BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF044I01

Length=246
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007013884.1|  Serine carboxypeptidase-like 29                  60.1    2e-08   Theobroma cacao [chocolate]
ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2          58.2    8e-08   Nicotiana sylvestris
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2          57.8    1e-07   Solanum lycopersicum
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like     57.4    2e-07   Solanum tuberosum [potatoes]
ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2          56.6    3e-07   Nicotiana tomentosiformis
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2          56.6    4e-07   Eucalyptus grandis [rose gum]
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like     56.6    4e-07   Eucalyptus grandis [rose gum]
ref|XP_002528403.1|  serine carboxypeptidase, putative                53.5    4e-06   Ricinus communis
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg              52.4    9e-06   Erythranthe guttata [common monkey flower]
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2          52.4    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2          52.0    1e-05   Fragaria vesca subsp. vesca
gb|KEH38195.1|  serine carboxypeptidase-like protein                  52.0    1e-05   Medicago truncatula
ref|XP_003595892.1|  Serine carboxypeptidase II-2                     52.0    1e-05   Medicago truncatula
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g           52.0    1e-05   Phaseolus vulgaris [French bean]
ref|XP_011018073.1|  PREDICTED: serine carboxypeptidase II-2-like     51.6    2e-05   Populus euphratica
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g           51.6    2e-05   
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...  51.2    2e-05   Populus euphratica
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein       51.2    2e-05   
emb|CDP02851.1|  unnamed protein product                              49.7    7e-05   Coffea canephora [robusta coffee]
emb|CAN75200.1|  hypothetical protein VITISV_014887                   49.7    7e-05   Vitis vinifera
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2          49.7    7e-05   Vitis vinifera
ref|XP_003595891.1|  Serine carboxypeptidase-like protein             49.7    8e-05   Medicago truncatula
ref|XP_003595890.1|  Serine carboxypeptidase II-2                     49.7    8e-05   Medicago truncatula
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like     49.3    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO62276.1|  hypothetical protein CISIN_1g0418331mg                46.2    1e-04   Citrus sinensis [apfelsine]
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg           48.9    1e-04   Citrus clementina [clementine]
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg           48.9    2e-04   Citrus clementina [clementine]
gb|KDP38716.1|  hypothetical protein JCGZ_04069                       48.1    2e-04   Jatropha curcas
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like     48.5    2e-04   Cicer arietinum [garbanzo]
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like  48.5    2e-04   Citrus sinensis [apfelsine]
gb|KHN02055.1|  Serine carboxypeptidase II-2                          48.1    2e-04   Glycine soja [wild soybean]
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like     48.1    2e-04   Glycine max [soybeans]
ref|XP_006470942.1|  PREDICTED: serine carboxypeptidase II-2-like     47.8    2e-04   
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2          48.1    3e-04   Sesamum indicum [beniseed]
gb|AFK34001.1|  unknown                                               47.0    3e-04   Medicago truncatula
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2          47.4    4e-04   Prunus mume [ume]
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg           47.4    4e-04   Prunus persica
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                  47.4    5e-04   
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2          46.6    8e-04   Nelumbo nucifera [Indian lotus]
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like     46.6    0.001   Setaria italica



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPKLALTLV++FL+GTSMPGL+ +SDS
Sbjct  444  HEVPLHRPKLALTLVKAFLSGTSMPGLEQVSDS  476



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPK ALTLV+SFLAG SMP LQ ISDS
Sbjct  438  HEVALHRPKQALTLVKSFLAGASMPSLQQISDS  470



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPK ALTLV+SFLAGTSMP L+ ISDS
Sbjct  433  HEVALHRPKQALTLVKSFLAGTSMPSLELISDS  465



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPK ALTLV+SFLAGTSMP L+ ISDS
Sbjct  433  HEVALHRPKQALTLVKSFLAGTSMPSLELISDS  465



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPK ALTLV+SFLAG+SMP L+ ISDS
Sbjct  438  HEVALHRPKQALTLVKSFLAGSSMPSLELISDS  470



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPKLAL L+++FLAGTSMP LQ +SDS
Sbjct  441  HEVPLHRPKLALALIKAFLAGTSMPSLQLVSDS  473



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPKLAL L+++FLAGTSMP LQ +SDS
Sbjct  441  HEVPLHRPKLALALIKAFLAGTSMPSLQLVSDS  473



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPKLALTL+++FL+GTSMP L+ +S S
Sbjct  448  HEVPLHRPKLALTLIKAFLSGTSMPTLEPVSSS  480



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPK ALTLV+SFL+G SMP L+ +SDS
Sbjct  444  HEVPLHRPKQALTLVKSFLSGISMPKLELVSDS  476



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHR KL+LTLV+SFLAG SMP L+ +SDS
Sbjct  443  HEVPLHRAKLSLTLVKSFLAGESMPTLEQVSDS  475



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH+PKLAL L+++FL+G+SMP LQ +SDS
Sbjct  438  HEVPLHKPKLALALIKNFLSGSSMPSLQLVSDS  470



>gb|KEH38195.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=441

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGIS  153
            HEV LHRPKLALTL+++FLAGTSMP L+ ++
Sbjct  408  HEVPLHRPKLALTLIKAFLAGTSMPTLEPLT  438



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGIS  153
            HEV LHRPKLALTL+++FLAGTSMP L+ ++
Sbjct  439  HEVPLHRPKLALTLIKAFLAGTSMPTLEPLT  469



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH+PKLALTLV++FLAGTSMP L  +S S
Sbjct  440  HEVPLHKPKLALTLVQTFLAGTSMPNLDLLSTS  472



>ref|XP_011018073.1| PREDICTED: serine carboxypeptidase II-2-like [Populus euphratica]
Length=371

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH+PK ALTLV++FL+GT MP LQ +SDS
Sbjct  339  HEVPLHKPKQALTLVKAFLSGTPMPTLQLVSDS  371



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH+PK ALTLV++FL+GT MP LQ +SDS
Sbjct  434  HEVPLHKPKQALTLVKAFLSGTPMPTLQLVSDS  466



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH+PK ALTLV++FL+GT MP LQ +SDS
Sbjct  446  HEVPLHKPKQALTLVKAFLSGTPMPTLQLVSDS  478



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH+PK ALTLV++FL+GT MP LQ +SDS
Sbjct  438  HEVPLHKPKQALTLVKAFLSGTPMPTLQLVSDS  470



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPK ALTL +SF++G S+P L+ ISDS
Sbjct  440  HEVPLHRPKQALTLFKSFISGNSLPQLEQISDS  472



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH+PK ALTL+ +FL GTSMP L+ ++DS
Sbjct  492  HEVPLHKPKQALTLINAFLKGTSMPSLEQLADS  524



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH+PK ALTL+ +FL GTSMP L+ ++DS
Sbjct  437  HEVPLHKPKQALTLINAFLKGTSMPSLEQLADS  469



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQ  162
            HEV LHRPKLALTL+++FL GTSMP L+
Sbjct  438  HEVPLHRPKLALTLIKAFLEGTSMPTLE  465



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQ  162
            HEV LHRPKLALTL+++FL GTSMP L+
Sbjct  438  HEVPLHRPKLALTLIKAFLEGTSMPTLE  465



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH+PKLAL L +SFL+G+SMP   G+ DS
Sbjct  441  HEVPLHQPKLALVLFKSFLSGSSMPTFTGLDDS  473



>gb|KDO62276.1| hypothetical protein CISIN_1g0418331mg, partial [Citrus sinensis]
Length=106

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPK ALTL++SFL+G SMP L+ +S S
Sbjct  72   HEVPLHRPKPALTLIKSFLSGRSMPCLKRVSHS  104



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPK ALTL++SFL+G SMP L+ +S S
Sbjct  440  HEVPLHRPKPALTLIKSFLSGRSMPCLERVSHS  472



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPK ALTL++SFL+G SMP L+ +S S
Sbjct  457  HEVPLHRPKPALTLIKSFLSGRSMPCLERVSHS  489



>gb|KDP38716.1| hypothetical protein JCGZ_04069 [Jatropha curcas]
Length=266

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            H+V LHRPKLALTL+++FL+GTSMP L+  S S
Sbjct  234  HKVPLHRPKLALTLLKAFLSGTSMPTLEQASAS  266



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQ  162
            HEV LH+PKLALTL ++FLAGTSMP L+
Sbjct  451  HEVPLHKPKLALTLFKAFLAGTSMPTLE  478



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPK ALTL++SFL+G SMP L+ +S S
Sbjct  440  HEVPLHRPKPALTLIKSFLSGRSMPCLKRVSHS  472



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH PKLALTL ++FLAGTSMP L+ +  S
Sbjct  437  HEVPLHSPKLALTLFKAFLAGTSMPNLELVGAS  469



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH PKLALTL ++FLAGTSMP L+ +  S
Sbjct  451  HEVPLHSPKLALTLFKAFLAGTSMPNLELVGAS  483



>ref|XP_006470942.1| PREDICTED: serine carboxypeptidase II-2-like [Citrus sinensis]
Length=315

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LHRPK ALTL++SFL+G SMP L+ +S S
Sbjct  281  HEVPLHRPKPALTLIKSFLSGRSMPCLERVSLS  313



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISD  150
            HEV LH+PK ALTL++S+L+G SMP L+ +SD
Sbjct  442  HEVPLHKPKQALTLIKSYLSGNSMPKLELVSD  473



>gb|AFK34001.1| unknown [Medicago truncatula]
Length=239

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQ  162
            HEV LHRPKLALTL+++FL GTSMP L+
Sbjct  204  HEVPLHRPKLALTLIKAFLEGTSMPTLE  231



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH+PK ALTL+++FL+G+SMP  + +SDS
Sbjct  441  HEVPLHKPKQALTLIKAFLSGSSMPSSELVSDS  473



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH+PK ALTL+++FL+G+SMP  + +SDS
Sbjct  441  HEVPLHKPKQALTLIKAFLSGSSMPSSELVSDS  473



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH+PK ALTL++SFL+G  MP L  +SDS
Sbjct  463  HEVPLHKPKQALTLIKSFLSGLPMPNLNLVSDS  495



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMPGLQGISDS  147
            HEV LH+PKLAL+L+++FL+G  MP L   SDS
Sbjct  453  HEVPLHKPKLALSLIKAFLSGRQMPTLTEYSDS  485



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -2

Query  245  HEVVLHRPKLALTLVESFLAGTSMP  171
            HEV LHRPK ALTL++SFLAGT MP
Sbjct  441  HEVPLHRPKQALTLIKSFLAGTPMP  465



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557676237175