEIFTIKLDG  644

Query  224  TGLQGLTWNGYENGTPAWHP  165
            + L+ LT N YE+GTP W P
Sbjct  645  SDLKRLTHNSYEDGTPTWAP  664



>ref|XP_006434259.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
 gb|ESR47499.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
Length=721

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 104/139 (75%), Gaps = 8/139 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            +G G+ +LT+G W DTM +WSPDG+ IAF+S+R+NPG+   F +Y++ P+GTGLR++  +
Sbjct  546  EGYGLHRLTEGPWSDTMCNWSPDGEWIAFASDRYNPGSG-SFEMYLIHPNGTGLRKLIQS  604

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G+ G       R NH  FS D + ++FT++ GG++AEP+S P+Q+QPYG+++ ++LDG+ 
Sbjct  605  GSAG-------RANHPYFSPDGKSIVFTSDYGGISAEPISTPHQYQPYGEIFKIKLDGSD  657

Query  218  LQGLTWNGYENGTPAWHPK  162
            L+ LT N +E+GTPAW P+
Sbjct  658  LKRLTQNSFEDGTPAWGPR  676



>ref|XP_003527947.1| PREDICTED: uncharacterized protein LOC100791865 [Glycine max]
Length=723

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 112/163 (69%), Gaps = 13/163 (8%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  387
            +R+LT+G W DTM +WSPDG+ IAF+S+RH+PG+   F IY++ P+GTGLR++  +G+ G
Sbjct  554  LRRLTEGPWTDTMCNWSPDGEWIAFASDRHDPGSG-SFEIYLIHPNGTGLRKLIQSGSGG  612

Query  386  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGL  207
                   R NH  FS D + + FT++  G++AEP+S P+ +QPYG+++ +RLDG+G++ L
Sbjct  613  -------RTNHPYFSPDGKSLTFTSDYAGISAEPISNPHHYQPYGEIFTVRLDGSGIKRL  665

Query  206  TWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            T N YE+GTPAW PK    +  +++ K G      FD+  W+N
Sbjct  666  THNSYEDGTPAWSPKY---MPPVNVPKGGPYC--SFDDCHWLN  703



>ref|XP_003562684.2| PREDICTED: uncharacterized protein LOC100824160 [Brachypodium 
distachyon]
Length=745

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 102/138 (74%), Gaps = 8/138 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GGI +LT+G W DTM +WSPDG+ IAF+S+RHNPG    F+IY++ P+GTGLRR+ V 
Sbjct  569  EAGGIHRLTNGPWSDTMCNWSPDGEWIAFASDRHNPGGG-SFAIYLIHPNGTGLRRL-VH  626

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
             A+G       R NH  FS DS+ ++FT++L  V+AEP+S P+ +QPYG+++ + +DG+G
Sbjct  627  SADGG------RTNHPWFSPDSKSIVFTSDLAAVSAEPISNPHHYQPYGEIFTINIDGSG  680

Query  218  LQGLTWNGYENGTPAWHP  165
            LQ LT N +E+GTP+W P
Sbjct  681  LQRLTHNSFEDGTPSWTP  698



>gb|KFK44274.1| hypothetical protein AALP_AA1G237000 [Arabis alpina]
Length=703

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 102/139 (73%), Gaps = 8/139 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+  LT+GAW DTM +WSPDG+ IAF+S+R NPG+   F ++++ P+GTGLR++  +
Sbjct  535  EAGGLWSLTEGAWSDTMCTWSPDGEWIAFASDRENPGSG-SFELFLIHPNGTGLRKLIQS  593

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G+ G       R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ 
Sbjct  594  GSGG-------RTNHPIFSPDSKTIVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSN  646

Query  218  LQGLTWNGYENGTPAWHPK  162
            L+ LT N YE+GTPAW P+
Sbjct  647  LRRLTHNSYEDGTPAWAPR  665



>ref|XP_008644344.1| PREDICTED: uncharacterized protein LOC103625729 [Zea mays]
 gb|AFW67030.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=689

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 113/171 (66%), Gaps = 18/171 (11%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GGIR+LT+G W DTM +WSPDG+ IAF+S+RHNPG    F+IY+V P+GTGLRR+ V 
Sbjct  519  EAGGIRRLTEGPWSDTMCNWSPDGEWIAFASDRHNPGGG-SFAIYMVHPNGTGLRRV-VH  576

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
             A+G       R NH  FS DS+ ++FT++   V+AEP+S P+ +QPYG+++ + +DG+G
Sbjct  577  SADGG------RTNHPWFSPDSKTLVFTSDYAAVSAEPISNPHHYQPYGEIFTVNIDGSG  630

Query  218  LQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGK----FDEPLWIN  78
            ++ LT N +E+GTP+W P        L     GE L+      F++  W+N
Sbjct  631  IRRLTHNSFEDGTPSWTPY------HLKAEDVGETLQASGTCAFEDCHWLN  675



>gb|KDO80522.1| hypothetical protein CISIN_1g004971mg [Citrus sinensis]
Length=721

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 103/139 (74%), Gaps = 8/139 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            +G G+ +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F +Y++ P+GTGLR++  +
Sbjct  546  EGYGLHRLTEGPWSDTMCNWSPDGEWIAFASDRDNPGSG-SFEMYLIHPNGTGLRKLIQS  604

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G+ G       R NH  FS D + ++FT++ GG++AEP+S P+Q+QPYG+++ ++LDG+ 
Sbjct  605  GSAG-------RANHPYFSPDGKSIVFTSDYGGISAEPISTPHQYQPYGEIFKIKLDGSD  657

Query  218  LQGLTWNGYENGTPAWHPK  162
            L+ LT N +E+GTPAW P+
Sbjct  658  LKRLTQNSFEDGTPAWGPR  676



>ref|XP_006304666.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
 gb|EOA37564.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
Length=708

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 101/137 (74%), Gaps = 8/137 (6%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GG+ +LT+GAW DTM +WSPDG+ IAF+S+R NPG+   F ++++ P+GTGL+++  +G 
Sbjct  542  GGLWRLTEGAWTDTMCNWSPDGEWIAFASDRENPGSG-SFELFLIHPNGTGLKKLIQSGT  600

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
             G       R NH  FS DS+ ++FT++  G++AEP+S P+ FQPYGD++ ++LDG+ L+
Sbjct  601  GG-------RTNHPVFSPDSKSLVFTSDYAGISAEPISNPHHFQPYGDIFTVKLDGSNLR  653

Query  212  GLTWNGYENGTPAWHPK  162
             LT N YE+GTPAW P+
Sbjct  654  RLTHNSYEDGTPAWSPR  670



>ref|XP_006472827.1| PREDICTED: uncharacterized protein LOC102617553 [Citrus sinensis]
Length=721

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 103/139 (74%), Gaps = 8/139 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            +G G+ +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F +Y++ P+GTGLR++  +
Sbjct  546  EGYGLHRLTEGPWSDTMCNWSPDGEWIAFASDRDNPGSG-SFEMYLIHPNGTGLRKLIQS  604

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G+ G       R NH  FS D + ++FT++ GG++AEP+S P+Q+QPYG+++ ++LDG+ 
Sbjct  605  GSAG-------RANHPYFSPDGKSIVFTSDYGGISAEPISTPHQYQPYGEIFKIKLDGSD  657

Query  218  LQGLTWNGYENGTPAWHPK  162
            L+ LT N +E+GTPAW P+
Sbjct  658  LKRLTQNSFEDGTPAWGPR  676



>emb|CDY08186.1| BnaA06g15400D [Brassica napus]
Length=667

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 116/169 (69%), Gaps = 10/169 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+GAW DTM SWSPDG+ IAF+S+R +PG+   + ++++ P+GTGLR++  +
Sbjct  499  ETGGLWKLTEGAWTDTMCSWSPDGEWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQS  557

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ 
Sbjct  558  GTGG-------RTNHPIFSPDSKSIVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSN  610

Query  218  LQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINSD  72
            L+ LT N YE+GTPAW P+  ++ + + L K  +     F++  W+N +
Sbjct  611  LRRLTHNSYEDGTPAWAPRF-INPSDVVLRKKNDS-SCAFEDCHWLNKN  657



>emb|CDX84088.1| BnaC08g07650D [Brassica napus]
Length=668

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 116/169 (69%), Gaps = 10/169 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+GAW DTM SWSPDG+ IAF+S+R +PG+   + ++++ P+GTGLR++  +
Sbjct  500  ETGGLWKLTEGAWTDTMCSWSPDGEWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQS  558

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ 
Sbjct  559  GTGG-------RTNHPIFSPDSKSIVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSN  611

Query  218  LQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINSD  72
            L+ LT N YE+GTPAW P+  ++ + + L K  +     F++  W+N +
Sbjct  612  LRRLTHNSYEDGTPAWAPRF-INPSDVVLRKKNDS-SCAFEDCHWLNKN  658



>emb|CDY04662.1| BnaC05g17000D [Brassica napus]
Length=706

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 115/169 (68%), Gaps = 10/169 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+GAW DTM SWSPDG+ IAF+S+R +PG+   + ++++ P+GTGLR++  +
Sbjct  537  ETGGLWKLTEGAWTDTMCSWSPDGEWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQS  595

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ 
Sbjct  596  GTGG-------RTNHPIFSPDSKSIVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSN  648

Query  218  LQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINSD  72
            L+ LT N YE+GTPAW P+  +D   + L +  +     F++  W+N +
Sbjct  649  LRRLTHNSYEDGTPAWAPRF-IDPNDVVLRRKNDS-SCAFEDCHWLNKN  695



>emb|CDP10971.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 104/145 (72%), Gaps = 8/145 (6%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GG+ +LT+G W DTM +WSPDG+ I F+S+R NPG+   F +++V P+GTGL ++ 
Sbjct  547  EGEAGGLYRLTEGPWSDTMCNWSPDGEWILFASDRENPGSG-TFELFMVHPNGTGLHKLV  605

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G+ G       R NH CFS D ++V+FT++  GV+AEP+S P+ +QPYG++++++ DG
Sbjct  606  QSGSGG-------RANHPCFSPDGKYVVFTSDYAGVSAEPISNPHHYQPYGEIFVIKSDG  658

Query  224  TGLQGLTWNGYENGTPAWHPKAEVD  150
            +G++ LT N YE+GTPAW PK   D
Sbjct  659  SGIRRLTHNSYEDGTPAWGPKYMKD  683



>ref|XP_010477409.1| PREDICTED: uncharacterized protein LOC104756505 [Camelina sativa]
Length=711

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 103/139 (74%), Gaps = 8/139 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            +GGG+ +LT+GAW DTM +WSP+G+ IAF+S+R +PG+   F ++++ P+GTGLR++  +
Sbjct  543  EGGGLWRLTEGAWTDTMCNWSPNGEWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQS  601

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ 
Sbjct  602  GTGG-------RTNHPVFSPDSKSLVFTSDYAGISAEPISNPHSYQPYGDIFTVKLDGSN  654

Query  218  LQGLTWNGYENGTPAWHPK  162
            L+ LT N YE+GTPAW P+
Sbjct  655  LKRLTHNSYEDGTPAWSPR  673



>ref|XP_004981111.1| PREDICTED: uncharacterized protein LOC101776730 [Setaria italica]
Length=691

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 112/173 (65%), Gaps = 18/173 (10%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GGI +LT+G W DTM +WSPDG+ IAFSS+RHNPG    F+IY++ P+GTGLRR+ V 
Sbjct  521  EAGGIHRLTEGPWSDTMCNWSPDGEWIAFSSDRHNPGGG-SFAIYMIHPNGTGLRRV-VH  578

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
             A+G       R NH  FS DS+ ++FT++   V+AEP+S P+ +QPYG+++ + +DGTG
Sbjct  579  SADGG------RTNHPWFSPDSKTLVFTSDYAAVSAEPISNPHHYQPYGEIFTVNIDGTG  632

Query  218  LQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRG----KFDEPLWINSD  72
            ++ LT N +E+GTP+W P        L     GE L+     KF +  W+  D
Sbjct  633  IRRLTHNSFEDGTPSWTPY------YLEPEDVGETLQASGTCKFRDCHWLTVD  679



>gb|KJB29176.1| hypothetical protein B456_005G088400 [Gossypium raimondii]
Length=713

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 96/134 (72%), Gaps = 8/134 (6%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  387
            I +LTDG W DTM +WSPDG  IAFSS+RH+PG+   F +Y++ P+GTGLRR+  +G+ G
Sbjct  540  IERLTDGPWTDTMCNWSPDGDWIAFSSDRHDPGSG-SFELYMIHPNGTGLRRLLRSGSSG  598

Query  386  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGL  207
                   R+NH  F  D + ++FT + GG++AEP+S P+ +QPYG+++ M+LDG+ L+ L
Sbjct  599  -------RVNHPSFRPDGKLLVFTTDYGGISAEPISNPHHYQPYGEIFTMKLDGSDLKRL  651

Query  206  TWNGYENGTPAWHP  165
            T N YE+GTP W P
Sbjct  652  THNSYEDGTPTWAP  665



>ref|XP_009149686.1| PREDICTED: uncharacterized protein LOC103873010 [Brassica rapa]
Length=705

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 116/169 (69%), Gaps = 10/169 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+GAW DTM SWSPDG+ IAF+S+R +PG+   + ++++ P+GTGLR++  +
Sbjct  537  ETGGLWKLTEGAWTDTMCSWSPDGEWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQS  595

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ 
Sbjct  596  GTGG-------RTNHPIFSPDSKSIVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSN  648

Query  218  LQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINSD  72
            L+ LT N YE+GTPAW P+  ++ + + L K  +     F++  W+N +
Sbjct  649  LRRLTHNSYEDGTPAWAPRF-INPSDVVLRKKNDS-SCAFEDCHWLNKN  695



>emb|CBI18981.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 96/139 (69%), Gaps = 8/139 (6%)
 Frame = -1

Query  575  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  396
            GGGI +LT+G W DTM +WSPDG  I F+S+R NPG    F +YV+ P+GTGLR++  +G
Sbjct  372  GGGIHRLTEGPWTDTMCNWSPDGDWIVFASDRENPGGG-GFELYVIHPNGTGLRKVVHSG  430

Query  395  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  216
            + G       R NH  FS D + ++FT++   V+AEP+S  + +QPYGD++++ LDG+GL
Sbjct  431  SAG-------RTNHPWFSPDGKSIVFTSDYAAVSAEPISNAHHYQPYGDIFVVNLDGSGL  483

Query  215  QGLTWNGYENGTPAWHPKA  159
              LT N YE+GTPAW PK 
Sbjct  484  HRLTHNSYEDGTPAWAPKV  502



>ref|XP_010521281.1| PREDICTED: uncharacterized protein LOC104800217 isoform X1 [Tarenaya 
hassleriana]
Length=724

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 101/139 (73%), Gaps = 8/139 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LTDG W DTM +WSPDG+LIAF+S+R NPG+   F ++++ P+GTG+R++  +
Sbjct  555  ESGGLFRLTDGPWTDTMCNWSPDGELIAFASDRENPGSG-SFELFLIHPNGTGMRKLIQS  613

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G+ G       R NH  FS D + + FT++ G ++AEP+S P+ +QPYG+++ ++LDG+ 
Sbjct  614  GSGG-------RTNHPIFSPDGQTIAFTSDYGAISAEPISNPHHYQPYGEIFTVKLDGSD  666

Query  218  LQGLTWNGYENGTPAWHPK  162
            L+ LT N +E+GTPAW PK
Sbjct  667  LRRLTHNSFEDGTPAWAPK  685



>ref|XP_010521282.1| PREDICTED: uncharacterized protein LOC104800217 isoform X2 [Tarenaya 
hassleriana]
Length=725

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 101/139 (73%), Gaps = 8/139 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LTDG W DTM +WSPDG+LIAF+S+R NPG+   F ++++ P+GTG+R++  +
Sbjct  556  ESGGLFRLTDGPWTDTMCNWSPDGELIAFASDRENPGSG-SFELFLIHPNGTGMRKLIQS  614

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G+ G       R NH  FS D + + FT++ G ++AEP+S P+ +QPYG+++ ++LDG+ 
Sbjct  615  GSGG-------RTNHPIFSPDGQTIAFTSDYGAISAEPISNPHHYQPYGEIFTVKLDGSD  667

Query  218  LQGLTWNGYENGTPAWHPK  162
            L+ LT N +E+GTPAW PK
Sbjct  668  LRRLTHNSFEDGTPAWAPK  686



>ref|XP_006351203.1| PREDICTED: uncharacterized protein LOC102604753 [Solanum tuberosum]
Length=696

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 101/140 (72%), Gaps = 8/140 (6%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GG+R+LT+G W DTM +WSPDG+ IAF+S+R NPG+   F +Y++ P+GTGL+++ 
Sbjct  516  EGEAGGLRRLTEGPWTDTMCNWSPDGEWIAFASDRENPGSG-SFEMYMIHPNGTGLKKVI  574

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G  G       R NH  FS D ++++FT++   V+AEP+S P+ +QPYGD+Y+++ DG
Sbjct  575  QSGMGG-------RTNHPYFSPDGKYIVFTSDYAAVSAEPISNPHHYQPYGDIYVIKSDG  627

Query  224  TGLQGLTWNGYENGTPAWHP  165
            + ++ LT N YE+GTPAW P
Sbjct  628  SDIRRLTHNSYEDGTPAWGP  647



>ref|XP_002890452.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66711.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
Length=706

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 102/139 (73%), Gaps = 8/139 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+GAW DTM +WSPDG+ IAF+S+R +PG+   F ++++ P+GTGLR++  +
Sbjct  538  ESGGLWRLTEGAWTDTMCNWSPDGEWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQS  596

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ 
Sbjct  597  GTGG-------RTNHPIFSPDSKSLVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSN  649

Query  218  LQGLTWNGYENGTPAWHPK  162
            L+ LT N YE+GTPAW P+
Sbjct  650  LRRLTHNSYEDGTPAWAPR  668



>ref|XP_004502520.1| PREDICTED: uncharacterized protein LOC101497096 [Cicer arietinum]
Length=683

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 113/170 (66%), Gaps = 11/170 (6%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E +  G+R+LT+G W DTM +WSPDG+ IAF+S+R +PG+   F +Y++ P+GTGL+++ 
Sbjct  514  EGEKKGLRRLTEGPWTDTMCNWSPDGEWIAFASDRDDPGSG-SFELYLIHPNGTGLKKLI  572

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G+ G       R NH  FS D + ++FT++  G++AEP+S P+ +QPYG+++ +RLDG
Sbjct  573  QSGSGG-------RTNHPYFSPDGKSIVFTSDYSGISAEPISNPHAYQPYGEIFTVRLDG  625

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINS  75
            +GL  LT N YE+GTPAW PK  +    +   K G      FD+  W+N+
Sbjct  626  SGLTRLTHNSYEDGTPAWSPKY-IKPVNVERPKGGPYC--SFDDCHWLNN  672



>ref|NP_564147.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
 gb|AAD41421.1|AC007727_10 ESTs gb|N96028, gb|F14286, gb|T20680, gb|F14443, gb|AA657300 
and gb|N65244 come from this gene [Arabidopsis thaliana]
 gb|AAK76710.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13226.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30138.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
Length=706

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 114/167 (68%), Gaps = 10/167 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+GAW DTM +WSPDG+ IAF+S+R +PG+   F ++++ P+GTGLR++  +
Sbjct  538  ESGGLWRLTEGAWTDTMCNWSPDGEWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQS  596

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ 
Sbjct  597  GTGG-------RTNHPIFSPDSKSLVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSN  649

Query  218  LQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            ++ LT N YE+GTPAW P+  +    + L +  +  R  F++  W+N
Sbjct  650  VRRLTHNSYEDGTPAWAPRF-IHPNNVELQRRNDS-RCSFEDCHWLN  694



>ref|XP_010270269.1| PREDICTED: uncharacterized protein LOC104606655 [Nelumbo nucifera]
Length=728

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 110/171 (64%), Gaps = 14/171 (8%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GG+R+LT+G W DTM SWSPDG+ IAF+S+R NPG    F++Y++ P+GTGL ++ 
Sbjct  526  EGEKGGLRRLTEGPWTDTMCSWSPDGEWIAFASDRDNPGGGG-FALYLIHPNGTGLMKVV  584

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G  G       R NH  FS D   ++FT++  GV+AEP+S P+ +QPYG++++ R DG
Sbjct  585  HSGEGG-------RTNHPSFSPDGRSIVFTSDYVGVSAEPISNPHHYQPYGEIFIARSDG  637

Query  224  TGLQGLTWNGYENGTPAWHPK--AEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            +G++ LT N YE+GTPAW P      D+     G+ G      FD+  W+N
Sbjct  638  SGIKRLTHNSYEDGTPAWGPTFMRPADVVESPFGEPG----CSFDDCHWLN  684



>gb|EAZ29242.1| hypothetical protein OsJ_13305 [Oryza sativa Japonica Group]
Length=688

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 100/138 (72%), Gaps = 8/138 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GGIR+LT+G W DTM +WSPDG+ IAF+S+RH PG+   F+IY+V P+GTGLRR+  +
Sbjct  516  EAGGIRRLTEGPWSDTMCNWSPDGEWIAFASDRHAPGSG-SFAIYMVHPNGTGLRRVVHS  574

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FS DS+ ++FT++   V+AEPVS P+ +QPYG+++ + +DG+ 
Sbjct  575  GGSG-------RTNHPWFSPDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIFTVDIDGSN  627

Query  218  LQGLTWNGYENGTPAWHP  165
            ++ LT N +E+GTP+W P
Sbjct  628  IRRLTHNSFEDGTPSWTP  645



>ref|NP_001051846.1| Os03g0840200 [Oryza sativa Japonica Group]
 gb|AAT77013.1| putative F8K7.10 protein [Oryza sativa Japonica Group]
 gb|ABF99802.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13760.1| Os03g0840200 [Oryza sativa Japonica Group]
 dbj|BAG90604.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94589.1| unnamed protein product [Oryza sativa Japonica Group]
Length=688

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 100/138 (72%), Gaps = 8/138 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GGIR+LT+G W DTM +WSPDG+ IAF+S+RH PG+   F+IY+V P+GTGLRR+  +
Sbjct  516  EAGGIRRLTEGPWSDTMCNWSPDGEWIAFASDRHAPGSG-SFAIYMVHPNGTGLRRVVHS  574

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FS DS+ ++FT++   V+AEPVS P+ +QPYG+++ + +DG+ 
Sbjct  575  GGSG-------RTNHPWFSPDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIFTVDIDGSN  627

Query  218  LQGLTWNGYENGTPAWHP  165
            ++ LT N +E+GTP+W P
Sbjct  628  IRRLTHNSFEDGTPSWTP  645



>ref|XP_006416277.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
 gb|ESQ34630.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
Length=713

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 101/139 (73%), Gaps = 8/139 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            +  G+ +LT+GAW DTM SWSPDG+ IAF+S+R +PG+   F ++++ P+GTGLR++  +
Sbjct  542  ETSGLWRLTEGAWTDTMCSWSPDGEWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQS  600

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G+ G       R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ 
Sbjct  601  GSGG-------RTNHPIFSPDSKSIVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSN  653

Query  218  LQGLTWNGYENGTPAWHPK  162
            L+ LT N YE+GTP W P+
Sbjct  654  LRRLTHNSYEDGTPVWAPR  672



>ref|XP_002520326.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42112.1| conserved hypothetical protein [Ricinus communis]
Length=708

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 113/169 (67%), Gaps = 11/169 (7%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GG+ +LT+G W DTM SWS DG+ IAF+S+R NPG+A  F ++++ P+GTGL+R+ 
Sbjct  530  EGEKGGLYRLTEGPWGDTMCSWSIDGEWIAFASDRENPGSA-SFELFLIHPNGTGLKRLV  588

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G  G       R NH  FS D + ++FT + GG++AEP+S P+ FQPYG++Y ++LDG
Sbjct  589  KSGLGG-------RTNHPYFSPDGKSIVFTTDYGGISAEPISNPHHFQPYGEIYTVKLDG  641

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            + L+ LT N +E+GTPAW P A ++   L   K G +    FD+  W++
Sbjct  642  SDLKRLTHNSFEDGTPAWGP-AYIEPVDLEWPKYGPQC--SFDDCHWLS  687



>ref|XP_011027475.1| PREDICTED: uncharacterized protein LOC105127763 [Populus euphratica]
Length=712

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 111/169 (66%), Gaps = 11/169 (7%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GG+ +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F ++++ P+GTGLR++ 
Sbjct  531  EGENGGLYRLTEGPWSDTMCNWSPDGEWIAFASDRENPGSG-SFELFLIHPNGTGLRKLV  589

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G+ G       R+NH  FS D   + FT++ GG++AEP+S P+ +QPYG+++ ++LDG
Sbjct  590  QSGSAG-------RVNHPYFSPDGNSIAFTSDYGGISAEPISNPHHYQPYGEIFTVKLDG  642

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            + L+ LT N YE+GTPAW P     +    +   G   +  F+E  W+N
Sbjct  643  SDLKRLTHNSYEDGTPAWGPTY---IKPKDVEWPGHGPQCSFEECHWLN  688



>ref|XP_011027472.1| PREDICTED: uncharacterized protein LOC105127760 [Populus euphratica]
Length=712

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 111/169 (66%), Gaps = 11/169 (7%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GG+ +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F ++++ P+GTGLR++ 
Sbjct  531  EGENGGLYRLTEGPWSDTMCNWSPDGEWIAFASDRENPGSG-SFELFLIHPNGTGLRKLV  589

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G+ G       R+NH  FS D   + FT++ GG++AEP+S P+ +QPYG+++ ++LDG
Sbjct  590  QSGSAG-------RVNHPYFSPDGNSIAFTSDYGGISAEPISNPHHYQPYGEIFTVKLDG  642

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            + L+ LT N YE+GTPAW P     +    +   G   +  F+E  W+N
Sbjct  643  SDLKRLTHNSYEDGTPAWGPTY---IKPKDVEWPGHGPQCSFEECHWLN  688



>ref|XP_006386357.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
 gb|ERP64154.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
Length=712

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 111/169 (66%), Gaps = 11/169 (7%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GG+ +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F ++++ P+GTGLR++ 
Sbjct  531  EGENGGLYRLTEGPWSDTMCNWSPDGEWIAFASDRENPGSG-SFELFLIHPNGTGLRKLV  589

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G+ G       R NH  FS D   ++FT++ GG++AEP+S P+ +QPYG+++ ++LDG
Sbjct  590  QSGSAG-------RANHPYFSPDGNSIVFTSDYGGISAEPISNPHHYQPYGEIFTVKLDG  642

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            + L+ LT N YE+GTPAW P     +    +   G   +  F+E  W+N
Sbjct  643  SDLKRLTHNSYEDGTPAWGPTY---IKPEDVEWPGHGPQCSFEECHWLN  688



>ref|XP_010672499.1| PREDICTED: uncharacterized protein LOC104889058 [Beta vulgaris 
subsp. vulgaris]
Length=700

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 111/165 (67%), Gaps = 11/165 (7%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GGIR+LT+G W DTM +WSPDG+ IAFSS+R NPG+   F I+++ P+GTGL ++  +G 
Sbjct  546  GGIRRLTEGPWSDTMCNWSPDGEWIAFSSDRENPGSG-SFEIFMMHPNGTGLHKVIQSGI  604

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
             G       R NH  FS D + ++FT++ GGV+AEP+S P+ +QPYG++++ ++DG+ ++
Sbjct  605  GG-------RANHPWFSPDGKSIVFTSDYGGVSAEPISNPHHYQPYGEIFIAKVDGSDIR  657

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
             LT N YE+GTP W P   + L+ + + +   + +  F +  W+N
Sbjct  658  RLTHNSYEDGTPTWGP---MFLSPIDVAEPTSEPKCLFQDCHWLN  699



>ref|XP_002285876.2| PREDICTED: uncharacterized protein LOC100267814 [Vitis vinifera]
Length=715

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 95/138 (69%), Gaps = 8/138 (6%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GGI +LT+G W DTM +WSPDG  I F+S+R NPG    F +YV+ P+GTGLR++  +G+
Sbjct  539  GGIHRLTEGPWTDTMCNWSPDGDWIVFASDRENPGGGG-FELYVIHPNGTGLRKVVHSGS  597

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
             G       R NH  FS D + ++FT++   V+AEP+S  + +QPYGD++++ LDG+GL 
Sbjct  598  AG-------RTNHPWFSPDGKSIVFTSDYAAVSAEPISNAHHYQPYGDIFVVNLDGSGLH  650

Query  212  GLTWNGYENGTPAWHPKA  159
             LT N YE+GTPAW PK 
Sbjct  651  RLTHNSYEDGTPAWAPKV  668



>emb|CAN73514.1| hypothetical protein VITISV_037210 [Vitis vinifera]
Length=715

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 95/138 (69%), Gaps = 8/138 (6%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GGI +LT+G W DTM +WSPDG  I F+S+R NPG    F +YV+ P+GTGLR++  +G+
Sbjct  539  GGIHRLTEGPWTDTMCNWSPDGDWIVFASDRENPGGGG-FELYVIHPNGTGLRKVVHSGS  597

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
             G       R NH  FS D + ++FT++   V+AEP+S  + +QPYGD++++ LDG+GL 
Sbjct  598  AG-------RTNHPWFSPDGKSIVFTSDYAAVSAEPISNAHHYQPYGDIFVVNLDGSGLH  650

Query  212  GLTWNGYENGTPAWHPKA  159
             LT N YE+GTPAW PK 
Sbjct  651  RLTHNSYEDGTPAWAPKV  668



>ref|XP_002466125.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
 gb|EER93123.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
Length=690

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 110/171 (64%), Gaps = 18/171 (11%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            +  GIR+LT+G W DTM +WSPDG+ IAF+S+RHNPG    F IY+V P+GTGLRR+ V 
Sbjct  520  EASGIRRLTEGPWSDTMCNWSPDGEWIAFASDRHNPGGG-SFGIYMVHPNGTGLRRV-VH  577

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
              +G       R NH  FS DS+ ++FT++   V+AEP+S P+ +QPYG+++ + +DG+G
Sbjct  578  STDGG------RTNHPWFSPDSKTLVFTSDYAAVSAEPISNPHHYQPYGEIFTVNIDGSG  631

Query  218  LQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGK----FDEPLWIN  78
            ++ LT N +E+GTP+W P        L     GE L+      F++  W+N
Sbjct  632  IRRLTHNSFEDGTPSWTPH------YLKPEDVGETLQASGTCAFEDCHWLN  676



>gb|KDP32822.1| hypothetical protein JCGZ_12114 [Jatropha curcas]
Length=699

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 112/169 (66%), Gaps = 11/169 (7%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GGI +LT+G W DTM +WSPDG+ IAF+S+R +PG+   F +Y++ P+GTGLR++ 
Sbjct  525  EGEKGGIHRLTEGPWSDTMCNWSPDGEWIAFASDREDPGSG-SFELYLIHPNGTGLRKLV  583

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G  G       R NH  FS D + V+FT +  G++AEP+S P+ +QPYG++Y ++LDG
Sbjct  584  QSGLGG-------RTNHPYFSPDGKSVVFTTDYAGISAEPISNPHHYQPYGEIYTIKLDG  636

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            + L+ LT N +E+GTPAW P   + +    +    E+ + +F++  W+N
Sbjct  637  SDLKRLTHNSFEDGTPAWGP---IYIEPNDVEWPNERPQCQFEDCHWLN  682



>emb|CDP10970.1| unnamed protein product [Coffea canephora]
Length=715

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 101/138 (73%), Gaps = 8/138 (6%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GG+ +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F +++V P+GTGL ++ 
Sbjct  544  EGETGGLSRLTEGPWSDTMCNWSPDGEWIAFASDRENPGSG-SFELFMVHPNGTGLHKLI  602

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G+ G       R NH  FS DS++V+FT++  GV+AEP+S P+ +QPYGD+++++ DG
Sbjct  603  QSGSGG-------RTNHPWFSPDSKYVVFTSDYAGVSAEPISNPHHYQPYGDIFVIKSDG  655

Query  224  TGLQGLTWNGYENGTPAW  171
            +G++ LT N YE+GTP W
Sbjct  656  SGIRRLTHNSYEDGTPTW  673



>ref|XP_009411896.1| PREDICTED: uncharacterized protein LOC103993528 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 111/173 (64%), Gaps = 18/173 (10%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E +  GI +LT+G W DTM +WSPDG+ IAF+S+R NPG    F+IY+V P+GTGLRR+ 
Sbjct  542  EGESAGIHRLTEGPWSDTMCNWSPDGEWIAFASDRDNPGGG-SFAIYMVHPNGTGLRRVV  600

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G+ G       R NH  FS DS+ ++FT++ G V+AEP+S P+ +QPYG+++ + +DG
Sbjct  601  HSGSGG-------RTNHPWFSPDSKSLVFTSDYGAVSAEPISNPHHYQPYGEIFTVGIDG  653

Query  224  TGLQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRG----KFDEPLWIN  78
            + ++ LT N +E+GTP W P        L      E L+G    +FD+  W+N
Sbjct  654  SDIRRLTHNSFEDGTPTWTPYF------LEPADVAESLQGSAWCEFDDCHWLN  700



>gb|EAY92514.1| hypothetical protein OsI_14253 [Oryza sativa Indica Group]
Length=682

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 99/138 (72%), Gaps = 8/138 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GGIR+LT+G W DTM +WSPDG+ IAF+S+RH PG+   F+IY+V P+GTGLRR+  +
Sbjct  510  EAGGIRRLTEGPWSDTMCNWSPDGEWIAFASDRHAPGSG-SFAIYMVHPNGTGLRRVVHS  568

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  F  DS+ ++FT++   V+AEPVS P+ +QPYG+++ + +DG+ 
Sbjct  569  GDGG-------RTNHPWFGPDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIFTVHIDGSN  621

Query  218  LQGLTWNGYENGTPAWHP  165
            ++ LT N +E+GTP+W P
Sbjct  622  IRRLTHNSFEDGTPSWTP  639



>ref|XP_010498624.1| PREDICTED: uncharacterized protein LOC104776288 [Camelina sativa]
Length=710

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 100/139 (72%), Gaps = 8/139 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W DTM +WSPDG+ IAF+S+R +PG+   F ++++ P+GTG+R++  +
Sbjct  542  ESGGLWRLTEGVWTDTMCNWSPDGEWIAFASDRESPGSG-SFELFLIHPNGTGIRKLIQS  600

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FS DS+ ++FT++  G++ EP+S P+ +QPYGD++ ++LDG+ 
Sbjct  601  GTGG-------RTNHPVFSPDSKSLVFTSDYAGISGEPISNPHSYQPYGDIFTVKLDGSN  653

Query  218  LQGLTWNGYENGTPAWHPK  162
            L+ LT N YE+GTPAW P+
Sbjct  654  LRRLTHNSYEDGTPAWSPR  672



>ref|XP_011069633.1| PREDICTED: uncharacterized protein LOC105155456 [Sesamum indicum]
Length=688

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 109/167 (65%), Gaps = 11/167 (7%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + G + +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F ++ + P+GTGL+++  +
Sbjct  517  EAGWLYRLTEGQWTDTMCNWSPDGEWIAFASDRENPGSG-SFELFKIHPNGTGLQKVIHS  575

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FS D  +++ T++  GV+AEP++ P+ +QPYGD++++R DG+G
Sbjct  576  GVGG-------RTNHPWFSPDGNYIVLTSDYAGVSAEPIANPHHYQPYGDIFVIRADGSG  628

Query  218  LQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            ++ LT N YE+GTPAW PK  +  A +     G K    FD+  W+N
Sbjct  629  IRRLTHNSYEDGTPAWSPKF-LSPANVEWPNGGSKC--SFDDCHWLN  672



>ref|XP_008466749.1| PREDICTED: uncharacterized protein LOC103504088 [Cucumis melo]
Length=703

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 96/139 (69%), Gaps = 8/139 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            +  G+R+LT+G W DTM SWSPDG  IAFSS+R NPG A  F ++++ P+GTGLR++  +
Sbjct  528  ESKGLRRLTEGLWTDTMCSWSPDGDWIAFSSDRENPG-AGSFDLFLIHPNGTGLRKLFQS  586

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  +  D + ++FT +  G++AEPVS P+ +QPYG++Y ++LDG+ 
Sbjct  587  GLGG-------RANHPNWRPDGKALVFTTDNAGISAEPVSNPHHYQPYGEIYTIKLDGSD  639

Query  218  LQGLTWNGYENGTPAWHPK  162
            LQ LT N YE+GTP W P+
Sbjct  640  LQRLTHNSYEDGTPTWSPR  658



>ref|XP_004249849.1| PREDICTED: uncharacterized protein LOC101257324 [Solanum lycopersicum]
Length=675

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 97/136 (71%), Gaps = 8/136 (6%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GG+R LT+G W DTM +WSPD + IAF+S+R NPG+   F +Y++ P+GTGL+++  +G 
Sbjct  504  GGLRPLTEGPWTDTMCNWSPDDEWIAFASDRENPGSG-SFEMYMIHPNGTGLKKVIQSGI  562

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
             G       R NH  FS D ++++FT++   V+AEP+S P+ +QPYGD+Y+++ DG+ ++
Sbjct  563  GG-------RTNHPYFSPDGKYIVFTSDYAAVSAEPISNPHHYQPYGDIYVIKSDGSDIR  615

Query  212  GLTWNGYENGTPAWHP  165
             LT N YE+GTPAW P
Sbjct  616  RLTHNSYEDGTPAWGP  631



>ref|XP_010269111.1| PREDICTED: uncharacterized protein LOC104605872 [Nelumbo nucifera]
Length=623

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 108/170 (64%), Gaps = 14/170 (8%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E +  G+R+LT+G W DTM +WSPDG+ IAF+S+R NPG    F+IY + P+GTGL+++ 
Sbjct  444  EGERAGVRRLTEGPWTDTMCNWSPDGEWIAFASDRDNPGGG-SFAIYFIHPNGTGLKKVV  502

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G  G       R NH  FS D + ++FT++   V+AEP++ P+ +QPYGD+++ R DG
Sbjct  503  HSGEGG-------RTNHPWFSPDGKSLVFTSDYAAVSAEPIANPHHYQPYGDIFIARSDG  555

Query  224  TGLQGLTWNGYENGTPAWHP--KAEVDLARLSLGKSGEKLRGKFDEPLWI  81
            +G++ LT N YE+GTP+W P     +D+     G      R  FD+  W+
Sbjct  556  SGIRRLTHNSYEDGTPSWGPMFMRPIDVVESPFGGP----RCSFDDCHWL  601



>ref|XP_009593179.1| PREDICTED: uncharacterized protein LOC104089880 [Nicotiana tomentosiformis]
Length=706

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 99/138 (72%), Gaps = 8/138 (6%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GG+ +LT+G+W DTM +WSPDG  IAF+S+R NPG+   F +++V P+GTGLR++ 
Sbjct  530  EGEAGGLYRLTEGSWTDTMCNWSPDGDWIAFASDRENPGSG-SFEMFMVHPNGTGLRKVI  588

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G  G       R NH  FS D ++++FT++   V+AEP+S P+ +QPYGD+++++ DG
Sbjct  589  QSGMGG-------RTNHPYFSPDGKYIVFTSDYAAVSAEPISNPHHYQPYGDIFVIKSDG  641

Query  224  TGLQGLTWNGYENGTPAW  171
            + ++ LT N YE+GTPAW
Sbjct  642  SEIRRLTHNSYEDGTPAW  659



>ref|XP_001780675.1| predicted protein [Physcomitrella patens]
 gb|EDQ54561.1| predicted protein [Physcomitrella patens]
Length=710

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 98/158 (62%), Gaps = 10/158 (6%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  387
            +R+LT+G W DTMP+WSPD + IAFSSNR +P     FS+Y++RP+GT L  +   G  G
Sbjct  526  LRRLTEGRWRDTMPAWSPDNEWIAFSSNRAHPTGERSFSLYLIRPNGTDLHMLLDTGVGG  585

Query  386  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGL  207
                      H  FS DS+ + FT+N  GV+AEP+S P+ +QPYG ++++ +DGTGL  L
Sbjct  586  LAM-------HAVFSPDSKRIAFTSNWAGVSAEPISFPHAYQPYGTIFVINIDGTGLTRL  638

Query  206  TWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDE  93
            T N YE+GTP W     + L + ++   G +    FD+
Sbjct  639  THNAYEDGTPTW---GRLPLPKPAISSDGRRSSCDFDD  673



>ref|XP_009796392.1| PREDICTED: uncharacterized protein LOC104242978 [Nicotiana sylvestris]
Length=706

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 100/140 (71%), Gaps = 8/140 (6%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GG+ +LT+G+W DTM +WSPDG  IAF+S+R NPG+   F +++V P+GTGLR++ 
Sbjct  526  EGETGGLYRLTEGSWTDTMCNWSPDGDWIAFASDRENPGSG-SFEMFMVHPNGTGLRKVI  584

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G  G       R NH  FS D ++++FT++   V+AEP++ P+ +QPYGD+++++ DG
Sbjct  585  QSGTGG-------RTNHPYFSPDGKYIVFTSDYAAVSAEPIANPHHYQPYGDIFVIKSDG  637

Query  224  TGLQGLTWNGYENGTPAWHP  165
            + ++ +T N YE+GTPAW P
Sbjct  638  SEIRRMTHNSYEDGTPAWGP  657



>ref|XP_007223068.1| hypothetical protein PRUPE_ppa003730mg [Prunus persica]
 gb|EMJ24267.1| hypothetical protein PRUPE_ppa003730mg [Prunus persica]
Length=553

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 96/135 (71%), Gaps = 8/135 (6%)
 Frame = -1

Query  569  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  390
            G+ +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F +YV+ P+GTGLR++  +G+ 
Sbjct  379  GLHRLTEGMWTDTMCNWSPDGEWIAFASDRDNPGSG-SFELYVIHPNGTGLRKVIESGSG  437

Query  389  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQG  210
            G       R NH  FS D + ++FT++ G ++AEP+S P+ +QPYG+++ + LDG+ L+ 
Sbjct  438  G-------RTNHPWFSPDGKSLVFTSDYGAISAEPISNPHHYQPYGEIFTINLDGSDLRR  490

Query  209  LTWNGYENGTPAWHP  165
            LT N YE+GTP W P
Sbjct  491  LTQNSYEDGTPVWIP  505



>ref|XP_010911317.1| PREDICTED: uncharacterized protein LOC105037336 [Elaeis guineensis]
Length=698

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 99/140 (71%), Gaps = 8/140 (6%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E D   +R+LT+G W DTM +WSPDG+ IAF+S+R NPG+   F+IY++ P+GTGLR++ 
Sbjct  526  EGDSAALRRLTEGPWSDTMCNWSPDGEWIAFASDRDNPGSG-SFAIYMIHPNGTGLRKVV  584

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G  G       R NH  FS DS+ + FT++  GV+AEP+S P+ +QPYG+++ +++DG
Sbjct  585  HSGDGG-------RTNHPWFSPDSKSLAFTSDYAGVSAEPISNPHHYQPYGEIFTVKIDG  637

Query  224  TGLQGLTWNGYENGTPAWHP  165
            + ++ LT N +E+GTP W P
Sbjct  638  SDIRRLTHNSFEDGTPTWAP  657



>ref|XP_009343980.1| PREDICTED: uncharacterized protein LOC103935890 [Pyrus x bretschneideri]
Length=689

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 97/138 (70%), Gaps = 8/138 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W DTM +WSPDG  IAF+S+R +PG+   F +YV+RP+G GLR++  +
Sbjct  519  ESGGLYRLTEGPWTDTMCNWSPDGNWIAFASDREDPGSG-SFELYVIRPNGAGLRKVIQS  577

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FS DS+ ++FT++   ++AEP+S P+ +QPYG+++ ++LDG+ 
Sbjct  578  GTGG-------RTNHPWFSPDSKSLVFTSDYRAISAEPISNPHHYQPYGEIFTVKLDGSD  630

Query  218  LQGLTWNGYENGTPAWHP  165
            L+ LT N YE+GTP W P
Sbjct  631  LKRLTQNSYEDGTPVWVP  648



>ref|XP_010063935.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104450916 
[Eucalyptus grandis]
Length=729

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 98/136 (72%), Gaps = 8/136 (6%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GG+ +LTDG W DTM +WSPDG+ IAF+S+R +PG+   FS+Y++ P+GTGLR++  +G+
Sbjct  555  GGLYRLTDGPWSDTMCNWSPDGEWIAFASDREDPGSG-SFSLYLIHPNGTGLRKLIQSGS  613

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
             G       R NH  FS D + ++FT++   V+AEP+S  + +QPYG+++ ++LDG+ L+
Sbjct  614  LG-------RANHPYFSPDGKSIVFTSDYAAVSAEPISNSHHYQPYGEIFTIKLDGSDLK  666

Query  212  GLTWNGYENGTPAWHP  165
             LT N YE+GTPAW P
Sbjct  667  RLTHNSYEDGTPAWGP  682



>gb|EYU32510.1| hypothetical protein MIMGU_mgv1a026619mg [Erythranthe guttata]
Length=716

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 110/164 (67%), Gaps = 11/164 (7%)
 Frame = -1

Query  569  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  390
            G+ QLT+G W DTMP+WSP+G+ IAF+S+R NPG+   F ++ + P+GTGL+++  +G+ 
Sbjct  545  GLYQLTEGPWSDTMPNWSPNGEWIAFASDRENPGSGG-FELFKIHPNGTGLQKVIQSGSG  603

Query  389  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQG  210
            G       R+NH  FS D + ++ T++  GV+AEP+S P+ FQPYGD+++++ DG+ ++ 
Sbjct  604  G-------RVNHPWFSPDGKHIVLTSDYAGVSAEPISNPHHFQPYGDIFVIKSDGSWIRR  656

Query  209  LTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
            LT N YE+GTP W PK+ +    +     G  L+  FD+  W+N
Sbjct  657  LTHNSYEDGTPTWIPKS-MKPGNVEWPNGG--LKCSFDDCHWLN  697



>ref|XP_004290903.2| PREDICTED: uncharacterized protein LOC101292474 [Fragaria vesca 
subsp. vesca]
Length=716

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 97/135 (72%), Gaps = 8/135 (6%)
 Frame = -1

Query  569  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  390
            G+++LT+G W DTM +WSPDG  IAF+S+R NPG+   F +YV+ P+GTGLR++  +G+ 
Sbjct  542  GLQRLTEGPWTDTMCNWSPDGDWIAFASDRENPGSG-SFELYVIHPNGTGLRKVIQSGSG  600

Query  389  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQG  210
            G       R NH  FS D + ++FT++ G ++AEP+S P+ +QPYG+++ +++DG+ L+ 
Sbjct  601  G-------RTNHPWFSPDGKSLVFTSDYGAISAEPISNPHHYQPYGEIFTVKVDGSDLRR  653

Query  209  LTWNGYENGTPAWHP  165
            LT N +E+GTP W P
Sbjct  654  LTQNSFEDGTPVWVP  668



>ref|XP_004160721.1| PREDICTED: protein TolB-like [Cucumis sativus]
Length=703

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 96/141 (68%), Gaps = 8/141 (6%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E +  G+R+LT+G W DTM SWSP+G  IAFSS+R NPG  + F ++++ P+GTGLR++ 
Sbjct  526  EGESKGLRRLTEGQWTDTMCSWSPEGDWIAFSSDRENPGGGN-FDLFLIHPNGTGLRKLF  584

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G  G       R NH  +  D + ++FT +  G++ EPVS P+ +QPYG++Y ++LDG
Sbjct  585  QSGLGG-------RANHPNWRPDGKALVFTTDNAGISGEPVSNPHHYQPYGEIYTIKLDG  637

Query  224  TGLQGLTWNGYENGTPAWHPK  162
            + LQ LT N YE+GTP W P+
Sbjct  638  SDLQRLTHNSYEDGTPTWSPR  658



>ref|XP_004149439.1| PREDICTED: protein TolB-like [Cucumis sativus]
 gb|KGN47697.1| hypothetical protein Csa_6G382360 [Cucumis sativus]
Length=703

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 95/141 (67%), Gaps = 8/141 (6%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E +  G+R+LT+G W DTM SWSP+G  IAFSS+R NPG    F ++++ P+GTGLR++ 
Sbjct  526  EGESKGLRRLTEGQWTDTMCSWSPEGDWIAFSSDRENPGGG-SFDLFLIHPNGTGLRKLF  584

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G  G       R NH  +  D + ++FT +  G++ EPVS P+ +QPYG++Y ++LDG
Sbjct  585  QSGLGG-------RANHPNWRPDGKALVFTTDNAGISGEPVSNPHHYQPYGEIYTIKLDG  637

Query  224  TGLQGLTWNGYENGTPAWHPK  162
            + LQ LT N YE+GTP W P+
Sbjct  638  SDLQRLTHNSYEDGTPTWSPR  658



>ref|XP_010095431.1| hypothetical protein L484_013388 [Morus notabilis]
 gb|EXB60123.1| hypothetical protein L484_013388 [Morus notabilis]
Length=732

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 108/165 (65%), Gaps = 11/165 (7%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GG+ +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F +Y++ P+GTGLR +  +G+
Sbjct  554  GGLHRLTEGPWTDTMCNWSPDGEWIAFASDRENPGSG-SFELYLIHPNGTGLRTLIESGS  612

Query  392  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  213
             G       R NH  FS D + + FT++  G++AEP+S P+ +QPYG+++ +  DG+ ++
Sbjct  613  GG-------RTNHPWFSPDGKKLAFTSDYAGISAEPISNPHHYQPYGEIFTVNFDGSDVR  665

Query  212  GLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  78
             LT N YE+GTP W PK    +  + +    ++ R +F++  W+N
Sbjct  666  RLTHNSYEDGTPTWVPKF---IRPVDVEWPVDRPRCEFEDLHWLN  707



>ref|XP_008338671.1| PREDICTED: uncharacterized protein LOC103401727 [Malus domestica]
Length=689

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 95/138 (69%), Gaps = 8/138 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W DTM +WSPDG  IAF+S+R +PG+   F +YV+RP+GTGLR++  +
Sbjct  519  ESGGLYRLTEGPWTDTMCNWSPDGNWIAFASDREDPGSG-SFELYVIRPNGTGLRKVIQS  577

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FS DS+ ++FT++   ++AEP+     +QPYG+++ ++LDG+ 
Sbjct  578  GTGG-------RTNHPWFSPDSKSLVFTSDYRAISAEPIXNXXHYQPYGEIFTVKLDGSD  630

Query  218  LQGLTWNGYENGTPAWHP  165
            L+ LT N YE+GTP W P
Sbjct  631  LKRLTQNSYEDGTPVWVP  648



>ref|XP_008219596.1| PREDICTED: uncharacterized protein LOC103319783 [Prunus mume]
Length=697

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 96/135 (71%), Gaps = 8/135 (6%)
 Frame = -1

Query  569  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  390
            G+++LT+G W DTM +WSPDG+ IAF+S+R +PG+   F +YV+ P+GTGLR++  +G+ 
Sbjct  523  GLQRLTEGMWTDTMCNWSPDGEWIAFASDRDDPGSG-SFELYVIHPNGTGLRKVIQSGSG  581

Query  389  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQG  210
            G       R NH  FS D + ++FT++   ++AEP+S P+ +QPYG+++ + LDG+ L+ 
Sbjct  582  G-------RTNHPWFSPDGKSLVFTSDYRAISAEPISNPHHYQPYGEIFTINLDGSDLKR  634

Query  209  LTWNGYENGTPAWHP  165
            LT N YE+GTP W P
Sbjct  635  LTQNSYEDGTPVWIP  649



>gb|EAY93383.1| hypothetical protein OsI_15178 [Oryza sativa Indica Group]
Length=470

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 97/138 (70%), Gaps = 9/138 (7%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GGIR+LT+G W DTM +WSP  + IAF+S+RH PG+   F+I +V P+GTGLRR+  +
Sbjct  300  EAGGIRRLTEGPWSDTMCNWSPHDEWIAFASDRHAPGSGS-FAI-MVHPNGTGLRRVVHS  357

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
            G  G       R NH  FSSD + ++FT++   V+AEPVS P+ +QPYG++Y + +DG+ 
Sbjct  358  GDGG-------RTNHPWFSSDFKSLVFTSDYAAVSAEPVSNPHHYQPYGEIYTVDIDGSN  410

Query  218  LQGLTWNGYENGTPAWHP  165
            ++ LT N +E+GTP+W P
Sbjct  411  IRRLTHNSFEDGTPSWTP  428



>ref|XP_002520327.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42113.1| conserved hypothetical protein [Ricinus communis]
Length=540

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 93/141 (66%), Gaps = 8/141 (6%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            E + GG+ ++ +G W DTM  WSPDG+ I F S+R  PG    F +Y + P+GTGLR++ 
Sbjct  358  EGEKGGLYRVIEGLWDDTMCDWSPDGEWIVFCSDREEPGTG-SFDLYFIHPNGTGLRKLL  416

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +G+ G       R+NH+  S + + ++FT +   ++AEP+S    FQPYG++Y++ LDG
Sbjct  417  QSGSGG-------RVNHLYISPNGKSIVFTTDYTAISAEPISNQQMFQPYGEIYIINLDG  469

Query  224  TGLQGLTWNGYENGTPAWHPK  162
            +GL+ LT N +E+GTPAW P+
Sbjct  470  SGLKRLTHNSFEDGTPAWGPR  490



>ref|XP_010539663.1| PREDICTED: uncharacterized protein LOC104813673 [Tarenaya hassleriana]
Length=672

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 90/140 (64%), Gaps = 10/140 (7%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LTDGAW DTM SWSPDG  IAF+SNR NPG  + F ++++ P+GTGLR++   
Sbjct  508  ETGGLFRLTDGAWNDTMCSWSPDGDWIAFASNRENPG-TESFGLFLIHPNGTGLRKL---  563

Query  398  GAEGSEEVNRERL-NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGT  222
                  E    R+ NH  FS D + V FT+N   ++AEP+S P+     G+++ ++LDG+
Sbjct  564  -----TETGLGRMSNHPVFSPDGKTVAFTSNYAAISAEPISNPDIAISAGEIFTVKLDGS  618

Query  221  GLQGLTWNGYENGTPAWHPK  162
             L  +T N Y +GTP W PK
Sbjct  619  DLSRVTHNSYMDGTPIWAPK  638



>gb|EMT16880.1| hypothetical protein F775_15390 [Aegilops tauschii]
Length=390

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 81/110 (74%), Gaps = 8/110 (7%)
 Frame = -1

Query  500  IAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVL  321
            IAF+S+RHNPG A  F+IY++ P+GTGLRR+ V  A+G       R NH  FS DS+ ++
Sbjct  237  IAFASDRHNPG-AGSFAIYMIHPNGTGLRRV-VHSADGG------RTNHPWFSPDSKRMV  288

Query  320  FTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGTPAW  171
            FT++L  V+AEP+S P  +QPYG+++ + +DG+GLQ LT N +E+GTP+W
Sbjct  289  FTSDLAAVSAEPISNPRHYQPYGEIFTINIDGSGLQRLTHNSFEDGTPSW  338



>ref|XP_010477408.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104756504 
[Camelina sativa]
Length=723

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 91/147 (62%), Gaps = 10/147 (7%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W D++P+WSPDG  I FSSNR  PG     ++YVV PDGTGLR++   
Sbjct  529  ESGGLFRLTNGNWNDSIPTWSPDGNWIVFSSNREFPGTF-LDNLYVVHPDGTGLRKL---  584

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                ++ +      H  FS DS+ ++FT    G++AEP+ +P+ F   G+++ + LDG+ 
Sbjct  585  ----AQNLTGGLSMHSTFSPDSKRIVFTTTYAGISAEPIGVPHFFIAGGEIFTVNLDGSD  640

Query  218  LQGLTWNGYENGTPAWHP--KAEVDLA  144
            L  LT N  E+G P W P  KA VD+A
Sbjct  641  LTRLTHNSVEDGPPMWFPKIKATVDVA  667



>ref|XP_006652005.1| PREDICTED: uncharacterized protein LOC102702184, partial [Oryza 
brachyantha]
Length=391

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (62%), Gaps = 8/138 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+R+LT+G W DTM +WSPDG+ IAF+S+RH+PG+         R            
Sbjct  219  EAGGVRRLTEGPWSDTMCNWSPDGEWIAFASDRHDPGSG--------RFAXXXXXXXGPG  270

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
               G       R NH  FS DS+ ++FT++   V+AEPVS P+ +QPYG++Y + +DG+ 
Sbjct  271  RRGGVHSGGGGRTNHPWFSPDSKSIVFTSDYAAVSAEPVSNPHHYQPYGEIYTVSIDGSN  330

Query  218  LQGLTWNGYENGTPAWHP  165
            ++ LT N +E+GTPAW P
Sbjct  331  IRRLTHNSFEDGTPAWTP  348



>ref|NP_001173830.1| Os04g0278101 [Oryza sativa Japonica Group]
 dbj|BAH92558.1| Os04g0278101 [Oryza sativa Japonica Group]
Length=378

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 89/141 (63%), Gaps = 30/141 (21%)
 Frame = -1

Query  581  LDG--GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI  408
            LDG  GGIR+LT+G W DTM +WSPD + IAF+S+RH PG+   F+I +V P+GTG    
Sbjct  224  LDGEAGGIRRLTEGPWSDTMCNWSPDDEWIAFASDRHAPGSG-SFAI-MVHPNGTG----  277

Query  407  HVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLD  228
                                  SDS+ ++FT++   V+AEPVS P+ +QPYG++Y + +D
Sbjct  278  ----------------------SDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIYTVDID  315

Query  227  GTGLQGLTWNGYENGTPAWHP  165
            G+ ++ LT N +E+GTP+W P
Sbjct  316  GSNIRRLTHNSFEDGTPSWTP  336



>ref|XP_010488216.1| PREDICTED: uncharacterized protein LOC104766097 [Camelina sativa]
Length=701

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 85/141 (60%), Gaps = 8/141 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W DT+ +WSPD   I F+SNR  PG     ++YVV PDGTGLR++   
Sbjct  523  EAGGLFRLTNGNWNDTIATWSPDNNWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL---  578

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                ++ +      H  FS DS+ ++FT+   G++AEP+  P+   P  +++ + LDG+G
Sbjct  579  ----AQNLTGGVSMHPMFSPDSKRIVFTSIYAGLSAEPIGTPHFNVPSSEIFTVNLDGSG  634

Query  218  LQGLTWNGYENGTPAWHPKAE  156
            L  LT N  E+G P W PK +
Sbjct  635  LTRLTHNSLEDGPPMWFPKIK  655



>ref|XP_010466456.1| PREDICTED: uncharacterized protein LOC104746633 isoform X1 [Camelina 
sativa]
Length=701

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 85/141 (60%), Gaps = 8/141 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W DT+ +WSPD   I F+SNR  PG     ++YVV PDGTGLR++   
Sbjct  523  EAGGLFRLTNGNWNDTIATWSPDNNWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL---  578

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                ++ +      H  FS DS+ ++FT+   G++AEP+  P+   P  +++ + LDG+G
Sbjct  579  ----AQNLTGGVSMHPMFSPDSKRIVFTSIYAGLSAEPIGTPHFNVPSSEIFTVNLDGSG  634

Query  218  LQGLTWNGYENGTPAWHPKAE  156
            L  LT N  E+G P W PK +
Sbjct  635  LTRLTHNSLEDGPPMWFPKIK  655



>ref|XP_010510815.1| PREDICTED: uncharacterized protein LOC104787018 [Camelina sativa]
Length=700

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 85/141 (60%), Gaps = 8/141 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W DT+ +WSPD   I F+SNR  PG     ++YVV PDGTGLR++   
Sbjct  522  EAGGLFRLTNGNWNDTIATWSPDNNWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL---  577

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                ++ +      H  FS DS+ ++FT+   G++AEP+  P+   P  +++ + LDG+G
Sbjct  578  ----AQNLTGGVSMHPMFSPDSKRIVFTSIYAGLSAEPIGTPHFNVPSSEIFTVNLDGSG  633

Query  218  LQGLTWNGYENGTPAWHPKAE  156
            L  LT N  E+G P W PK +
Sbjct  634  LTRLTHNSLEDGPPMWFPKIK  654



>ref|XP_010466457.1| PREDICTED: uncharacterized protein LOC104746633 isoform X2 [Camelina 
sativa]
Length=701

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 84/141 (60%), Gaps = 8/141 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W DT+ +WSPD   I F+SNR  PG     ++YVV PDGTGLR++   
Sbjct  523  EAGGLFRLTNGNWNDTIATWSPDNNWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL---  578

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                ++ +      H  FS DS+ ++FT+   G++AEP+  P    P  +++ + LDG+G
Sbjct  579  ----AQNLTGGVSMHPMFSPDSKRIVFTSIYAGLSAEPIGTPRFNVPSSEIFTVNLDGSG  634

Query  218  LQGLTWNGYENGTPAWHPKAE  156
            L  LT N  E+G P W PK +
Sbjct  635  LTRLTHNSLEDGPPMWFPKIK  655



>ref|NP_564146.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD41420.1|AC007727_9 F8K7.9 [Arabidopsis thaliana]
 gb|AAK59584.1| unknown protein [Arabidopsis thaliana]
 gb|AAN41381.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30137.1| uncharacterized protein AT1G21670 [Arabidopsis thaliana]
Length=703

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 84/141 (60%), Gaps = 8/141 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W DT+ +WSPDG  I F+SNR  PG     +IYVV PDGTGLR++   
Sbjct  525  ESGGLFRLTNGNWNDTIATWSPDGNWIVFASNREFPGTL-LMNIYVVHPDGTGLRKL---  580

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                ++ +      H  FS DS+ ++FT    G++AE +  P+   P  +++ + LDG+G
Sbjct  581  ----AQNLTGLVSMHPMFSPDSKRIVFTTIYAGISAEQIGNPHFNVPSSEIFTVNLDGSG  636

Query  218  LQGLTWNGYENGTPAWHPKAE  156
            L  LT N  E+G P W PK +
Sbjct  637  LTRLTHNSVEDGPPMWFPKIK  657



>ref|XP_002890451.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66710.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
Length=703

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 84/141 (60%), Gaps = 8/141 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W DT+ +WSPDG  I F+SNR  PG     +IYVV PDGTGLR++   
Sbjct  525  ESGGLFRLTNGNWNDTIATWSPDGNWIVFASNREFPGTL-LMNIYVVHPDGTGLRKL---  580

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                ++ +      H  FS DS+ ++FT    G++AE +  P+   P  +++ + LDG+G
Sbjct  581  ----AQNLTGGVSMHPMFSPDSKRIVFTTIYAGISAEQIGNPHFNVPSSEIFTVNLDGSG  636

Query  218  LQGLTWNGYENGTPAWHPKAE  156
            +  LT N  E+G P W PK +
Sbjct  637  MTRLTHNSVEDGPPMWFPKIK  657



>ref|XP_006416278.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
 gb|ESQ34631.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
Length=698

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 80/141 (57%), Gaps = 8/141 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W D + +WSPDG  I F+SNR  PG     ++YVV PDGTGLR++   
Sbjct  526  ETGGLFRLTNGNWSDVIATWSPDGNWIVFASNREFPGTL-LMNLYVVHPDGTGLRKV---  581

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                ++ +      H  FS DS+ ++FT     ++AE +  P+   P  +++ + LDG+ 
Sbjct  582  ----AQNLTGAVSMHPMFSPDSKRIVFTTTYAAISAESIGNPHFNVPSSEIFTVNLDGSD  637

Query  218  LQGLTWNGYENGTPAWHPKAE  156
               LT N  E+G P W PK +
Sbjct  638  FTRLTHNSLEDGPPMWFPKIK  658



>ref|XP_005646452.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE21908.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
Length=732

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 82/141 (58%), Gaps = 15/141 (11%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGN---ADCFSIYVVRPDGTGLR  414
            E +  G+ +LT+G W DTMP W+P    I F+S+R    +   A  F I+++R DG+GL+
Sbjct  532  EGEAAGLIRLTEGPWDDTMPGWTPASGWIVFASSREYVESNRPAGAFDIFMIRTDGSGLQ  591

Query  413  RIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMR  234
            ++         + +    NH  FS     V+FT      +AE +S P+QFQPYGDL+ + 
Sbjct  592  KVF--------DSHGGLANHPHFSPSQTSVVFTR----YSAEEISTPHQFQPYGDLFAID  639

Query  233  LDGTGLQGLTWNGYENGTPAW  171
             DGT L+ LT + YENGTPAW
Sbjct  640  TDGTNLRRLTHDPYENGTPAW  660



>gb|EMS54560.1| hypothetical protein TRIUR3_19354 [Triticum urartu]
Length=136

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 67/94 (71%), Gaps = 7/94 (7%)
 Frame = -1

Query  443  VVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQF  264
            +V P+GTGLRR+ V  A+G       R NH  FS DS+ ++FT++L  V+AEP+S P+ +
Sbjct  1    MVHPNGTGLRRV-VHSADGG------RTNHPWFSPDSKSMVFTSDLAAVSAEPISNPHHY  53

Query  263  QPYGDLYMMRLDGTGLQGLTWNGYENGTPAWHPK  162
            QPYG+++ + +DG+GLQ LT N +E+GTP+W P 
Sbjct  54   QPYGEIFTINIDGSGLQRLTHNSFEDGTPSWTPH  87



>gb|KFK44273.1| hypothetical protein AALP_AA1G236600 [Arabis alpina]
Length=690

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 83/141 (59%), Gaps = 8/141 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G   DT+ +WSPDG  I F+SNR  PG     ++YVV PDGTGL+++   
Sbjct  520  ETGGLFRLTNGHGNDTIATWSPDGNWIVFASNREFPGTL-FLNLYVVHPDGTGLKKV---  575

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                +E++      H  FS DS+ ++FT     ++AEP+  P+   P  +++ + LDG+ 
Sbjct  576  ----TEKLTGGISMHPMFSPDSKRIVFTTIHAAISAEPIGNPHFNVPSSEIFTVNLDGSD  631

Query  218  LQGLTWNGYENGTPAWHPKAE  156
            L  +T N  E+G P W PK +
Sbjct  632  LTRITHNSVEDGPPMWFPKIK  652



>emb|CDY04661.1| BnaC05g16990D [Brassica napus]
Length=697

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 78/141 (55%), Gaps = 8/141 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W DT+ +WSPD   I F+SNR   G      +YVV PDGTGLR++   
Sbjct  526  EAGGLFRLTNGNWNDTIATWSPDNNWIVFASNREYIGTL-LMDLYVVHPDGTGLRKV---  581

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                ++ +      H  FS DS+ ++FT    G++AEP+  P       +++ + LDG+ 
Sbjct  582  ----AQNLTGGVSMHPMFSPDSKRIVFTTTYAGISAEPIGNPKFNVASSEIFTVNLDGSD  637

Query  218  LQGLTWNGYENGTPAWHPKAE  156
               LT N  E+G P W PK +
Sbjct  638  FMRLTHNSVEDGPPLWFPKIK  658



>emb|CDY08187.1| BnaA06g15390D [Brassica napus]
Length=704

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 77/141 (55%), Gaps = 8/141 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W DT+ +WSPD   I F+SNR   G      +YVV PDGTGLR++   
Sbjct  533  EAGGLFRLTNGNWNDTIATWSPDNNWIVFASNREYIGTL-LMDLYVVHPDGTGLRKV---  588

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                ++ +      H  FS DS+ ++FT     ++AEP+  P       +++ + LDG+ 
Sbjct  589  ----AQNLTGGVSMHPMFSPDSKRIVFTTTYAAISAEPIGNPKFNVASSEIFTVNLDGSD  644

Query  218  LQGLTWNGYENGTPAWHPKAE  156
               LT N  E+G P W PK +
Sbjct  645  FMRLTHNSVEDGPPLWFPKIK  665



>ref|XP_009149685.1| PREDICTED: uncharacterized protein LOC103873008 [Brassica rapa]
Length=704

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 77/141 (55%), Gaps = 8/141 (6%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            + GG+ +LT+G W DT+ +WSPD   I F+SNR   G      +YVV PDGTGLR++   
Sbjct  533  EAGGLFRLTNGNWNDTIATWSPDNNWIVFASNREYIGTL-LMDLYVVHPDGTGLRKV---  588

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  219
                ++ +      H  FS DS+ ++FT     ++AEP+  P       +++ + LDG+ 
Sbjct  589  ----AQNLTGGVSMHPMFSPDSKRIVFTTTYAAISAEPIGNPKFNVASSEIFTVNLDGSD  644

Query  218  LQGLTWNGYENGTPAWHPKAE  156
               LT N  E+G P W PK +
Sbjct  645  FMRLTHNSVEDGPPLWFPKIK  665



>ref|XP_002467956.1| hypothetical protein SORBIDRAFT_01g037140 [Sorghum bicolor]
 gb|EER94954.1| hypothetical protein SORBIDRAFT_01g037140 [Sorghum bicolor]
Length=724

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 86/159 (54%), Gaps = 26/159 (16%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP  432
            E+ GG + +LT+G+WIDT   WSPDG L+ F+SNR  P +A           F++Y++  
Sbjct  522  EVGGGKVTRLTEGSWIDTHCQWSPDGNLVVFASNRDKPADAPERDHGLDPGYFAVYLMNV  581

Query  431  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQ  261
                + R+  +G + S  V     NH  FS D   +  T++L  V+A+P+S+P   +  +
Sbjct  582  SDRSVVRVIRSGYDLSGHV-----NHPVFSPDGRSIAVTSDLAAVSADPMSLPTFLHSVR  636

Query  260  PYGDLYMMRLDGTGLQG---------LTWNGYENGTPAW  171
            PYGD++ + +D   ++          +T + YEN TPAW
Sbjct  637  PYGDIFSVDIDPDDMEKNKDLDKFVRVTHSRYENSTPAW  675



>gb|ABJ88479.1| WD40 domain protein beta Propeller [Candidatus Solibacter usitatus 
Ellin6076]
Length=638

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  357
            D  P WSP G LI FS           + IY ++PDG+ L+R+       +         
Sbjct  521  DNFPLWSPRGDLITFSRQIEG-----AYEIYTIKPDGSSLKRLTFTKGNDA---------  566

Query  356  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGTP  177
            H+ +S D E+++FT++  G   E V+  +  QPYG++++MR DGTG++ LT N +E GTP
Sbjct  567  HMAWSPDGEYIVFTSSRMGFKDE-VAYTDAPQPYGEIFVMRYDGTGVEQLTDNQWEEGTP  625

Query  176  AWHPKA  159
            AW P A
Sbjct  626  AWQPMA  631


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 40/71 (56%), Gaps = 8/71 (11%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNP--------GNADCFSIYVVRPD  429
            +L  G  R LT G   D  PSWSPDGK IAFSS R NP               IYV+RPD
Sbjct  158  DLVTGRARALTSGPGGDFRPSWSPDGKWIAFSSGRDNPVPFASGRWERLQLSDIYVIRPD  217

Query  428  GTGLRRIHVAG  396
            G+GL++I  +G
Sbjct  218  GSGLKKITKSG  228


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 73/180 (41%), Gaps = 58/180 (32%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            DG     L   A  D  P+W+PDG  I F+S R+  G+AD F    V PDG+GL+++   
Sbjct  71   DGSDEHPLLASADTDYDPAWAPDGGSIVFTSERN--GSADLFR---VNPDGSGLKQLTAD  125

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP--------------NQFQ  261
             A           +   FSSDS+ + F +  GG TA   ++                 F+
Sbjct  126  PAYD---------DQATFSSDSKQLAFVSTRGGGTANLWTMDLVTGRARALTSGPGGDFR  176

Query  260  P------------------------------YGDLYMMRLDGTGLQGLTWNGYENGTPAW  171
            P                                D+Y++R DG+GL+ +T +G   G+P W
Sbjct  177  PSWSPDGKWIAFSSGRDNPVPFASGRWERLQLSDIYVIRPDGSGLKKITKSGNFCGSPKW  236



>ref|WP_041858684.1| hypothetical protein [Candidatus Solibacter usitatus]
Length=611

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 72/126 (57%), Gaps = 15/126 (12%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  357
            D  P WSP G LI FS  R   G    + IY ++PDG+ L+R+       +         
Sbjct  494  DNFPLWSPRGDLITFS--RQIEG---AYEIYTIKPDGSSLKRLTFTKGNDA---------  539

Query  356  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGTP  177
            H+ +S D E+++FT++  G   E V+  +  QPYG++++MR DGTG++ LT N +E GTP
Sbjct  540  HMAWSPDGEYIVFTSSRMGFKDE-VAYTDAPQPYGEIFVMRYDGTGVEQLTDNQWEEGTP  598

Query  176  AWHPKA  159
            AW P A
Sbjct  599  AWQPMA  604


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 40/71 (56%), Gaps = 8/71 (11%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNP--------GNADCFSIYVVRPD  429
            +L  G  R LT G   D  PSWSPDGK IAFSS R NP               IYV+RPD
Sbjct  131  DLVTGRARALTSGPGGDFRPSWSPDGKWIAFSSGRDNPVPFASGRWERLQLSDIYVIRPD  190

Query  428  GTGLRRIHVAG  396
            G+GL++I  +G
Sbjct  191  GSGLKKITKSG  201


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 73/180 (41%), Gaps = 58/180 (32%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  399
            DG     L   A  D  P+W+PDG  I F+S R+  G+AD F    V PDG+GL+++   
Sbjct  44   DGSDEHPLLASADTDYDPAWAPDGGSIVFTSERN--GSADLFR---VNPDGSGLKQLTAD  98

Query  398  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP--------------NQFQ  261
             A           +   FSSDS+ + F +  GG TA   ++                 F+
Sbjct  99   PAYD---------DQATFSSDSKQLAFVSTRGGGTANLWTMDLVTGRARALTSGPGGDFR  149

Query  260  P------------------------------YGDLYMMRLDGTGLQGLTWNGYENGTPAW  171
            P                                D+Y++R DG+GL+ +T +G   G+P W
Sbjct  150  PSWSPDGKWIAFSSGRDNPVPFASGRWERLQLSDIYVIRPDGSGLKKITKSGNFCGSPKW  209



>ref|XP_004960704.1| PREDICTED: uncharacterized protein LOC101777811 [Setaria italica]
Length=754

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 80/164 (49%), Gaps = 23/164 (14%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHN-----PGNADC--FSIYVVRP---DGT  423
            G + QLTDG W+DT  SWSP G  I FSS+R       PG  D   FSIY+V     D T
Sbjct  548  GTVTQLTDGPWVDTHCSWSPSGDWIVFSSSRDKDPDAQPGTLDAGYFSIYIVNAAERDPT  607

Query  422  GLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYG  252
                        S +     +NH  FS D   ++FT++L  V+ EP+S+P   +  +PYG
Sbjct  608  NKTMPPPVRVVHSADTFIGHVNHPVFSHDMRSLIFTSDLAAVSVEPISMPIFIHSVRPYG  667

Query  251  DLYMMRL----------DGTGLQGLTWNGYENGTPAWHPKAEVD  150
            D++ + L          + T    LT + YE  TPAW   A VD
Sbjct  668  DIFSVDLRDDKDIAKNENITEFHRLTHSRYEYSTPAWTKFATVD  711



>ref|XP_010676032.1| PREDICTED: uncharacterized protein LOC104891942 [Beta vulgaris 
subsp. vulgaris]
Length=662

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 78/162 (48%), Gaps = 24/162 (15%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPG--------NADCFSIYVVRPD  429
            E  GG I +LT+G W DT   WSP+G  I F+SNR NP         +   F IY+V+ D
Sbjct  454  EFMGGEITRLTEGEWTDTHCQWSPNGDWIVFASNRANPTAPKKDDLPDPGYFGIYMVKAD  513

Query  428  GTGLRRIHVAGAEGSEEVNRE----RLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---N  270
                    +     S    RE     +NH  FS D + ++  A+L  V+ EP+S+P   +
Sbjct  514  NKNAWLKVIDSGFDSTRPGRELFPGHVNHPFFSPDGKSIVIAADLAAVSCEPISLPLFAH  573

Query  269  QFQPYGDLYMMRLDG---------TGLQGLTWNGYENGTPAW  171
              +PYGD++ + LD          T  + LT + YEN T  W
Sbjct  574  SVRPYGDIFTVDLDSENFENNANLTKFKRLTHSRYENSTAVW  615



>gb|EMT08438.1| hypothetical protein F775_30261 [Aegilops tauschii]
Length=806

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 81/157 (52%), Gaps = 26/157 (17%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDG  426
            DGG   ++T+G WIDT   WSPD   I FSSNR  P +A           F++Y++    
Sbjct  606  DGGEAERITEGDWIDTHCQWSPDRDWIVFSSNRDKPADAPERDHGMDPGYFAVYLMNAID  665

Query  425  TGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPY  255
              + R+  +G + S  V     NH  FS D   ++ TA+L  V+A+P+S+P   +  +PY
Sbjct  666  RSVVRVIRSGYDFSGHV-----NHPVFSPDGRSIVVTADLAAVSADPMSLPLLLHSQRPY  720

Query  254  GDLYMMRLDGTGLQG---------LTWNGYENGTPAW  171
            GD++ + +D   ++          +T + YEN TP W
Sbjct  721  GDIFTVDIDPDDMEKNQDVEEFARVTHSRYENATPDW  757



>gb|AFK45973.1| unknown [Medicago truncatula]
Length=97

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = -1

Query  326  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGTPAWHPKAEVDL  147
            ++FT++  G++AEP+S P+ +QPYG+++ +RLDG+GL  LT N YE+GTPAW PK  +  
Sbjct  1    MVFTSDYAGISAEPISNPHHYQPYGEIFTVRLDGSGLTRLTHNSYEDGTPAWSPKY-IKP  59

Query  146  ARLSLGKSGEKLRGKFDEPLWINS  75
              + + K G      F++  W+N+
Sbjct  60   VNVEMPKGGPYC--SFEDCHWLNN  81



>gb|EAY89757.1| hypothetical protein OsI_11300 [Oryza sativa Indica Group]
Length=737

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 78/153 (51%), Gaps = 26/153 (17%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLR  414
            + ++T G W DT   WSP+GK I FSSNR  P +A           F++Y++      + 
Sbjct  541  VTRMTAGEWTDTHCQWSPNGKWIVFSSNRDRPADAPERDHGLDPGYFAVYLMDVASRSVV  600

Query  413  RIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLY  243
            R+  +G + +  V     NH  FS D   +  T++L  VTA+P+S+P   +  +PYGD++
Sbjct  601  RVIRSGYDVAGHV-----NHPVFSPDGRSIAVTSDLAAVTADPMSLPLFLHSVRPYGDIF  655

Query  242  MMRLDG---------TGLQGLTWNGYENGTPAW  171
             + +D           G   +T + YEN TPAW
Sbjct  656  TVDIDPDDMARNEDVEGFVRVTHSRYENSTPAW  688



>gb|EJL34752.1| periplasmic component of the Tol biopolymer transport system 
[Caulobacter sp. AP07]
Length=602

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 70/140 (50%), Gaps = 14/140 (10%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            +LD G    L  G      P+WSP   +IAF+++         + IY +R DG+GL+R+ 
Sbjct  469  DLDSGESHVLLAGPAHYNFPAWSPTADVIAFTADIDG-----DYEIYSIRADGSGLKRLT  523

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +    +         H  +S D +W+ F +  GG   E +  P   QPYG++Y+MR DG
Sbjct  524  RSPGNDA---------HNAWSPDGKWIAFASARGGFKDEALLHPANPQPYGEIYVMRADG  574

Query  224  TGLQGLTWNGYENGTPAWHP  165
            +    LT   +E GTPAW P
Sbjct  575  SEAHALTDEPFEKGTPAWAP  594



>ref|NP_001049934.1| Os03g0314500 [Oryza sativa Japonica Group]
 gb|ABF95608.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11848.1| Os03g0314500 [Oryza sativa Japonica Group]
 gb|EAZ26709.1| hypothetical protein OsJ_10615 [Oryza sativa Japonica Group]
Length=730

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 78/153 (51%), Gaps = 26/153 (17%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLR  414
            + ++T G W DT   WSP+GK I FSSNR  P +A           F++Y++      + 
Sbjct  534  VTRMTAGEWTDTHCQWSPNGKWIVFSSNRDRPADAPERDHGLDPGYFAVYLMDVASRSVV  593

Query  413  RIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLY  243
            R+  +G + +  V     NH  FS D   +  T++L  VTA+P+S+P   +  +PYGD++
Sbjct  594  RVIRSGYDVAGHV-----NHPVFSPDGRSIAVTSDLAAVTADPMSLPLFLHSVRPYGDIF  648

Query  242  MMRLDG---------TGLQGLTWNGYENGTPAW  171
             + +D           G   +T + YEN TPAW
Sbjct  649  TVDIDPDDMARNEDVEGFVRVTHSRYENSTPAW  681



>emb|CAE05101.3| OSJNBa0009K15.21 [Oryza sativa Japonica Group]
 gb|EAZ30049.1| hypothetical protein OsJ_14105 [Oryza sativa Japonica Group]
Length=139

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 60/98 (61%), Gaps = 10/98 (10%)
 Frame = -1

Query  359  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGT  180
            NH  FSSDS+ ++FT++   V+AEPVS P+ +QPYG++Y + +DG+ ++ LT N +E+GT
Sbjct  33   NHPWFSSDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIYTVDIDGSNIRRLTHNSFEDGT  92

Query  179  PAWHPKAEVDLARLSLGKSGEKL----RGKFDEPLWIN  78
            P+W P        L     GE L    R  F +  W+N
Sbjct  93   PSWTPY------FLDPRDVGETLQASGRCAFQDCHWLN  124



>ref|XP_002437598.1| hypothetical protein SORBIDRAFT_10g030220 [Sorghum bicolor]
 gb|EER88965.1| hypothetical protein SORBIDRAFT_10g030220 [Sorghum bicolor]
Length=769

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 75/163 (46%), Gaps = 25/163 (15%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP  432
            E +  G+ +LTDG W DT   WSP G  I FSS+RH P  A           F +Y+V P
Sbjct  554  EGESAGVTRLTDGDWTDTHCQWSPSGDWIVFSSSRHKPDGAPKTDNFLDPGYFGVYLVNP  613

Query  431  DG-TGLRRIHVAGAEGSEEVNRE---RLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---  273
                 + R+  +        N      +NH  FS D   ++ TA+L  V+ EP+S+P   
Sbjct  614  ASPKAVVRVMTSALPPPVPTNVAGLGHVNHPMFSPDGRSIVVTADLAAVSVEPISMPMFL  673

Query  272  NQFQPYGDLYMMRLDGTGLQG---------LTWNGYENGTPAW  171
            +  +PYGD++   +D   +           +T + YE  TP W
Sbjct  674  HSVRPYGDIFSFDIDPVDMDKNKDIQKFHRVTHSRYEYATPVW  716



>gb|KFY12538.1| hypothetical protein V491_06750 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=665

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 68/126 (54%), Gaps = 14/126 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  369
            D  PSWSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPSWSPDGKRIVFTRRNHINWDDIGATDSFDIYTIAPDGTGLAQLTTSGANDA-----  598

Query  368  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYE  189
                H  +S+D   +++T+ + G   E V+  N FQPYG + +M  DG+  + LT + +E
Sbjct  599  ----HAAWSADGR-IMYTSGMYGFREESVNYDNTFQPYGQIVIMDADGSNKRMLTDSMWE  653

Query  188  NGTPAW  171
            +  P +
Sbjct  654  DSMPLY  659



>ref|WP_035092853.1| hypothetical protein [Caulobacter henricii]
Length=625

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 72/139 (52%), Gaps = 16/139 (12%)
 Frame = -1

Query  581  LDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHV  402
            LD   IR LT G   D +P WSPDGK I F+       +A  F IY +RPDG+ L+R+  
Sbjct  501  LDTRQIRVLTTG--YDNLPFWSPDGKRIVFTRKV----DAVNFDIYTIRPDGSDLQRL--  552

Query  401  AGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGT  222
                     NR    H  +S+D + +LF+  + G   E     N FQPYG + +M  DGT
Sbjct  553  -------TTNRGNDGHAVWSADGK-ILFSTGMYGFREEAALYDNTFQPYGQIMVMSADGT  604

Query  221  GLQGLTWNGYENGTPAWHP  165
            G + +T + +E+  P + P
Sbjct  605  GKRLVTDSLWEDSMPLYLP  623



>ref|WP_035205184.1| hypothetical protein [Acidovorax sp. CF316]
Length=622

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 71/140 (51%), Gaps = 12/140 (9%)
 Frame = -1

Query  581  LDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNA-DCFSIYVVRPDGTGLRRIH  405
            L+   IR +T G   D MP WSPDG  I F+    NP +    F +Y VRPDG+ LRR+ 
Sbjct  490  LETRQIRHITRG--YDNMPIWSPDGSRILFNRGVRNPDSIWSNFDLYTVRPDGSDLRRLT  547

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
               A            H  +++D + +L+ +   G   E       FQPYG +++M  DG
Sbjct  548  DHPASD---------GHPVWTADGKQILYNSGQAGYRDEACHYDQTFQPYGQVFVMNADG  598

Query  224  TGLQGLTWNGYENGTPAWHP  165
            +G + +T + +E+ TP + P
Sbjct  599  SGKRQITDSIWEDSTPQYAP  618



>gb|EJE50504.1| periplasmic component of the Tol biopolymer transport system 
[Acidovorax sp. CF316]
Length=637

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 69/135 (51%), Gaps = 12/135 (9%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNA-DCFSIYVVRPDGTGLRRIHVAGAE  390
            IR +T G   D MP WSPDG  I F+    NP +    F +Y VRPDG+ LRR+    A 
Sbjct  510  IRHITRG--YDNMPIWSPDGSRILFNRGVRNPDSIWSNFDLYTVRPDGSDLRRLTDHPAS  567

Query  389  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQG  210
                       H  +++D + +L+ +   G   E       FQPYG +++M  DG+G + 
Sbjct  568  D---------GHPVWTADGKQILYNSGQAGYRDEACHYDQTFQPYGQVFVMNADGSGKRQ  618

Query  209  LTWNGYENGTPAWHP  165
            +T + +E+ TP + P
Sbjct  619  ITDSIWEDSTPQYAP  633



>ref|XP_002446045.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor]
 gb|EES10373.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor]
Length=730

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 80/160 (50%), Gaps = 27/160 (17%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVR-  435
            E  GG + +LT+G W DT   WSP G  I FSS R  P +A           +++++V+ 
Sbjct  527  EYSGGTVTRLTNGEWTDTHCQWSPRGDWIVFSSTRDKPKDAPELDNGLDSGYYAVFMVKV  586

Query  434  PDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQF  264
             D T + R+  +G +    V     NH  FS D   +  TA+L  V+A+P+S+P   +  
Sbjct  587  SDPTVVIRVVQSGDDLGGHV-----NHPVFSPDGRSIAMTADLAAVSADPISLPLFIHSV  641

Query  263  QPYGDLYMMRLDG---------TGLQGLTWNGYENGTPAW  171
            +PYGD++++ +D               +T + YE  TPAW
Sbjct  642  RPYGDIFVVDIDPDDARKNKDVKKFHRVTHSRYEYSTPAW  681



>ref|XP_010676033.1| PREDICTED: uncharacterized protein LOC104891943 [Beta vulgaris 
subsp. vulgaris]
Length=751

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 84/167 (50%), Gaps = 27/167 (16%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNA-DC--------FSIYVVRP  432
            E   G IR+LT G  IDT   WSP    I FSSNR  P +A  C        FS+Y+V+ 
Sbjct  526  EFGRGEIRRLTTGNCIDTHCKWSPRNDWIVFSSNRDMPEDARKCDEDLDSGYFSVYLVKA  585

Query  431  DGTG-LRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQF  264
            D    L R+  +G++ +  V     NH  FS D + ++ T+++  V+A+P+S+P   +  
Sbjct  586  DNPDVLVRVMYSGSDLAGHV-----NHPFFSPDGKSIVVTSDVAAVSADPMSLPLFLHSA  640

Query  263  QPYGDLYMMRLDGTGLQG---------LTWNGYENGTPAWHPKAEVD  150
            +PYGD++ + +D   +           +T + YEN T  W   +  D
Sbjct  641  RPYGDIFTIDIDSDDINKNEDLKMFNRITHSRYENATGTWTKSSTRD  687



>ref|XP_010087211.1| hypothetical protein L484_006140 [Morus notabilis]
 gb|EXB28518.1| hypothetical protein L484_006140 [Morus notabilis]
Length=726

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 84/160 (53%), Gaps = 27/160 (17%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP  432
            E   G I +LT+G+W DT   WSP G  I FSS R  P +A           F+IY+V+ 
Sbjct  524  EYGHGKITRLTNGSWTDTHCQWSPTGDWIVFSSTRDKPEDAPKSDNGLDPGYFAIYLVKV  583

Query  431  -DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQF  264
             D + + R+  +G++ +  V     NH  FS D + ++ T++L GV+ +P+S+P   +  
Sbjct  584  NDPSVVVRVTGSGSDLTGHV-----NHPFFSPDRKSIVVTSDLAGVSVDPISLPLFLHSV  638

Query  263  QPYGDLYMMRLDGTGLQG---------LTWNGYENGTPAW  171
            +PYGD++ + +D   +           +T + YEN T +W
Sbjct  639  RPYGDIFTIDIDPDDINKNWDVKEFNRITHSRYENATGSW  678



>ref|XP_004963491.1| PREDICTED: uncharacterized protein LOC101774581 [Setaria italica]
Length=740

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 74/155 (48%), Gaps = 25/155 (16%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD--------CFSIYVVRPDGTGL  417
            G + +LTDG W DT  SWSP G  I FSS+R  P  A          F+I++V  +   +
Sbjct  561  GTVTRLTDGPWTDTHCSWSPRGDWIVFSSSRDKPAGAPEKDILDPGFFAIFLVNANNPDV  620

Query  416  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDL  246
                V     S +     + H  FS D   ++ TA+L  V+AEP+S+P   +  +PYGD+
Sbjct  621  ----VVRVMKSSDTIAGHVTHPMFSPDMRSIVVTADLAAVSAEPISMPQFLHSVRPYGDV  676

Query  245  YMMRLDGT----------GLQGLTWNGYENGTPAW  171
            + + L  T              +T + YE  TPAW
Sbjct  677  FSVNLRDTVDIAKNENIEEFHRITHSRYEYATPAW  711



>ref|WP_020604165.1| hypothetical protein [Spirosoma spitsbergense]
Length=612

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 70/126 (56%), Gaps = 13/126 (10%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  357
            D +P WSPDG LI+F+  +H+  N   F I+ +RPDGT LR++    A  +         
Sbjct  497  DNLPFWSPDGSLISFT-RKHDDNN---FDIFTIRPDGTNLRQLTTTPANDA---------  543

Query  356  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGTP  177
            H  +++DS+ +++++ + G   E     N FQPYG ++ M  DG+  + LT + +E+  P
Sbjct  544  HAYWTADSKHLMWSSGIYGFKDEAALYDNTFQPYGAIFSMNADGSDKRQLTDSAWEDSMP  603

Query  176  AWHPKA  159
               PKA
Sbjct  604  VVVPKA  609


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 33/54 (61%), Gaps = 10/54 (19%)
 Frame = -1

Query  527  PSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRIHVAG  396
            PSWSPDGK IAF+S+R      H  G    +     IYVV PDGTGLR++  AG
Sbjct  170  PSWSPDGKWIAFASDRNTQWLGHGNGAGWEHVQELGIYVVHPDGTGLRKLSQAG  223



>ref|XP_010102639.1| hypothetical protein L484_010931 [Morus notabilis]
 gb|EXB93789.1| hypothetical protein L484_010931 [Morus notabilis]
Length=714

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 83/160 (52%), Gaps = 27/160 (17%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP  432
            E   G I +LT+G WIDT   WSP G  I FSS R  P +A           F++Y+V+ 
Sbjct  512  EYGDGIITRLTNGPWIDTHCQWSPRGDWIVFSSTRDKPEDAPESDNDLDPGYFAVYLVKA  571

Query  431  -DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQF  264
             D + + R+  +G++ +  V     NH  FS D + ++ TA+L  V+ +P+S+P   +  
Sbjct  572  NDPSVVVRVLGSGSDVAGHV-----NHPIFSPDGKSIVVTADLAAVSVDPISLPLFLHSV  626

Query  263  QPYGDLYMMRLDGTGL---------QGLTWNGYENGTPAW  171
            +PYGD++ + +D   +           +T + YEN T +W
Sbjct  627  RPYGDIFTIDIDPDDIYMNEDVEKCNRITHSRYENSTASW  666



>gb|KFY42678.1| hypothetical protein V495_04387 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY59861.1| hypothetical protein V497_04044 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=665

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 71/133 (53%), Gaps = 16/133 (12%)
 Frame = -1

Query  557  LTDGAWIDTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAE  390
            LTDG W D  P WSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA 
Sbjct  539  LTDG-W-DNNPGWSPDGKRIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGAN  596

Query  389  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQG  210
             +         H  +S+D   +++T+ + G   E V+  + FQPYG + +M  DGT    
Sbjct  597  DA---------HAAWSADGR-IVYTSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTM  646

Query  209  LTWNGYENGTPAW  171
            LT + +E+  P +
Sbjct  647  LTDSMWEDSMPVY  659



>ref|XP_010675829.1| PREDICTED: uncharacterized protein LOC104891772 [Beta vulgaris 
subsp. vulgaris]
Length=731

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 83/167 (50%), Gaps = 21/167 (13%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPG--------NADCFSIYVVRP-  432
            E +G  + +LT+G W DT   WSP    I F+SNR NP         +   F +Y+V+  
Sbjct  519  EFEGAKVTRLTEGNWTDTHCQWSPKQDWIVFASNRSNPTAKTPQDLPDPGFFGVYLVKAN  578

Query  431  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQ  261
            D T + ++  +G     ++    +NH  FS D E ++  A+L  V+ +PVS+P   +  +
Sbjct  579  DKTVVVKVMDSGYTYLGDLFPGHVNHPFFSPDGESLVVAADLAAVSCDPVSMPLFVHSVR  638

Query  260  PYGDLYMMRLDGTGLQG---------LTWNGYENGTPAWHPKAEVDL  147
            PYGD++++ ++   +           +T + YEN T  W   +  DL
Sbjct  639  PYGDIFILDINRDDIYKNENLKKFTRVTHSKYENSTATWTMTSTKDL  685



>gb|KFY81759.1| hypothetical protein V500_11119 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=665

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 14/126 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  369
            D  P WSPDG+LI F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPGWSPDGELIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQVTTSGANDA-----  598

Query  368  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYE  189
                H  +S+D   +++T+ + G   E V+  N FQPYG + +M  DG+    LT + +E
Sbjct  599  ----HAAWSADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMLTDSMWE  653

Query  188  NGTPAW  171
            +  P +
Sbjct  654  DSMPLY  659



>ref|XP_002519807.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42603.1| conserved hypothetical protein [Ricinus communis]
Length=711

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 80/160 (50%), Gaps = 27/160 (17%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP  432
            E   G I +LT+G WIDT   WSP G  I FSS R  P +A           F++++V+ 
Sbjct  519  EYGDGKITRLTNGPWIDTHCQWSPRGNWIVFSSTRDKPKDAPETDNGLDPGYFAVFLVKA  578

Query  431  -DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQF  264
             D + + R+  +G   +  V     NH  FS D   +  T++L  V+ +PVS+P   +  
Sbjct  579  NDSSVVVRVIKSGDNIAGHV-----NHPFFSPDGMSIAVTSDLAAVSVDPVSLPHFLHSV  633

Query  263  QPYGDLYMMRLDGTGLQG---------LTWNGYENGTPAW  171
            +PYGD++ + +D   +           +T + YEN TP+W
Sbjct  634  RPYGDVFTLDIDPDDINKNKDLKKFNRITHSRYENATPSW  673



>gb|KFZ03462.1| hypothetical protein V502_10931 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=666

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 14/126 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  369
            D  P WSPDG+LI F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPGWSPDGELIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQVTTSGANDA-----  598

Query  368  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYE  189
                H  +S+D   +++T+ + G   E V+  N FQPYG + +M  DG+    LT + +E
Sbjct  599  ----HAAWSADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMLTDSMWE  653

Query  188  NGTPAW  171
            +  P +
Sbjct  654  DSMPLY  659



>dbj|BAJ92843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=754

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 77/160 (48%), Gaps = 27/160 (17%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPG--------NADCFSIYVVR-P  432
            E   G + +LTDG W DT  SWSP G  + FSS R  P         +A  F++Y+V+  
Sbjct  549  EFSEGTVTRLTDGPWTDTHCSWSPRGDWVVFSSTREMPPSAPEMAFLDAGYFAVYLVKVS  608

Query  431  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQ  261
            D T + R+  + A  +  V     NH  FS D   ++F ++L  V+ EP+S+P   +  +
Sbjct  609  DPTAVVRVVQSSATLAGHV-----NHPIFSPDMRSIVFASDLAAVSNEPISMPVFLHSVR  663

Query  260  PYGDLYMMRLDGTG----------LQGLTWNGYENGTPAW  171
            PYGD+  + L  T              +T + YE  TP W
Sbjct  664  PYGDILSVDLRDTDDIAKNKDIQEFHRITHSRYEYSTPTW  703



>gb|KFY02373.1| hypothetical protein O988_02191 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=665

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 71/133 (53%), Gaps = 16/133 (12%)
 Frame = -1

Query  557  LTDGAWIDTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAE  390
            LTDG W D  P WSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA 
Sbjct  539  LTDG-W-DNNPGWSPDGKRIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGAN  596

Query  389  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQG  210
             +         H  +S+D   +++T+ + G   E V+  + FQPYG + +M  DGT    
Sbjct  597  DA---------HAAWSADGR-IVYTSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTM  646

Query  209  LTWNGYENGTPAW  171
            LT + +E+  P +
Sbjct  647  LTDSMWEDSMPVY  659



>gb|KFX90155.1| hypothetical protein V490_06619 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=665

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 71/133 (53%), Gaps = 16/133 (12%)
 Frame = -1

Query  557  LTDGAWIDTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAE  390
            LTDG W D  P WSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA 
Sbjct  539  LTDG-W-DNNPGWSPDGKRIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGAN  596

Query  389  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQG  210
             +         H  +++D   +++T+ + G   E V+  + FQPYG + +M  DGT    
Sbjct  597  DA---------HAAWTADGR-IVYTSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTM  646

Query  209  LTWNGYENGTPAW  171
            LT + +E+  P +
Sbjct  647  LTDSMWEDSMPVY  659



>ref|XP_002519802.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42598.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 81/160 (51%), Gaps = 27/160 (17%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP  432
            E   G I +LT+G W DT   WSP G  I FSS R  P +A           F++++V+ 
Sbjct  522  EFGDGKITRLTNGPWTDTHCQWSPRGDWIVFSSTRDKPKDAPDSDNGLDPGYFAVFLVKV  581

Query  431  -DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQF  264
             D + + R+  +G + +  V     NH  FS D   +  T++L  V+ +P+S+P   +  
Sbjct  582  NDPSVVIRVIKSGDDLAGHV-----NHPFFSPDGMSIAVTSDLAAVSVDPISLPLFLHSV  636

Query  263  QPYGDLYMMRLDGTGLQG---------LTWNGYENGTPAW  171
            +PYGDL+++ +D + +           +T + YEN TP W
Sbjct  637  RPYGDLFVVDIDPSDINKNKDVKKFNRITHSRYENSTPTW  676



>ref|XP_010091904.1| hypothetical protein L484_001053 [Morus notabilis]
 gb|EXB47193.1| hypothetical protein L484_001053 [Morus notabilis]
Length=210

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 83/166 (50%), Gaps = 25/166 (15%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP  432
            E   G I +LT+GA  DT   WSP G  I FSS R  P +A           F++++V+ 
Sbjct  8    EYRDGIITRLTNGASTDTHCQWSPRGDWIVFSSTRDKPEDAPELDNGLDPGYFAVFLVKA  67

Query  431  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQ  261
            +   +  + V G++         +NH  FS D + ++ TA+L  V+ +P+S+P   +  +
Sbjct  68   NNPSV-EVRVLGSDSDLA---GHVNHPFFSPDGKSIVVTADLAAVSVDPISLPIFVHSVR  123

Query  260  PYGDLYMMRLDGTGLQG---------LTWNGYENGTPAWHPKAEVD  150
            PYGD++++ +D   +           +T + YEN T +W P +  D
Sbjct  124  PYGDIFIVDIDPDDINKNKDVEKFNRITHSRYENSTASWTPFSTQD  169



>ref|XP_010675836.1| PREDICTED: uncharacterized protein LOC104891779 [Beta vulgaris 
subsp. vulgaris]
Length=723

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 77/153 (50%), Gaps = 22/153 (14%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD-------CFSIYVVRPDGTGLR  414
            G I +LT+G W+DT   WSP+G+ I F+SNRH   +          F++Y+V+ D   + 
Sbjct  525  GEITRLTNGPWVDTHCEWSPNGEWIVFASNRHRTTDDSDHGLDTGYFAVYLVKADDPDV-  583

Query  413  RIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLY  243
             + V G+   +      +NH  FS D   +   A+L  V+ +P+S+P   +  +PYGDL+
Sbjct  584  WVKVIGSRSGDLAG--HVNHPFFSPDGRSLSVVADLAAVSCDPISMPLFIHSVRPYGDLF  641

Query  242  MMRLDGTGLQG---------LTWNGYENGTPAW  171
            ++ +D   +           +T   YEN T  W
Sbjct  642  ILDIDEDDIYANEDVEDYRRITHTRYENSTAVW  674



>ref|XP_004980674.1| PREDICTED: uncharacterized protein LOC101756594 [Setaria italica]
Length=1083

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 78/163 (48%), Gaps = 25/163 (15%)
 Frame = -1

Query  584   ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVR-  435
             E   G + +LT+G WIDT   WSP G  I FSS R  P  A           F+IY+V  
Sbjct  902   EFGEGSVTRLTNGPWIDTQCQWSPRGNWIVFSSTRDKPAAAPENYNELDPGHFAIYLVNA  961

Query  434   PDGTGLRRIHVAGAEGSEEVNRE-RLNHVCFSSDSEWVLFTANLGGVTAEPVSIP-----  273
              D T + R+  +G  G    +    +NH  FS D   + FT+++  V+AEP+S+P     
Sbjct  962   ADPTVVVRVVTSGDPGPGASSIAGHVNHPVFSPDGRSIAFTSDIAAVSAEPISMPMASVM  1021

Query  272   NQFQPYGDLYMMRLDGTGL---------QGLTWNGYENGTPAW  171
                +PYGD++ + +D   +           +T + YE  T AW
Sbjct  1022  ASVRPYGDIFSVDIDPDDICRNKDIDRVHRVTHSRYEYSTNAW  1064



>ref|WP_006298539.1| hypothetical protein [Hylemonella gracilis]
 gb|EGI76207.1| hypothetical protein HGR_12282 [Hylemonella gracilis ATCC 19624]
Length=638

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 70/140 (50%), Gaps = 12/140 (9%)
 Frame = -1

Query  581  LDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNA-DCFSIYVVRPDGTGLRRIH  405
            L+   IR++T G   D MP WSPDG  I F+    NP +    F +Y VRPDG+ L+R+ 
Sbjct  506  LETRQIRRITAG--YDNMPIWSPDGSRILFNRGVRNPNSIWSNFDLYTVRPDGSDLQRLT  563

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
               A            H  ++ D + +L+ + + G   E       FQPYG L++M  DG
Sbjct  564  SHPASD---------GHPVWTPDGKQILYNSGMAGYRDEACHYDQTFQPYGQLFVMDADG  614

Query  224  TGLQGLTWNGYENGTPAWHP  165
               + +T + +E+ TP + P
Sbjct  615  RNKRQITDSIWEDSTPQYVP  634



>gb|EMT19136.1| hypothetical protein F775_12749 [Aegilops tauschii]
Length=669

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 76/168 (45%), Gaps = 35/168 (21%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKL--IAFSSNRHNPGNADC---------FSIYVVRPDG  426
             G+ QLT+G W DT  SWSP      I FSS+R  PG A           FS+Y+V    
Sbjct  460  AGVDQLTNGPWTDTHCSWSPREGCDWIVFSSSRGKPGGAPASDHGLDSGYFSVYLVNAKD  519

Query  425  TG-----LRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---N  270
                   +R IH A            +NH  FS D   ++FTA+L  V+ +P+S+P   +
Sbjct  520  MAEGVVPVRVIHSAPTIAGH------VNHPVFSPDMMSIVFTADLAAVSVDPISMPHFMH  573

Query  269  QFQPYGDLYMMRL----------DGTGLQGLTWNGYENGTPAWHPKAE  156
              +PYGD++ + L          D      +T + YE  TP W P  +
Sbjct  574  SVRPYGDIFSVELLDREDMAKNKDIHKYHRITHSRYEYSTPTWSPHTD  621



>gb|EAY90391.1| hypothetical protein OsI_11968 [Oryza sativa Indica Group]
Length=744

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 77/162 (48%), Gaps = 29/162 (18%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPD--GKLIAFSSNRHNPGNADC---------FSIYVV  438
            E   G + +LT GAW DT  SWSP      I FSS R  P  A           F++++V
Sbjct  536  EFGTGKVTRLTSGAWTDTHCSWSPREGSDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLV  595

Query  437  RP-DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---N  270
            R  D T + R+  +    +  VN     H  FS D   +  TA+L  V+A+P+S+P   +
Sbjct  596  RASDPTVVVRVVRSADSVAGHVN-----HPVFSPDGRSIAVTADLAAVSADPISLPLFLH  650

Query  269  QFQPYGDLYMMRLDG---------TGLQGLTWNGYENGTPAW  171
              +PYGD++ + +D               +T + YEN TPAW
Sbjct  651  SVRPYGDIFTVDIDPDDISKNRDVRAFHRVTHSRYENSTPAW  692



>ref|WP_029915040.1| hypothetical protein [Caulobacter sp. UNC358MFTsu5.1]
Length=618

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 72/139 (52%), Gaps = 16/139 (12%)
 Frame = -1

Query  581  LDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHV  402
            LD   +R LT G  +D +P WSPDGK I F+       +A  F ++ +RPDG+ L+R+  
Sbjct  494  LDTREVRTLTTG--LDNLPFWSPDGKRIVFTRKV----DAVNFDVFTIRPDGSDLQRL--  545

Query  401  AGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGT  222
                     NR    H  +++D   +L++  + G   E     N FQPYG + +M  DGT
Sbjct  546  -------TTNRGNDGHAVWTADGR-ILWSTGMYGFREEAALYDNTFQPYGQIMVMNADGT  597

Query  221  GLQGLTWNGYENGTPAWHP  165
            G + LT + +E+  P + P
Sbjct  598  GKRLLTDSLWEDSMPLYLP  616



>gb|KFY15902.1| hypothetical protein V492_01680 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=652

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 14/126 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  369
            D  P WSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  531  DNNPGWSPDGKSIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLMQLTTSGANDA-----  585

Query  368  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYE  189
                H  +S+D   +++T+ + G   E V+  N FQPYG + +M  DG+    +T + +E
Sbjct  586  ----HAAWSADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMVTDSMWE  640

Query  188  NGTPAW  171
            +  P +
Sbjct  641  DSMPLY  646



>gb|EMT14934.1| hypothetical protein F775_30553 [Aegilops tauschii]
Length=723

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 77/160 (48%), Gaps = 27/160 (17%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPG--------NADCFSIYVVR-P  432
            E   G + +LT+G W DT  SWSP G  + FSS R  P         +A  F++Y+V+  
Sbjct  518  EFGQGTVTRLTNGPWTDTHCSWSPKGDWVVFSSTREMPASAPEMAFLDAGYFAVYLVKVS  577

Query  431  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQ  261
            D T + R+  + A  +  V     NH  FS D   ++F ++L  V+ EP+S+P   +  +
Sbjct  578  DPTVVVRVVQSSATLAGHV-----NHPIFSPDMRSIVFASDLAAVSNEPISMPVFLHSVR  632

Query  260  PYGDLYMMRLDGTG----------LQGLTWNGYENGTPAW  171
            PYGD+  + L  T              +T + YE  TP W
Sbjct  633  PYGDILSVDLRDTDDITKNKDIQEFHRITHSRYEYSTPTW  672



>ref|XP_008662981.1| PREDICTED: uncharacterized protein LOC103641407 [Zea mays]
 gb|AFW57694.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=730

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 79/160 (49%), Gaps = 27/160 (17%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP  432
            E   G + +LT+G W DT   WSP G  I FSS R  P +A           F++++V+ 
Sbjct  527  EYGDGTVTRLTNGEWTDTHCQWSPSGDWIVFSSTRDKPKDAPELDNGLDPGYFAVFMVKA  586

Query  431  -DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQF  264
             D T + R+  +G +    V     NH  FS D   ++ T++L  V+A+P+S+P   +  
Sbjct  587  SDPTVVIRVIRSGDDLGGHV-----NHPVFSPDGRSIVVTSDLAAVSADPISLPLFIHSV  641

Query  263  QPYGDLYMMRLDG---------TGLQGLTWNGYENGTPAW  171
            +PYGD++++ +D               +T + YE  TP W
Sbjct  642  RPYGDIFVVDIDPEDASKNKDVKKFHRVTHSRYEYSTPTW  681



>gb|KFY39698.1| hypothetical protein V494_03875 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=652

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 14/126 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  369
            D  P WSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  531  DNNPGWSPDGKSIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA-----  585

Query  368  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYE  189
                H  +S+D   +++T+ + G   E V+  N FQPYG + +M  DG+    +T + +E
Sbjct  586  ----HAAWSADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMVTDSMWE  640

Query  188  NGTPAW  171
            +  P +
Sbjct  641  DSMPLY  646



>ref|XP_002524160.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38223.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 80/160 (50%), Gaps = 27/160 (17%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP  432
            E   G I +LT+G W DT   WSP G  I FSS R  P +A           F++++V+ 
Sbjct  522  EYGDGKITRLTNGPWTDTHCQWSPRGDWIVFSSTRDKPKDAPETDNGLDPGYFAVFLVKV  581

Query  431  -DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQF  264
             D + + R+  +G + +  V     NH  FS D   +  T++L  V+A+P+S+P   +  
Sbjct  582  NDPSVVIRVIKSGDDLAGHV-----NHPFFSPDGMSIAVTSDLAAVSADPISLPLFLHSV  636

Query  263  QPYGDLYMMRLDGTGLQG---------LTWNGYENGTPAW  171
            +PYGD++ + +D   +           +T + YEN TP W
Sbjct  637  RPYGDVFTVDIDPDDINKNKDVKKFNRITHSRYENSTPTW  676



>gb|EMT29283.1| hypothetical protein F775_17496 [Aegilops tauschii]
Length=869

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (51%), Gaps = 20/132 (15%)
 Frame = -1

Query  560  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDG--TGLR  414
            +LT G W DT   WSP G  + FSS R  P +AD          FS+Y+V+P      +R
Sbjct  571  RLTKGPWTDTHCQWSPTGDWVVFSSTRGKPRDADELDNGLDPGYFSVYLVKPSDPMVVIR  630

Query  413  RIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLY  243
             +   G  G        +NH  FS D   +  TA+L  V+ +P+S+P   +  +PYGD++
Sbjct  631  VMDSMGDLGGH------INHPVFSPDGRSIAVTADLAAVSVDPISLPMFMHAVRPYGDIF  684

Query  242  MMRLDGTGLQGL  207
            M+ LD   L+ +
Sbjct  685  MIDLDTDNLKNI  696



>gb|EAZ27259.1| hypothetical protein OsJ_11196 [Oryza sativa Japonica Group]
Length=744

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 76/162 (47%), Gaps = 29/162 (18%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPD--GKLIAFSSNRHNPGNADC---------FSIYVV  438
            E     + +LT GAW DT  SWSP      I FSS R  P  A           F++++V
Sbjct  536  EFGTSKVTRLTSGAWTDTHCSWSPREGSDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLV  595

Query  437  RP-DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---N  270
            R  D T + R+  +    +  VN     H  FS D   +  TA+L  V+A+P+S+P   +
Sbjct  596  RASDPTVVVRVVRSADSVAGHVN-----HPVFSPDGRSIAVTADLAAVSADPISLPLFLH  650

Query  269  QFQPYGDLYMMRLDG---------TGLQGLTWNGYENGTPAW  171
              +PYGD++ + +D               +T + YEN TPAW
Sbjct  651  SVRPYGDIFTVDIDPDDISKNRDVRAFHRVTHSRYENSTPAW  692



>gb|KFY74302.1| hypothetical protein V499_05663 [Pseudogymnoascus pannorum VKM 
F-103]
Length=667

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 66/126 (52%), Gaps = 14/126 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  369
            D  P WSPDG+ I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  546  DNNPGWSPDGERIVFTRRNHIKWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA-----  600

Query  368  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYE  189
                H  +S+D   +++T+ + G   E V+  N FQPYG + +M  DG+    +T + +E
Sbjct  601  ----HAAWSADGR-IMYTSGMYGFREECVNYDNTFQPYGQIVVMNADGSNKTLVTDSMWE  655

Query  188  NGTPAW  171
            +  P +
Sbjct  656  DSMPVY  661



>ref|WP_030901696.1| hypothetical protein [Streptomyces sp. NRRL F-5126]
Length=628

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 14/126 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  357
            D +P WSPDGKLI F+       +A  F +  +RPDGTGL  +  +GA            
Sbjct  513  DNLPDWSPDGKLILFTRRT----SATNFDVCTIRPDGTGLAVLTSSGAND---------G  559

Query  356  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGTP  177
            H  ++SD   VL+ + + G   E     N FQPYG ++ M+ DG+  + LT + +E+  P
Sbjct  560  HAVWASDGR-VLYNSGMYGFREEAALYDNTFQPYGQIFSMKADGSDKRMLTDSQWEDSMP  618

Query  176  AWHPKA  159
             + P++
Sbjct  619  IYIPQS  624


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 10/50 (20%)
 Frame = -1

Query  527  PSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  408
            PSWSPDG+ +AFSS+R      H+ G    +    SIYV+RPDGTG RR+
Sbjct  172  PSWSPDGQWLAFSSDRDTAWRGHDNGKGWEHTQELSIYVIRPDGTGFRRV  221



>gb|KCW71232.1| hypothetical protein EUGRSUZ_F04330 [Eucalyptus grandis]
Length=640

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 8/77 (10%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  393
            GG+ +LTDG W DTM +WSPDG+ IAF+S+R +PG+   FS+Y++ P+GTGLR++  +G+
Sbjct  555  GGLYRLTDGPWSDTMCNWSPDGEWIAFASDREDPGSG-SFSLYLIHPNGTGLRKLIQSGS  613

Query  392  EGSEEVNRERLNHVCFS  342
             G       R NH  FS
Sbjct  614  LG-------RANHPYFS  623



>ref|NP_001050324.1| Os03g0403400 [Oryza sativa Japonica Group]
 gb|AAP03369.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96486.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12238.1| Os03g0403400 [Oryza sativa Japonica Group]
Length=744

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 76/162 (47%), Gaps = 29/162 (18%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPD--GKLIAFSSNRHNPGNADC---------FSIYVV  438
            E     + +LT GAW DT  SWSP      I FSS R  P  A           F++++V
Sbjct  536  EFGTSKVTRLTSGAWTDTHCSWSPREGSDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLV  595

Query  437  RP-DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---N  270
            R  D T + R+  +    +  VN     H  FS D   +  TA+L  V+A+P+S+P   +
Sbjct  596  RASDPTVVVRVVRSADSVAGHVN-----HPVFSPDGRSIAVTADLAAVSADPISLPLFLH  650

Query  269  QFQPYGDLYMMRLDG---------TGLQGLTWNGYENGTPAW  171
              +PYGD++ + +D               +T + YEN TPAW
Sbjct  651  SVRPYGDIFTVDIDPDDISKNRDVRAFHRVTHSRYENSTPAW  692



>gb|EMS49561.1| hypothetical protein TRIUR3_11240 [Triticum urartu]
Length=568

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 77/160 (48%), Gaps = 27/160 (17%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPG--------NADCFSIYVVR-P  432
            E   G + +LT+G W DT  SWSP G  + FSS R  P         +A  F++Y+V+  
Sbjct  363  EFGQGTVTRLTNGPWTDTHCSWSPKGDWVVFSSTREMPASAPEMAFLDAGYFAVYLVKVS  422

Query  431  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQ  261
            + T + R+  + A  +  V     NH  FS D   ++F ++L  V+ EP+S+P   +  +
Sbjct  423  NPTVVVRVVQSSATLAGHV-----NHPIFSPDMRSIVFASDLAAVSNEPISMPVFLHSVR  477

Query  260  PYGDLYMMRLDGTG----------LQGLTWNGYENGTPAW  171
            PYGD+  + L  T              +T + YE  TP W
Sbjct  478  PYGDILSVDLRDTDDITKNKDIQEFHRITHSRYEYSTPTW  517



>ref|XP_003575792.1| PREDICTED: uncharacterized protein LOC100821131 [Brachypodium 
distachyon]
Length=730

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 77/161 (48%), Gaps = 35/161 (22%)
 Frame = -1

Query  575  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHN--PG------NADCFSIYVV--RPDG  426
             G + QLT G W DT   WSP    I FSS+R    PG      +A CFSI++V  +   
Sbjct  546  AGKVTQLTKGDWTDTHCCWSPTDDWIVFSSSRDRAPPGTDPAILDAGCFSIFMVNYKDPS  605

Query  425  TGLRRIHVAGAEGSEEVNRERLNHVC---FSSDSEWVLFTANLGGVTAEPVSIP---NQF  264
              +R +H          +     HVC   FS D + ++ T+++  V+A+P S+P   +  
Sbjct  606  VVVRVMH---------SDMSLAGHVCHPVFSPDRKSIVVTSDVAAVSADPASLPIFIHSV  656

Query  263  QPYGDLYMMRL----------DGTGLQGLTWNGYENGTPAW  171
            +PYGD++ ++L          D      +T + YEN TP W
Sbjct  657  RPYGDIFTIKLRDPDCLEKNGDIVEFDRITHSRYENSTPTW  697



>gb|KFZ05841.1| hypothetical protein V501_07970 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=665

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 14/126 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  369
            D  P WSPDG+ I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPGWSPDGERIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA-----  598

Query  368  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYE  189
                H  +S+D   +++T+ + G   E V+  N FQPYG +  M  DG+    +T + +E
Sbjct  599  ----HAAWSADGR-IMYTSGMYGFREECVNYDNTFQPYGQIVAMNADGSNKTLVTDSMWE  653

Query  188  NGTPAW  171
            +  P +
Sbjct  654  DSMPVY  659



>ref|XP_002524154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38217.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 79/160 (49%), Gaps = 27/160 (17%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP  432
            E   G + +LT+G W DT   WSP G  I FSS R  P +A           F++++V+ 
Sbjct  522  EYGDGKVTRLTNGPWTDTHCQWSPRGDWIVFSSTRDKPKDAPETDNGLDPGYFAVFLVKV  581

Query  431  -DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQF  264
             D + + R+   G + +  V     NH  FS D   +  T++L  V+A+P+S+P   +  
Sbjct  582  NDPSVVIRVIKGGDDLAGHV-----NHPFFSPDGMSIAVTSDLAAVSADPISLPLFLHSV  636

Query  263  QPYGDLYMMRLDGTGLQG---------LTWNGYENGTPAW  171
            +PYGD++ + +D   +           +T + YEN TP W
Sbjct  637  RPYGDVFTVDIDPDDINKNKDVKKFNRITHSRYENSTPTW  676



>ref|XP_003574472.1| PREDICTED: uncharacterized protein LOC100838501 [Brachypodium 
distachyon]
Length=752

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 75/163 (46%), Gaps = 36/163 (22%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGL  417
            + +LTDG W DT   WSP G  I FSS R  P  A           F++++V+  D T +
Sbjct  545  VTRLTDGEWTDTHCQWSPSGDWIVFSSTRDKPATAAPTDHGLDPGYFAVFMVKASDPTVV  604

Query  416  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDL  246
             R+  +G + S  V     NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD+
Sbjct  605  IRVVGSGDDLSGHV-----NHPVFSPDGRTIAVTADLAAVSADPISLPLFLHSVRPYGDI  659

Query  245  YMMRLDGT------------------GLQGLTWNGYENGTPAW  171
            + + +D                        +T + YE  TP W
Sbjct  660  FAVDIDDILRLGDDVEKLKKIKDLKKKFHRITHSRYEYSTPEW  702



>gb|ENH85242.1| WD40 domain protein beta propeller [Colletotrichum orbiculare 
MAFF 240422]
Length=655

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 71/140 (51%), Gaps = 16/140 (11%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            +L    +R LTD    D +PSWSPDG  I F+       +A  F +  +RPDG+GLR + 
Sbjct  527  DLATRAVRNLTDA--TDNLPSWSPDGTRIVFTRKV----DAANFDVCTIRPDGSGLRVLT  580

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +GA  +         H  +++D   +L+++ + G   E  +    FQPYG + +M  DG
Sbjct  581  SSGANDA---------HAVWTADGR-ILYSSGMYGFRDEAAAYDQTFQPYGQIVVMDADG  630

Query  224  TGLQGLTWNGYENGTPAWHP  165
               + LT + +E+  P + P
Sbjct  631  ANKRMLTDSLWEDSMPLYVP  650



>ref|XP_010235117.1| PREDICTED: uncharacterized protein LOC100846313 [Brachypodium 
distachyon]
Length=751

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 74/166 (45%), Gaps = 34/166 (20%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDG  426
            +GG + +LTDG W DT   WSP G  I FSS R  P  A           F++++V+   
Sbjct  540  EGGKVTRLTDGEWTDTHCQWSPSGDWIVFSSTRDKPPTAAPLDHGLDPGYFAVFMVKASD  599

Query  425  TGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPY  255
              +    V    GS +     +NH  FS +   +  T++L  V+A+P+S+P   +  +PY
Sbjct  600  PAV----VIRVVGSGDDLSGHVNHPVFSPNGRSIAVTSDLAAVSADPISLPLFLHSVRPY  655

Query  254  GDLYMMRLDGT------------------GLQGLTWNGYENGTPAW  171
            GD++ + +D                        +T + YE  TP W
Sbjct  656  GDIFAVDIDDILRLGDDAEKLKKIKDLRRKFHRITHSRYEYSTPEW  701



>ref|XP_010105408.1| hypothetical protein L484_008562 [Morus notabilis]
 gb|EXC04631.1| hypothetical protein L484_008562 [Morus notabilis]
Length=424

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 80/166 (48%), Gaps = 25/166 (15%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP  432
            E   G I +LT+GAW DT   WSP G  I FSS R  P +A           F++++V+ 
Sbjct  222  EYGDGIITRLTNGAWTDTHCQWSPRGDWIVFSSTRDKPDDAPESDNGLDPGYFAVFLVKA  281

Query  431  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQ  261
            +   +    V    GS+      +NH  FS D + ++ TA+L  V+ +P+S+P   +  +
Sbjct  282  NDPSV----VVRVLGSDSDLAGHVNHPFFSPDGKSIVVTADLAAVSVDPISLPIFVHSVR  337

Query  260  PYGDLYM---------MRLDGTGLQGLTWNGYENGTPAWHPKAEVD  150
            PYGD+++            D      +T + YEN T +W P +  D
Sbjct  338  PYGDIFIIDIDPDDINKNKDVEKFNRITHSRYENSTASWTPFSTQD  383



>ref|XP_010097467.1| hypothetical protein L484_024672 [Morus notabilis]
 gb|EXB68658.1| hypothetical protein L484_024672 [Morus notabilis]
Length=743

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 73/140 (52%), Gaps = 23/140 (16%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD--------------CFSIYV  441
            + G + +LT+G W DT   WSP+G  I FSS+R NP  AD               F++Y+
Sbjct  534  EDGCLTRLTEGKWTDTHCQWSPNGDWIVFSSSRENPYGADQYKKENFDNGLDPGYFAVYL  593

Query  440  VRPDG-TGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---  273
            V     + + R+  +G + +  V     NH  FS D + ++ T++L  V+ +P+S+P   
Sbjct  594  VNTSNPSAVVRVAGSGYDLAGHV-----NHPFFSPDGKSIVVTSDLAAVSVDPISLPLFV  648

Query  272  NQFQPYGDLYMMRLDGTGLQ  213
            +  +PYGD+++  +D   + 
Sbjct  649  HSVRPYGDIFIFDIDTKDIH  668



>ref|XP_010675830.1| PREDICTED: uncharacterized protein LOC104891773 [Beta vulgaris 
subsp. vulgaris]
Length=886

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 80/167 (48%), Gaps = 21/167 (13%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPG--------NADCFSIYVVRPD  429
            E +   + +LT G W DT   WSP    I FSSNR  P         +A  F +Y+V  +
Sbjct  693  EFEEAKVTRLTKGNWTDTHCQWSPTQDWIVFSSNRSYPTAKTFEDLPDAGYFGVYLVNAN  752

Query  428  GTGLR-RIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQ  261
               +  ++  +G      +    +NH  FS D + ++ TA+L  V+ +PVS+P   +  +
Sbjct  753  NEDVVIKVIDSGYTYLGGLFPGHVNHPFFSPDGKSLVVTADLAAVSCDPVSMPLFLHSVR  812

Query  260  PYGDLYMMRLDGTGLQG---------LTWNGYENGTPAWHPKAEVDL  147
            PYGD++++ +DG  +           +T + YEN T  W   +  DL
Sbjct  813  PYGDIFVVDIDGDDIYKNENLKKFTRVTHSRYENSTGTWTEASTKDL  859



>ref|XP_010094534.1| hypothetical protein L484_024827 [Morus notabilis]
 gb|EXB56288.1| hypothetical protein L484_024827 [Morus notabilis]
Length=210

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 77/159 (48%), Gaps = 25/159 (16%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP  432
            E   G I +LT+GAW DT   WSP G  I FSS R  P +A           F++++V+ 
Sbjct  8    EYGDGVITRLTNGAWTDTHCQWSPRGDWIVFSSTRDKPEDAPELDNGLDPGYFAVFLVKA  67

Query  431  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQ  261
            +   +    V    GS+      +NH  FS D + ++ TA+L  V+ +P+S+P   +  +
Sbjct  68   NDPSV----VVRVLGSDSDLAGHVNHPFFSPDGKSIVVTADLAAVSVDPISLPIFVHSVR  123

Query  260  PYGDLYM---------MRLDGTGLQGLTWNGYENGTPAW  171
            PYGD+++            D      +T + YEN T +W
Sbjct  124  PYGDIFIIDIDPDDINKNKDVEKFNHITHSRYENSTASW  162



>ref|XP_010675837.1| PREDICTED: uncharacterized protein LOC104891780 [Beta vulgaris 
subsp. vulgaris]
Length=722

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 77/154 (50%), Gaps = 24/154 (16%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPG-------NADCFSIYVVRPDGTGLR  414
            G I +LT+G W+DT   WSP G+ I F+SNR+          +   F++Y+V+ D   + 
Sbjct  524  GEITRLTNGPWVDTHCDWSPSGEWIVFASNRNRTTEGMDHGLDTGYFAVYLVKADDPDV-  582

Query  413  RIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQF----QPYGDL  246
             + V G+   +      +NH  FS D   +   ++L  V+ +P+S+P QF    +PYG+L
Sbjct  583  WVKVIGSRSGDLAG--HVNHPFFSPDGRSLSVVSDLAAVSCDPISLP-QFIHSARPYGEL  639

Query  245  YMMRLDGTGLQG---------LTWNGYENGTPAW  171
            +++ +D   +           +T   YEN T  W
Sbjct  640  FILDIDHDDIYANEDVEDYRRITHTRYENSTAVW  673



>gb|AHI25037.1| hypothetical protein H845_1092 [Komagataeibacter xylinus E25]
Length=628

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 67/124 (54%), Gaps = 14/124 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  357
            D +P WSPDG+ I F+  R +  N D F+I   RPDG+GL+R+  +GA            
Sbjct  518  DNLPGWSPDGRRIVFT-RRVDDENYDIFTI---RPDGSGLKRLTTSGAND---------G  564

Query  356  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGTP  177
            H  ++ D   +++++ L G   E     N FQPYG +++M  DG+  + LT + +E+  P
Sbjct  565  HAVWTGDGR-IMWSSGLYGFRDEAALYDNTFQPYGQIFIMNADGSHKKILTDSLWEDSMP  623

Query  176  AWHP  165
             + P
Sbjct  624  LYVP  627



>ref|WP_025438063.1| hypothetical protein [Komagataeibacter xylinus]
Length=614

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 67/124 (54%), Gaps = 14/124 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  357
            D +P WSPDG+ I F+  R +  N D F+I   RPDG+GL+R+  +GA            
Sbjct  504  DNLPGWSPDGRRIVFT-RRVDDENYDIFTI---RPDGSGLKRLTTSGAND---------G  550

Query  356  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGTP  177
            H  ++ D   +++++ L G   E     N FQPYG +++M  DG+  + LT + +E+  P
Sbjct  551  HAVWTGDGR-IMWSSGLYGFRDEAALYDNTFQPYGQIFIMNADGSHKKILTDSLWEDSMP  609

Query  176  AWHP  165
             + P
Sbjct  610  LYVP  613



>emb|CDM86908.1| unnamed protein product [Triticum aestivum]
Length=731

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 74/152 (49%), Gaps = 29/152 (19%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNP--GNADCFSIYVVRPDGTGLRRIHVA  399
            G + QLTDG W D+  SWSP G  I FSS+R      +A CFSI++V      +  + V 
Sbjct  541  GTVTQLTDGPWTDSHCSWSPRGDWIVFSSSRDRDILDSAGCFSIFLVLATDRKV-LVRVM  599

Query  398  GAEGSEEVNRERLNHVC---FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMM  237
               G          HVC   FS D + ++ T+++  V+A+PVS+P      +PYGD++ +
Sbjct  600  SLPG----------HVCHPIFSPDMDNLVVTSDVAVVSADPVSLPIFIASGRPYGDMFSI  649

Query  236  RLDGTG----------LQGLTWNGYENGTPAW  171
            +L  T              +T   YE   P+W
Sbjct  650  KLRDTTDINKNKDIMEFHRITHTRYEYSKPSW  681



>ref|XP_001545913.1| hypothetical protein BC1G_15641 [Botrytis cinerea B05.10]
 gb|EMR86797.1| putative tat pathway signal sequence domain-containing protein 
[Botrytis cinerea BcDW1]
 emb|CCD52696.2| similar to prolyl oligopeptidase [Botrytis cinerea T4]
Length=674

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 70/141 (50%), Gaps = 16/141 (11%)
 Frame = -1

Query  581  LDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLR  414
            L  G +  LTD  W D  P WSPDG+ I F+   H    +  + D + +Y + P+GTGL 
Sbjct  540  LADGTVTNLTD-TW-DNTPGWSPDGERIVFTRRNHLNFDDLSSTDSYDVYTIFPNGTGLT  597

Query  413  RIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMR  234
            ++  +GA  +         H  +S+D   +L+++ + G   E     N FQPYG +  M 
Sbjct  598  QVTTSGANDA---------HAVWSADGR-ILYSSGMYGFREESPLYDNAFQPYGQIISMN  647

Query  233  LDGTGLQGLTWNGYENGTPAW  171
             DG+    LT + +E+  P +
Sbjct  648  FDGSNKTMLTDSMWEDSMPLY  668



>emb|CBH22796.1| TolB protein precursor [Salinibacter ruber M8]
Length=543

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 73/146 (50%), Gaps = 28/146 (19%)
 Frame = -1

Query  578  DGGGIRQLTDGAWID-----TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLR  414
            DG  +RQ+TD + ID       P+WSPDG  IAF S+R        F IY V PDG+ L+
Sbjct  418  DGSDLRQVTDRSDIDGNSGDLAPAWSPDGSRIAFQSDRDG---GSSFDIYTVDPDGSDLK  474

Query  413  RIHVAGAEGSEEVNRERLNHV--CFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYM  240
            ++  AG         +R++ +   +S D   ++F +N  G +A P           D+Y 
Sbjct  475  QVTTAGDR------DDRVDDISPAWSPDGSRIVFGSNRDG-SAVP-----------DIYT  516

Query  239  MRLDGTGLQGLTWNGYENGTPAWHPK  162
            +R DG+ L+ +T N   +  PAW P 
Sbjct  517  IRPDGSELERITNNDRLDFGPAWSPS  542



>dbj|BAK07068.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=733

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 75/160 (47%), Gaps = 27/160 (17%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD--------CFSIYVVRP-  432
            E   G +R+LT+G W DT  SWSP    I FSS+R     A          F++++V   
Sbjct  549  EFSEGTVRRLTNGPWTDTHCSWSPKNDWIVFSSSRDKAAGAPKRDILDPGSFAVFMVMAS  608

Query  431  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQ  261
            D T + R+     + S+ V    + H  FS D   ++  A+L  V+ EP+S+P   +  +
Sbjct  609  DPTVVVRV----MKSSDSVA-GHVTHPMFSPDMRSIVVAADLAAVSTEPISMPQFLHSVR  663

Query  260  PYGDLYMMRLDGTG----------LQGLTWNGYENGTPAW  171
            PYGD++ + L  T              +T + YE  TP W
Sbjct  664  PYGDIFSVDLRDTDDMSKNKDIKEFHRITHSRYEYATPEW  703



>ref|XP_010097483.1| hypothetical protein L484_024689 [Morus notabilis]
 gb|EXB68674.1| hypothetical protein L484_024689 [Morus notabilis]
Length=740

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 74/151 (49%), Gaps = 23/151 (15%)
 Frame = -1

Query  578  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD--------------CFSIYV  441
            + G + +LT+G W DT   WSP+G  I FSS+R NP  AD               F++Y+
Sbjct  533  EDGCLTRLTEGKWTDTHCQWSPNGDWIVFSSSRENPYGADQYKKENFDNGLDPGYFAVYL  592

Query  440  VRPDG-TGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---  273
            V     + + R+  +G + +  V     NH  FS D + ++ T++L  V+ +P S+P   
Sbjct  593  VNTSNPSAVVRVAGSGYDLAGHV-----NHPFFSPDGKSIVVTSDLAAVSVDPTSLPLFV  647

Query  272  NQFQPYGDLYMMRLDGTGLQGLTWNGYENGT  180
            +  +PYGD+++   D   +       ++  T
Sbjct  648  HSVRPYGDVFIFDFDCNDMNQEDLKTFKRAT  678



>ref|XP_010102640.1| hypothetical protein L484_010932 [Morus notabilis]
 gb|EXB93790.1| hypothetical protein L484_010932 [Morus notabilis]
Length=717

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 79/159 (50%), Gaps = 25/159 (16%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP  432
            E   G I +LT+GAW DT   WSP G  I FSS R  P +A           F++++V+ 
Sbjct  515  EYGDGIITRLTNGAWTDTHCQWSPRGDWIVFSSTRDKPDDAPESDNGLDPGYFAVFLVKA  574

Query  431  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQ  261
            +   +    V    GS+      +NH  FS D + ++ TA+L  V+ +P+S+P   +  +
Sbjct  575  NDPSV----VVRVLGSDSDLAGHVNHPFFSPDGKSIVVTADLAAVSVDPISLPIFVHSVR  630

Query  260  PYGDLYMMRL---------DGTGLQGLTWNGYENGTPAW  171
            PYGD++++ +         D      +T + YEN T +W
Sbjct  631  PYGDIFIIDIDPDDINKNKDVEKFNRITHSRYENSTASW  669



>gb|EMT06488.1| hypothetical protein F775_06751 [Aegilops tauschii]
Length=739

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 78/160 (49%), Gaps = 35/160 (22%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHN-PG-------NADCFSIY-VVRPDGTG  420
            G + QLTDG W D+  +WSP    I FSS+R   PG       +A  FSI+ V+  D + 
Sbjct  562  GTVTQLTDGPWTDSHCTWSPTDDWIVFSSSRDRAPGAPDRDILDAGFFSIFLVLATDPSV  621

Query  419  LRRI-HVAGAEGSEEVNRERLNHVC---FSSDSEWVLFTANLGGVTAEPVSIP---NQFQ  261
            L R+ H A +            HVC   FS   + ++ T+++ GV+A+PVS+P   +  +
Sbjct  622  LVRVMHSADSLA---------GHVCHPVFSPFKDSIVVTSDIAGVSADPVSLPIFIHSVR  672

Query  260  PYGDLYMMRL----------DGTGLQGLTWNGYENGTPAW  171
            PYGD++ + L          D      +T   YE  TP W
Sbjct  673  PYGDIFTINLRDKNDIMKNKDIMEFDRITHTRYEYSTPTW  712



>ref|XP_010097765.1| hypothetical protein L484_023906 [Morus notabilis]
 gb|EXB70720.1| hypothetical protein L484_023906 [Morus notabilis]
Length=744

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 52/181 (29%), Positives = 85/181 (47%), Gaps = 32/181 (18%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNA---------DCFSIYVVRP  432
            E   G + +LT+G W DT   WSP+   I FSS R  P +A           F++++V  
Sbjct  540  EYGNGFLTRLTEGDWTDTHCQWSPNSDWIVFSSTRDKPKDAPPLDNGLDPGFFAVFLVNV  599

Query  431  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQ  261
            +    +   V    GS       LNH  FS D   ++ T +L  V++EP+S+P   +  +
Sbjct  600  N----KPSVVVRVVGSGNRLAGHLNHPFFSPDGNSIVVTGDLAAVSSEPISLPLFLHSVR  655

Query  260  PYGDLYMMRLDGTGLQG---------LTWNGYENGTPAW------HPKAEVDLARLSLGK  126
            PYGD++ + +D   ++          +T + YE  T +W       P A  ++ +L+ GK
Sbjct  656  PYGDIFTVDIDPKNIEKNEDVEKFKRITHSRYEYSTASWTMFSTTDPNAAWNM-QLAAGK  714

Query  125  S  123
            S
Sbjct  715  S  715



>ref|WP_019091574.1| hypothetical protein [Komagataeibacter europaeus]
Length=614

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 67/124 (54%), Gaps = 14/124 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  357
            D +P WSPDG  I F+  R +  N D F+I   RP+GTGL+R+  +GA            
Sbjct  504  DNLPGWSPDGGRIVFT-RRVDDENYDIFTI---RPNGTGLKRLTTSGAND---------G  550

Query  356  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGTP  177
            H  +++D   +++++ + G   E     N FQPYG +++M  DG+  + LT + +E+  P
Sbjct  551  HAVWTADGR-IMWSSGIHGFRDEAALYDNTFQPYGQIFIMNADGSHKRILTDSLWEDSMP  609

Query  176  AWHP  165
             + P
Sbjct  610  LYVP  613



>ref|WP_035035180.1| hypothetical protein, partial [Caulobacter sp. AP07]
Length=544

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 64/132 (48%), Gaps = 14/132 (11%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            +LD G    L  G      P+WSP   +IAF+++         + IY +R DG+GL+R+ 
Sbjct  427  DLDSGESHVLLAGPAHYNFPAWSPTADVIAFTADIDG-----DYEIYSIRADGSGLKRLT  481

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +    +         H  +S D +W+ F +  GG   E +  P   QPYG++Y+MR DG
Sbjct  482  RSPGNDA---------HNAWSPDGKWIAFASARGGFKDEALLHPANPQPYGEIYVMRADG  532

Query  224  TGLQGLTWNGYE  189
            +    LT   +E
Sbjct  533  SEAHALTDEPFE  544



>dbj|GAA89133.1| tat pathway signal sequence domain-containing protein [Aspergillus 
kawachii IFO 4308]
Length=687

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 73/147 (50%), Gaps = 18/147 (12%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGN------ADCFSIYVVRPDGTGLRR  411
            G   QLTDG W D  P WSPDG+ I F+ N +   +      AD F IY +RPDG+ L R
Sbjct  553  GKTHQLTDG-W-DNTPGWSPDGERIVFTRNNNWTESYGARWYADRFDIYTIRPDGSELTR  610

Query  410  IHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRL  231
            +       ++ ++ +   H  +S D   ++++  + G   E     + FQPYG + +M  
Sbjct  611  V-------TDSLSNDA--HAVWSQDGR-IMWSTGMYGFKDESALFDDTFQPYGQIMVMNY  660

Query  230  DGTGLQGLTWNGYENGTPAWHPKAEVD  150
            DGT    +T   +E+  P + P   ++
Sbjct  661  DGTNKTLVTDTIWEDSMPLYMPNEYLE  687



>ref|XP_007798560.1| putative tat pathway signal sequence domain-containing protein 
[Eutypa lata UCREL1]
 gb|EMR62348.1| putative tat pathway signal sequence domain-containing protein 
[Eutypa lata UCREL1]
Length=641

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 69/140 (49%), Gaps = 16/140 (11%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            +L    +R LT+    D +P WSPDG+ I F+       +A  F++  +RPDGT LR + 
Sbjct  513  DLTDKSVRVLTNAT--DNLPFWSPDGERIVFTRK----SSATDFNVCTIRPDGTDLRVLT  566

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +GA  +         H  +S+D   +L++    G   E     N FQPYG +  M  DG
Sbjct  567  SSGANEA---------HAVWSADGR-ILYSTGEYGFRDEAAIFDNTFQPYGQIMAMNADG  616

Query  224  TGLQGLTWNGYENGTPAWHP  165
            +  + LT + +E+  P + P
Sbjct  617  SDKRMLTDSMWEDSMPLYVP  636



>ref|WP_019086650.1| hypothetical protein [Komagataeibacter europaeus]
Length=614

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 67/124 (54%), Gaps = 14/124 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  357
            D +P WSPDG  I F+  R +  N D F+I   RP+GTGL+R+  +GA            
Sbjct  504  DNLPGWSPDGGRIVFT-RRVDDENYDIFTI---RPNGTGLKRLTTSGAND---------G  550

Query  356  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGTP  177
            H  +++D   +++++ + G   E     N FQPYG +++M  DG+  + LT + +E+  P
Sbjct  551  HAVWTADGR-IMWSSGIYGFRDEAALYDNTFQPYGQIFIMNADGSHKRILTDSLWEDSMP  609

Query  176  AWHP  165
             + P
Sbjct  610  LYVP  613



>ref|WP_010509656.1| hypothetical protein [Komagataeibacter europaeus]
Length=614

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 67/124 (54%), Gaps = 14/124 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  357
            D +P WSPDG  I F+  R +  N D F+I   RP+GTGL+R+  +GA            
Sbjct  504  DNLPGWSPDGGRIVFT-RRVDDENYDIFTI---RPNGTGLKRLTTSGAND---------G  550

Query  356  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGTP  177
            H  +++D   +++++ + G   E     N FQPYG +++M  DG+  + LT + +E+  P
Sbjct  551  HAVWTADGR-IMWSSGIYGFRDEAALYDNTFQPYGQIFIMNADGSHKRILTDSLWEDSMP  609

Query  176  AWHP  165
             + P
Sbjct  610  LYVP  613



>ref|XP_007914327.1| putative tat pathway signal sequence domain-containing protein 
[Togninia minima UCRPA7]
 gb|EOO00969.1| putative tat pathway signal sequence domain-containing protein 
[Togninia minima UCRPA7]
Length=679

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 70/142 (49%), Gaps = 16/142 (11%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGL  417
            +L  G   +LTDG W D  P WSPDGKLI F+   +    N    D F I  ++PDGT L
Sbjct  543  DLATGNTTRLTDG-W-DNTPGWSPDGKLIVFTRQTNWTWGNSWELDRFDICTIKPDGTDL  600

Query  416  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  237
            + +  + A  +         H  +S D   +++++ + G   E     N FQPYG + +M
Sbjct  601  KVLTESQANDA---------HAVWSLDGR-IMYSSGMYGFRDESSLYDNTFQPYGQIIVM  650

Query  236  RLDGTGLQGLTWNGYENGTPAW  171
              DG+    LT + +E+  P +
Sbjct  651  NADGSNKTMLTDSMWEDSMPIY  672



>ref|XP_001395414.2| hypothetical protein ANI_1_1672104 [Aspergillus niger CBS 513.88]
Length=688

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 73/147 (50%), Gaps = 18/147 (12%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGN------ADCFSIYVVRPDGTGLRR  411
            G   QLTDG W D  P WSPDG+ I F+ N +   +      AD F IY +RPDG+ L R
Sbjct  554  GKTHQLTDG-W-DNTPGWSPDGERIVFTRNNNWTESYGARWYADRFDIYTIRPDGSELTR  611

Query  410  IHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRL  231
            +       ++ ++ +   H  +S D   +++++   G   E     + FQPYG + +M  
Sbjct  612  V-------TDSLSNDA--HAVWSQDGR-IMWSSGQYGFKDESALFDDTFQPYGQIMVMNY  661

Query  230  DGTGLQGLTWNGYENGTPAWHPKAEVD  150
            DGT    +T   +E+  P + P   ++
Sbjct  662  DGTNKTLVTDTIWEDSMPLYMPNEYLE  688



>gb|EHA25732.1| hypothetical protein ASPNIDRAFT_50375 [Aspergillus niger ATCC 
1015]
Length=688

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 73/147 (50%), Gaps = 18/147 (12%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGN------ADCFSIYVVRPDGTGLRR  411
            G   QLTDG W D  P WSPDG+ I F+ N +   +      AD F IY +RPDG+ L R
Sbjct  554  GKTHQLTDG-W-DNTPGWSPDGERIVFTRNNNWTESYGARWYADRFDIYTIRPDGSELTR  611

Query  410  IHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRL  231
            +       ++ ++ +   H  +S D   +++++   G   E     + FQPYG + +M  
Sbjct  612  V-------TDSLSNDA--HAVWSQDGR-IMWSSGQYGFKDESALFDDTFQPYGQIMVMNY  661

Query  230  DGTGLQGLTWNGYENGTPAWHPKAEVD  150
            DGT    +T   +E+  P + P   ++
Sbjct  662  DGTNKTLVTDTIWEDSMPLYMPNEYLE  688



>ref|WP_034400879.1| translocation protein TolB [Candidatus Pelagibacter ubique]
Length=441

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 77/169 (46%), Gaps = 35/169 (21%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            +LD   + ++TD + IDT PS+SPDGK IAF+S+R     +    IYV+R DG+G++RI 
Sbjct  277  DLDTRVVERITDHSSIDTSPSFSPDGKFIAFNSDR-----SGLQQIYVMRSDGSGVKRIT  331

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYM--MRL  231
                     V   R + + F+   +                         G  Y+  MR 
Sbjct  332  FGNGIYGTPVWSPRGDLIAFTKMRK-------------------------GRFYIGVMRT  366

Query  230  DGTGLQGLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLW  84
            DGTG + LT N Y+   P+W P   V L      K+G K  G F   LW
Sbjct  367  DGTGERLLTENYYQEA-PSWSPNGRV-LVFYRETKAGSKGEG-FSAKLW  412



>gb|ETI58852.1| hypothetical protein C100_22665 [Sphingobium sp. C100]
Length=611

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 67/137 (49%), Gaps = 16/137 (12%)
 Frame = -1

Query  581  LDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHV  402
            LD    R LT G  +D +P WSPDGK I F+  R + GN   F IY ++PDG+GL R   
Sbjct  486  LDTRKTRVLTTG--LDNLPGWSPDGKRIVFTRKRED-GN---FDIYTIKPDGSGLFRCTD  539

Query  401  AGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGT  222
              +            H  +S D   ++++ +  G   E       FQ YG +Y+M  DG+
Sbjct  540  HPSSD---------GHAVWSPDGR-IMWSGSQHGFRDEAALYDQTFQQYGQIYVMNADGS  589

Query  221  GLQGLTWNGYENGTPAW  171
              + LT + +E+  P +
Sbjct  590  DKRLLTDSKWEDSMPLY  606


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 10/50 (20%)
 Frame = -1

Query  527  PSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  408
            P+WSPDGK +AFSS+R      H+ G    +    SIY++RPDGTG R++
Sbjct  157  PAWSPDGKWLAFSSDRNTRWTGHDKGHGWEHTQELSIYIIRPDGTGFRKV  206



>ref|WP_031310342.1| hypothetical protein [Sphingobium sp. C100]
Length=621

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 67/137 (49%), Gaps = 16/137 (12%)
 Frame = -1

Query  581  LDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHV  402
            LD    R LT G  +D +P WSPDGK I F+  R + GN   F IY ++PDG+GL R   
Sbjct  496  LDTRKTRVLTTG--LDNLPGWSPDGKRIVFTRKRED-GN---FDIYTIKPDGSGLFRCTD  549

Query  401  AGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGT  222
              +            H  +S D   ++++ +  G   E       FQ YG +Y+M  DG+
Sbjct  550  HPSSD---------GHAVWSPDGR-IMWSGSQHGFRDEAALYDQTFQQYGQIYVMNADGS  599

Query  221  GLQGLTWNGYENGTPAW  171
              + LT + +E+  P +
Sbjct  600  DKRLLTDSKWEDSMPLY  616


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 10/50 (20%)
 Frame = -1

Query  527  PSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  408
            P+WSPDGK +AFSS+R      H+ G    +    SIY++RPDGTG R++
Sbjct  167  PAWSPDGKWLAFSSDRNTRWTGHDKGHGWEHTQELSIYIIRPDGTGFRKV  216



>gb|KEQ78669.1| tricorn protease N-terminal domain-containing protein [Aureobasidium 
pullulans EXF-150]
Length=675

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 70/142 (49%), Gaps = 16/142 (11%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGL  417
            +++ G   QLT G W D  P WSPDG+LI F+   +    +    D F I  +RPDGT L
Sbjct  540  DMETGDTTQLTAG-W-DNTPGWSPDGELIVFTRQTNWTYGSSWQEDRFDICTIRPDGTDL  597

Query  416  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  237
            + +  + A  +         H  +S D   ++++  + G   E V   N FQPYG + +M
Sbjct  598  KILTESEANDA---------HAVWSFDGR-IMYSTGMYGFRDESVMYDNTFQPYGQIVVM  647

Query  236  RLDGTGLQGLTWNGYENGTPAW  171
              DG   + LT + +E+  P +
Sbjct  648  DKDGQNKKMLTDSMWEDSMPLY  669



>ref|WP_027978304.1| hypothetical protein [gamma proteobacterium L18]
Length=628

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 67/142 (47%), Gaps = 14/142 (10%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCF--SIYVVRPDGTGLRR  411
            ++D     +LT  A  D +P WSPDG  I F+    NP + + F   +Y ++PDGTG+ R
Sbjct  497  DVDTRQTTELTSEA--DNLPGWSPDGSKIVFTRKEINPADPNKFHYDVYTIKPDGTGVTR  554

Query  410  IHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRL  231
            +   GA            H  +  D   + +++ + G   E     N FQP G  ++M  
Sbjct  555  LTTPGAN---------QGHAVWLYDGR-IAYSSGVYGFRDELALYDNTFQPDGQNWVMNA  604

Query  230  DGTGLQGLTWNGYENGTPAWHP  165
            DG+G   +T   +E+  P + P
Sbjct  605  DGSGQHAITDTLWEDSMPLYVP  626



>dbj|GAD95313.1| hypothetical protein ANI_1_1672104 [Byssochlamys spectabilis 
No. 5]
Length=685

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 68/142 (48%), Gaps = 18/142 (13%)
 Frame = -1

Query  572  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGN------ADCFSIYVVRPDGTGLRR  411
            G   QLT G W D  P WSPDG+ I F+ N +          AD F IY +RPDG+ L R
Sbjct  551  GETTQLTLG-W-DNTPGWSPDGERIVFTRNNNWTAAYGARWYADRFDIYTIRPDGSELTR  608

Query  410  IHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRL  231
            +  + A  +         H  +S D   ++++  + G   E     N FQPYG + +M  
Sbjct  609  VTDSLANDA---------HAVWSQDGR-IMWSTGMYGFKDESALYDNTFQPYGQIMVMDY  658

Query  230  DGTGLQGLTWNGYENGTPAWHP  165
            DG+  + +T   +E+  P + P
Sbjct  659  DGSNKRLVTDTIWEDSMPLYMP  680



>ref|XP_007595649.1| TOXD [Colletotrichum fioriniae PJ7]
 gb|EXF80711.1| TOXD [Colletotrichum fioriniae PJ7]
Length=1021

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 70/140 (50%), Gaps = 16/140 (11%)
 Frame = -1

Query  584   ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
             +L+   +R LT+    D +P WSPDG+ I F+       +A  F +  +RPDG+ L+ + 
Sbjct  893   DLETKTVRSLTNAT--DNLPFWSPDGERIVFTRKT----SATNFDVCTIRPDGSDLQTLT  946

Query  404   VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
              +GA  +         H  +S D   +L+++ + G   E       FQPYG + +M  DG
Sbjct  947   SSGANDA---------HAVWSHDGR-ILYSSGMYGFRDEAAIYDQTFQPYGQIIVMDADG  996

Query  224   TGLQGLTWNGYENGTPAWHP  165
             +  + LT + +E+  P + P
Sbjct  997   SNKRMLTDSLWEDSMPLYVP  1016



>ref|WP_043436880.1| hypothetical protein [Streptomyces nodosus]
 gb|AJE38818.1| hypothetical protein SNOD_01070 [Streptomyces nodosus]
Length=642

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 63/126 (50%), Gaps = 14/126 (11%)
 Frame = -1

Query  536  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  357
            D +P WS DGKLI F+  +  P N   F +  ++PDG  LR +  +GA            
Sbjct  527  DNLPDWSADGKLILFT-RKTGPTN---FDVCTIQPDGGNLRVLTTSGAND---------G  573

Query  356  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGLTWNGYENGTP  177
            H  ++ D   +L+ + + G   E     + FQPYG +  M  DG+G Q LT + +E+  P
Sbjct  574  HAVWNYDGR-ILYNSGMYGFREEAALYDDTFQPYGQIMAMNADGSGKQLLTDSQWEDSMP  632

Query  176  AWHPKA  159
             + P++
Sbjct  633  LYLPQS  638



>gb|EKG10177.1| Six-bladed beta-propeller TolB-like protein [Macrophomina phaseolina 
MS6]
Length=642

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 68/140 (49%), Gaps = 16/140 (11%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            +L    +R LT+    D +P WSPDG+ I F+       NA  F +  +RPDGT L+ + 
Sbjct  514  DLQDKSMRFLTNAT--DNLPGWSPDGERIVFTRKM----NATNFDVCTIRPDGTDLQVLT  567

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +GA  +         H  +++D   + F+  + G   E       FQPYG + +M  DG
Sbjct  568  SSGANDA---------HAVWTADGR-IAFSTGMYGFRDEAAIYDQTFQPYGQIMIMDADG  617

Query  224  TGLQGLTWNGYENGTPAWHP  165
            +  + +T + +E+  P + P
Sbjct  618  SSKRLITDSIWEDSMPLYVP  637



>ref|WP_041532010.1| translocation protein TolB [Pelobacter carbinolicus]
Length=433

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 69/138 (50%), Gaps = 28/138 (20%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            +L GG   +LT     +  P+WSPDGK IAF+  R   G    F IY VRPDGT  RR+ 
Sbjct  320  DLLGGQTARLTANGKYNATPAWSPDGKRIAFT--RLEKG---VFDIYTVRPDGTDERRLT  374

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
                 G++E       H  +S DS +++++++  G                 +Y+MR DG
Sbjct  375  F--GPGNKE-------HPRWSPDSRFLVYSSDQDGRKG--------------IYIMRADG  411

Query  224  TGLQGLTWNGYENGTPAW  171
            TG++ ++  G +   PAW
Sbjct  412  TGIRRISAGGGQCQHPAW  429



>sp|Q3A097.2|TOLB_PELCD RecName: Full=Protein TolB; Flags: Precursor [Pelobacter carbinolicus 
DSM 2380]
 gb|ABA90210.2| biopolymer transport periplasmic beta-propeller repeat protein, 
TolB-related protein [Pelobacter carbinolicus DSM 2380]
Length=430

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 69/138 (50%), Gaps = 28/138 (20%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            +L GG   +LT     +  P+WSPDGK IAF+  R   G    F IY VRPDGT  RR+ 
Sbjct  317  DLLGGQTARLTANGKYNATPAWSPDGKRIAFT--RLEKG---VFDIYTVRPDGTDERRLT  371

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
                 G++E       H  +S DS +++++++  G                 +Y+MR DG
Sbjct  372  F--GPGNKE-------HPRWSPDSRFLVYSSDQDGRKG--------------IYIMRADG  408

Query  224  TGLQGLTWNGYENGTPAW  171
            TG++ ++  G +   PAW
Sbjct  409  TGIRRISAGGGQCQHPAW  426



>gb|KGO45093.1| WD40-like Beta Propeller [Penicillium expansum]
Length=677

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 72/134 (54%), Gaps = 16/134 (12%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  387
            I QLT G W D +PS+SPDG+ I F+  + +P N   + +  +RPDGT LR +  +GA  
Sbjct  556  ITQLTSG-W-DNLPSFSPDGEFIIFT-RKVSPTN---YEVCTIRPDGTDLRILTSSGAND  609

Query  386  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGL  207
            +         H  +  D + +L+++ + G   E     + FQPYG + +M  DG+  + L
Sbjct  610  A---------HAVWRQDGK-ILWSSGMYGFQYECALYDHTFQPYGQIMIMDSDGSNKRAL  659

Query  206  TWNGYENGTPAWHP  165
            T + +E+  P + P
Sbjct  660  TNSIWEDSMPLFLP  673



>gb|ESZ89568.1| hypothetical protein SBOR_10048 [Sclerotinia borealis F-4157]
Length=677

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 66/141 (47%), Gaps = 16/141 (11%)
 Frame = -1

Query  581  LDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLR  414
            L  G I  LTD  W D  P WS DG+ I F+   H    + G+ D + IY + P+GTGL 
Sbjct  541  LTDGTITNLTD-TW-DNTPGWSADGERIVFTRRNHLDFTDLGSTDSYDIYTIHPNGTGLT  598

Query  413  RIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMR  234
            ++  +G   +         H  ++ D   +L+++ + G   E     N FQPYG +  M 
Sbjct  599  QLTTSGTNDA---------HAVWTDDGR-ILYSSGMYGFREESSLYDNAFQPYGQIMSMN  648

Query  233  LDGTGLQGLTWNGYENGTPAW  171
             DG     LT   +E+  P +
Sbjct  649  GDGGNKTLLTDTMWEDSMPLY  669



>gb|KGO53636.1| WD40-like Beta Propeller [Penicillium expansum]
 gb|KGO61373.1| WD40-like Beta Propeller [Penicillium expansum]
Length=677

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 72/134 (54%), Gaps = 16/134 (12%)
 Frame = -1

Query  566  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  387
            I QLT G W D +PS+SPDG+ I F+  + +P N   + +  +RPDGT LR +  +GA  
Sbjct  556  ITQLTSG-W-DNLPSFSPDGEFIIFT-RKVSPTN---YEVCTIRPDGTDLRILTSSGAND  609

Query  386  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQGL  207
            +         H  +  D + +L+++ + G   E     + FQPYG + +M  DG+  + L
Sbjct  610  A---------HAVWRQDGK-ILWSSGMYGFQYECALYDHTFQPYGQIMIMDSDGSNKRAL  659

Query  206  TWNGYENGTPAWHP  165
            T + +E+  P + P
Sbjct  660  TNSIWEDSMPLFLP  673



>gb|EKV04294.1| hypothetical protein PDIP_88020 [Penicillium digitatum Pd1]
 gb|EKV17164.1| hypothetical protein PDIG_16510 [Penicillium digitatum PHI26]
Length=676

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 72/140 (51%), Gaps = 16/140 (11%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            +LD   I QLT G W D +PS+SPDG+ I F+       ++  + +  +RPDGT  R + 
Sbjct  549  DLDTREITQLTSG-W-DNLPSFSPDGEFIVFTRKV----SSSNYEVCTIRPDGTDFRILT  602

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +GA  +         H  +  D + +++++ + G   E     + FQPYG + +M  DG
Sbjct  603  SSGANDA---------HAVWRQDGK-IMWSSGMYGFQYECALYDDTFQPYGQIMIMDSDG  652

Query  224  TGLQGLTWNGYENGTPAWHP  165
            +  + LT + +E+  P + P
Sbjct  653  SNKRALTNSIWEDSMPLFLP  672



>ref|XP_007835900.1| hypothetical protein PFICI_09128 [Pestalotiopsis fici W106-1]
 gb|ETS79275.1| hypothetical protein PFICI_09128 [Pestalotiopsis fici W106-1]
Length=678

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 74/148 (50%), Gaps = 18/148 (12%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNR---HNPGNA---DCFSIYVVRPDGT  423
            +++ G   Q+T+G W D  P WSPDG+LI F+       + GN    D + I  ++PDGT
Sbjct  540  DMETGNTTQITNG-W-DNTPGWSPDGELIVFARQTNWTQDYGNRWYDDRYDIATIKPDGT  597

Query  422  GLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLY  243
             L+ +  + A  +         H  ++ D   +++ + + G   E     N FQPYG + 
Sbjct  598  DLKILTESHANDA---------HAVWAPDGR-IMYNSGMHGFRDESPLYDNTFQPYGQII  647

Query  242  MMRLDGTGLQGLTWNGYENGTPAWHPKA  159
            +M  DG+    LT + +E+  P + P++
Sbjct  648  IMNADGSNKTALTDSMWEDSMPQYIPRS  675



>ref|WP_043399319.1| tolB protein precursor protein, partial [Cystobacter violaceus]
Length=349

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 78/164 (48%), Gaps = 33/164 (20%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            + DG  +R+LT     D  P WSPDGK I+F S+R          ++VV+PDGTGLR + 
Sbjct  189  KADGTDVRRLTSFHKEDMAPKWSPDGKWISFLSDREG-----RVRVFVVKPDGTGLRAVS  243

Query  404  VAGAEGSEE-----VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPN--------QF  264
             +   G E       + ++L  V  + D +  ++ A++GG   EPV++ +        ++
Sbjct  244  GSQQTGEEREPVWSPDGKKLAFVGRAKDQKSRIWVADMGG--GEPVALTDGKSTDDQPEW  301

Query  263  QPYG-------------DLYMMRLDGTGLQGLTWNGYENGTPAW  171
             P G             +L++MR +G+G   LT     +  P W
Sbjct  302  SPDGKYLAFASERTGDVELFLMRANGSGQTQLTSTKGADWLPRW  345



>ref|XP_007588104.1| putative tat pathway signal sequence domain-containing protein 
[Neofusicoccum parvum UCRNP2]
 gb|EOD44421.1| putative tat pathway signal sequence domain-containing protein 
[Neofusicoccum parvum UCRNP2]
Length=590

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 67/140 (48%), Gaps = 16/140 (11%)
 Frame = -1

Query  584  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  405
            +L    +R LT+    D +P WSPDG+ I F+       NA  F +  +RPDGT L+R+ 
Sbjct  462  DLQDKSMRFLTNAT--DNLPGWSPDGERIVFTRKM----NATNFDVCTIRPDGTDLQRLT  515

Query  404  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  225
             +GA  +         H  ++ D   + +++   G   E       FQPYG + +M  DG
Sbjct  516  TSGANDA---------HAVWTWDGR-IAYSSGEYGFRDEAAIYDETFQPYGQIIVMNADG  565

Query  224  TGLQGLTWNGYENGTPAWHP  165
            +    +T + +E+  P + P
Sbjct  566  SDKHMVTDSMWEDSMPLYIP  585



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455