BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF044H10

Length=552
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009628597.1|  PREDICTED: ataxin-2 homolog                        123   1e-29   Nicotiana tomentosiformis
ref|XP_009782976.1|  PREDICTED: vacuolar protein sorting-associat...    120   2e-28   Nicotiana sylvestris
ref|XP_004243351.1|  PREDICTED: bromodomain-containing protein 4-...    118   1e-27   Solanum lycopersicum
ref|XP_006357482.1|  PREDICTED: transcription factor SPT20 homolog      114   3e-26   Solanum tuberosum [potatoes]
ref|XP_009628959.1|  PREDICTED: extensin-like                           113   6e-26   Nicotiana tomentosiformis
ref|XP_006367642.1|  PREDICTED: adenylate cyclase, terminal-diffe...    113   6e-26   Solanum tuberosum [potatoes]
ref|XP_009782624.1|  PREDICTED: pollen-specific leucine-rich repe...    113   7e-26   Nicotiana sylvestris
ref|XP_004248167.1|  PREDICTED: bromodomain-containing protein 4        112   2e-25   Solanum lycopersicum
ref|XP_010110218.1|  hypothetical protein L484_009824                   107   8e-24   Morus notabilis
emb|CDP14783.1|  unnamed protein product                                107   8e-24   Coffea canephora [robusta coffee]
ref|XP_007198900.1|  hypothetical protein PRUPE_ppa004117mg             101   1e-21   Prunus persica
ref|XP_008229158.1|  PREDICTED: mediator of RNA polymerase II tra...    101   2e-21   Prunus mume [ume]
ref|XP_008229157.1|  PREDICTED: mediator of RNA polymerase II tra...    101   2e-21   Prunus mume [ume]
ref|XP_008337475.1|  PREDICTED: altered inheritance of mitochondr...    100   2e-21   
ref|XP_010689008.1|  PREDICTED: RNA polymerase II degradation fac...    100   4e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB31694.1|  hypothetical protein B456_005G201600                  99.8    5e-21   Gossypium raimondii
ref|XP_009357856.1|  PREDICTED: putative uncharacterized protein ...  99.0    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_007043595.1|  Structural constituent of cell wall              97.8    3e-20   
ref|XP_008342911.1|  PREDICTED: extensin-like isoform X2              97.4    4e-20   
ref|XP_008342910.1|  PREDICTED: extensin-like isoform X1              97.4    4e-20   
ref|XP_002272844.1|  PREDICTED: arginine-glutamic acid dipeptide ...  97.1    5e-20   Vitis vinifera
gb|EYU28592.1|  hypothetical protein MIMGU_mgv1a004659mg              96.3    8e-20   Erythranthe guttata [common monkey flower]
ref|XP_004303103.1|  PREDICTED: transcriptional regulator DEF1        95.5    2e-19   Fragaria vesca subsp. vesca
ref|XP_009341976.1|  PREDICTED: ATP-dependent helicase brm-like i...  95.1    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_009341977.1|  PREDICTED: ATP-dependent helicase brm-like i...  95.1    3e-19   Pyrus x bretschneideri [bai li]
gb|KDP24130.1|  hypothetical protein JCGZ_25787                       94.7    4e-19   Jatropha curcas
ref|XP_009336198.1|  PREDICTED: mediator of RNA polymerase II tra...  94.4    4e-19   Pyrus x bretschneideri [bai li]
ref|XP_009336199.1|  PREDICTED: mediator of RNA polymerase II tra...  94.4    4e-19   Pyrus x bretschneideri [bai li]
ref|XP_011098021.1|  PREDICTED: extensin                              93.6    7e-19   Sesamum indicum [beniseed]
ref|XP_004506616.1|  PREDICTED: transcription factor SPT20 homolog    93.2    1e-18   Cicer arietinum [garbanzo]
gb|KEH17617.1|  structural constituent of cell wall protein, puta...  93.2    1e-18   Medicago truncatula
ref|XP_007132659.1|  hypothetical protein PHAVU_011G113900g           92.4    2e-18   Phaseolus vulgaris [French bean]
gb|KDO51850.1|  hypothetical protein CISIN_1g008878mg                 92.0    3e-18   Citrus sinensis [apfelsine]
gb|KDO51849.1|  hypothetical protein CISIN_1g008878mg                 92.0    3e-18   Citrus sinensis [apfelsine]
ref|XP_006447363.1|  hypothetical protein CICLE_v10014791mg           92.0    3e-18   Citrus clementina [clementine]
ref|XP_006447362.1|  hypothetical protein CICLE_v10014791mg           92.0    3e-18   Citrus clementina [clementine]
gb|KHN31988.1|  hypothetical protein glysoja_025822                   91.3    5e-18   Glycine soja [wild soybean]
ref|XP_010035753.1|  PREDICTED: RNA polymerase II degradation fac...  91.3    5e-18   Eucalyptus grandis [rose gum]
ref|XP_006592435.1|  PREDICTED: putative uncharacterized protein ...  90.9    7e-18   Glycine max [soybeans]
ref|XP_003539922.1|  PREDICTED: putative uncharacterized protein ...  90.9    7e-18   Glycine max [soybeans]
ref|XP_002325597.2|  hydroxyproline-rich glycoprotein                 90.5    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002517918.1|  structural constituent of cell wall, putative    90.1    1e-17   Ricinus communis
ref|XP_011002849.1|  PREDICTED: calcium-binding protein P-like        90.1    2e-17   Populus euphratica
gb|KHG27956.1|  S-adenosylmethionine synthase 1                       89.7    2e-17   Gossypium arboreum [tree cotton]
gb|KCW89535.1|  hypothetical protein EUGRSUZ_A01820                   89.0    3e-17   Eucalyptus grandis [rose gum]
gb|KEH39132.1|  structural constituent of cell wall protein, puta...  89.0    3e-17   Medicago truncatula
ref|XP_010051997.1|  PREDICTED: LOW QUALITY PROTEIN: bromodomain-...  89.0    3e-17   Eucalyptus grandis [rose gum]
gb|KJB77269.1|  hypothetical protein B456_012G128800                  87.0    3e-17   Gossypium raimondii
gb|KEH39131.1|  structural constituent of cell wall protein, puta...  88.6    4e-17   Medicago truncatula
gb|KJB77268.1|  hypothetical protein B456_012G128800                  89.0    4e-17   Gossypium raimondii
gb|KJB77274.1|  hypothetical protein B456_012G128800                  88.2    4e-17   Gossypium raimondii
gb|KJB77267.1|  hypothetical protein B456_012G128800                  87.8    4e-17   Gossypium raimondii
gb|KJB77271.1|  hypothetical protein B456_012G128800                  89.0    4e-17   Gossypium raimondii
ref|XP_002869511.1|  hypothetical protein ARALYDRAFT_491942           88.2    5e-17   
ref|NP_974630.1|  uncharacterized protein                             87.4    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194559.2|  uncharacterized protein                             87.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAB79632.1|  predicted proline-rich protein                       87.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006376495.1|  hydroxyproline-rich glycoprotein                 87.0    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009144355.1|  PREDICTED: protein transport protein SEC31-like  86.7    2e-16   Brassica rapa
ref|XP_006283593.1|  hypothetical protein CARUB_v10004649mg           86.3    3e-16   Capsella rubella
ref|XP_009137778.1|  PREDICTED: basic salivary proline-rich prote...  85.9    4e-16   Brassica rapa
emb|CDY67879.1|  BnaC07g50480D                                        85.1    6e-16   Brassica napus [oilseed rape]
gb|KFK35898.1|  hypothetical protein AALP_AA4G050800                  85.1    6e-16   Arabis alpina [alpine rockcress]
emb|CDX89188.1|  BnaA01g17050D                                        84.7    8e-16   
ref|XP_010438481.1|  PREDICTED: formin-like protein 5                 84.3    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010433239.1|  PREDICTED: bromodomain-containing protein 4-...  84.3    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010448000.1|  PREDICTED: vacuolar protein-sorting protein ...  84.3    1e-15   Camelina sativa [gold-of-pleasure]
emb|CDY18985.1|  BnaC01g20830D                                        84.0    2e-15   Brassica napus [oilseed rape]
ref|XP_006412973.1|  hypothetical protein EUTSA_v10024987mg           83.6    2e-15   Eutrema salsugineum [saltwater cress]
emb|CDX97433.1|  BnaC08g12980D                                        82.8    4e-15   
ref|XP_006582794.1|  PREDICTED: vacuolar protein sorting-associat...  82.0    6e-15   
emb|CDY25250.1|  BnaA02g22060D                                        82.0    7e-15   Brassica napus [oilseed rape]
gb|KHN35253.1|  hypothetical protein glysoja_042323                   82.0    7e-15   Glycine soja [wild soybean]
ref|XP_010924426.1|  PREDICTED: putative cyclin-dependent serine/...  81.3    8e-15   
emb|CDY14248.1|  BnaA08g13790D                                        81.6    9e-15   Brassica napus [oilseed rape]
ref|XP_009109102.1|  PREDICTED: formin-like protein 3                 81.3    1e-14   Brassica rapa
ref|XP_010924425.1|  PREDICTED: hepatocyte growth factor-regulate...  80.9    2e-14   Elaeis guineensis
ref|XP_010540875.1|  PREDICTED: extensin                              79.7    4e-14   Tarenaya hassleriana [spider flower]
gb|EPS62243.1|  hypothetical protein M569_12549                       78.2    2e-13   Genlisea aurea
ref|XP_010242911.1|  PREDICTED: RNA polymerase II degradation fac...  77.8    3e-13   Nelumbo nucifera [Indian lotus]
ref|XP_008455322.1|  PREDICTED: transcription factor SPT20 homolog    77.4    3e-13   Cucumis melo [Oriental melon]
ref|XP_004136824.1|  PREDICTED: uncharacterized protein LOC101206745  77.4    3e-13   Cucumis sativus [cucumbers]
ref|XP_008810226.1|  PREDICTED: ataxin-2 homolog isoform X2           76.6    5e-13   Phoenix dactylifera
ref|XP_003540363.1|  PREDICTED: integrator complex subunit 3 homo...  76.6    6e-13   Glycine max [soybeans]
ref|XP_008810225.1|  PREDICTED: ataxin-2 homolog isoform X1           76.3    6e-13   Phoenix dactylifera
ref|XP_008455323.1|  PREDICTED: mediator of RNA polymerase II tra...  76.6    6e-13   Cucumis melo [Oriental melon]
ref|XP_004136823.1|  PREDICTED: uncharacterized protein LOC101206501  75.5    1e-12   Cucumis sativus [cucumbers]
ref|XP_008798248.1|  PREDICTED: putative cyclin-dependent serine/...  75.1    2e-12   Phoenix dactylifera
ref|XP_007149849.1|  hypothetical protein PHAVU_005G103700g           74.7    3e-12   Phaseolus vulgaris [French bean]
ref|XP_011037330.1|  PREDICTED: putative uncharacterized protein ...  73.9    4e-12   Populus euphratica
ref|XP_011037329.1|  PREDICTED: bromodomain-containing protein 4-...  73.9    4e-12   Populus euphratica
gb|EEC71500.1|  hypothetical protein OsI_03777                        71.6    3e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001044280.1|  Os01g0754500                                     71.6    3e-11   
ref|XP_006644725.1|  PREDICTED: mediator of RNA polymerase II tra...  71.6    3e-11   Oryza brachyantha
ref|XP_006644724.1|  PREDICTED: mediator of RNA polymerase II tra...  71.6    3e-11   Oryza brachyantha
dbj|BAK01177.1|  predicted protein                                    71.2    4e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004969990.1|  PREDICTED: trithorax group protein osa-like      70.5    7e-11   Setaria italica
ref|XP_003543336.1|  PREDICTED: RNA polymerase II degradation fac...  70.1    9e-11   Glycine max [soybeans]
ref|XP_010919602.1|  PREDICTED: tyrosine-protein phosphatase non-...  69.7    1e-10   Elaeis guineensis
gb|KHN36637.1|  hypothetical protein glysoja_001368                   69.3    1e-10   Glycine soja [wild soybean]
ref|XP_010919593.1|  PREDICTED: tyrosine-protein phosphatase non-...  69.3    1e-10   Elaeis guineensis
gb|EMT05386.1|  hypothetical protein F775_26441                       69.7    2e-10   
ref|XP_009395702.1|  PREDICTED: pollen-specific leucine-rich repe...  69.3    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM84126.1|  unnamed protein product                              68.6    3e-10   Triticum aestivum [Canadian hard winter wheat]
gb|EMS50510.1|  hypothetical protein TRIUR3_23019                     68.6    3e-10   Triticum urartu
ref|XP_002458505.1|  hypothetical protein SORBIDRAFT_03g034890        67.4    7e-10   Sorghum bicolor [broomcorn]
ref|NP_001169238.1|  uncharacterized protein LOC100383096             63.9    8e-09   Zea mays [maize]
ref|XP_008655245.1|  PREDICTED: uncharacterized protein LOC100383...  63.9    1e-08   Zea mays [maize]
ref|XP_009396506.1|  PREDICTED: pinin-like                            60.8    8e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH24794.1|  DNA-binding protein, putative                         55.5    6e-06   Medicago truncatula
ref|XP_008795992.1|  PREDICTED: protein transport protein SEC31-like  53.9    2e-05   
ref|XP_006446566.1|  hypothetical protein CICLE_v10014743mg           53.5    3e-05   Citrus clementina [clementine]
ref|XP_006470271.1|  PREDICTED: COPII coat assembly protein sec16...  53.1    3e-05   Citrus sinensis [apfelsine]
ref|XP_006643803.1|  PREDICTED: vegetative cell wall protein gp1-...  52.8    4e-05   Oryza brachyantha
gb|KDO55180.1|  hypothetical protein CISIN_1g0084162mg                52.4    5e-05   Citrus sinensis [apfelsine]
ref|XP_001784568.1|  predicted protein                                52.4    5e-05   
ref|XP_010940140.1|  PREDICTED: protein diaphanous homolog 1-like     52.4    5e-05   Elaeis guineensis
gb|KDO55179.1|  hypothetical protein CISIN_1g0084162mg                52.4    6e-05   Citrus sinensis [apfelsine]
gb|KDO55178.1|  hypothetical protein CISIN_1g0084162mg                52.4    6e-05   Citrus sinensis [apfelsine]
ref|XP_006655038.1|  PREDICTED: vegetative cell wall protein gp1-...  51.6    9e-05   Oryza brachyantha
ref|XP_008801947.1|  PREDICTED: arginine-glutamic acid dipeptide ...  51.6    1e-04   Phoenix dactylifera
ref|XP_001770189.1|  predicted protein                                51.2    1e-04   
emb|CAJ44247.1|  hypothetical protein                                 48.9    1e-04   Cocos nucifera
ref|XP_011097415.1|  PREDICTED: protein enabled-like                  51.2    2e-04   Sesamum indicum [beniseed]
ref|XP_001758183.1|  predicted protein                                50.4    2e-04   
ref|XP_010108811.1|  hypothetical protein L484_020546                 50.4    3e-04   Morus notabilis
ref|XP_009388841.1|  PREDICTED: bromodomain-containing protein 4      50.1    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002300038.2|  hypothetical protein POPTR_0001s34990g           49.7    4e-04   
ref|XP_007031556.1|  Uncharacterized protein TCM_016944               49.7    5e-04   
ref|XP_011047322.1|  PREDICTED: vacuolar protein sorting-associat...  49.3    6e-04   Populus euphratica
gb|KHG02060.1|  Myosin-2                                              49.3    7e-04   Gossypium arboreum [tree cotton]
gb|KJB75894.1|  hypothetical protein B456_012G063600                  49.3    7e-04   Gossypium raimondii
ref|NP_001042136.2|  Os01g0169900                                     48.9    7e-04   
ref|XP_010906083.1|  PREDICTED: protein transport protein SEC31       48.9    8e-04   Elaeis guineensis



>ref|XP_009628597.1| PREDICTED: ataxin-2 homolog [Nicotiana tomentosiformis]
Length=535

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 2/75 (3%)
 Frame = -1

Query  552  PQPA-NXNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            PQP  + N+MVRPPQ +RN P YNEL+EKL SMGYR DH++NVIQR+EESGQPVDFNAVL
Sbjct  462  PQPTPSANLMVRPPQLVRNHP-YNELIEKLVSMGYRADHVVNVIQRLEESGQPVDFNAVL  520

Query  375  DRLNGHSSGGSQKGW  331
            DRLNGHSSGGSQ+GW
Sbjct  521  DRLNGHSSGGSQRGW  535



>ref|XP_009782976.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Nicotiana sylvestris]
Length=535

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 66/75 (88%), Gaps = 2/75 (3%)
 Frame = -1

Query  552  PQPA-NXNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            PQP  + N+MVRPPQ +RN P + EL+EK+ SMGYR DH+INVIQR+EESGQPVDFNAVL
Sbjct  462  PQPTPSANLMVRPPQLVRNHP-FKELIEKMVSMGYRADHVINVIQRLEESGQPVDFNAVL  520

Query  375  DRLNGHSSGGSQKGW  331
            DRLNGHSSGGSQ+GW
Sbjct  521  DRLNGHSSGGSQRGW  535



>ref|XP_004243351.1| PREDICTED: bromodomain-containing protein 4-like [Solanum lycopersicum]
Length=537

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  549  QPA-NXNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLD  373
            QPA + N+MVRPPQ +RN P YNEL+EKL SMGYR DH++NVIQR+EESGQPVDFNA+LD
Sbjct  465  QPAPSPNLMVRPPQQVRNHP-YNELIEKLVSMGYRGDHVVNVIQRLEESGQPVDFNAILD  523

Query  372  RLNGHSSGGSQKGW  331
            R+NGHSSGG Q+GW
Sbjct  524  RMNGHSSGGPQRGW  537



>ref|XP_006357482.1| PREDICTED: transcription factor SPT20 homolog [Solanum tuberosum]
Length=537

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = -1

Query  534  NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHS  355
            N+MVRP Q +RN P YNEL+EKL SMGYR DH++NVIQR+EESGQPVDFNA+LD +NGHS
Sbjct  471  NLMVRPTQQVRNHP-YNELIEKLVSMGYRGDHVVNVIQRLEESGQPVDFNAILDSMNGHS  529

Query  354  SGGSQKGW  331
            SGGSQ+GW
Sbjct  530  SGGSQRGW  537



>ref|XP_009628959.1| PREDICTED: extensin-like [Nicotiana tomentosiformis]
Length=534

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = -1

Query  534  NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHS  355
            N+MVRPPQ +R  P YNEL+EK+ SMGYR DH++NVIQR+EESGQ VDFNAVLDRLNGHS
Sbjct  468  NIMVRPPQLVRTHP-YNELIEKMVSMGYRGDHVVNVIQRLEESGQTVDFNAVLDRLNGHS  526

Query  354  SGGSQKGW  331
            SG SQ+GW
Sbjct  527  SGASQRGW  534



>ref|XP_006367642.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
[Solanum tuberosum]
Length=548

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = -1

Query  534  NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHS  355
            N MVRPPQ MR  P YNEL+EKLASMGYR DH++NVIQR+EESGQ VDFN VLDRLNGHS
Sbjct  480  NHMVRPPQLMRTHP-YNELIEKLASMGYRGDHVVNVIQRLEESGQTVDFNTVLDRLNGHS  538

Query  354  SGGSQKGW  331
            SGG Q+GW
Sbjct  539  SGGPQRGW  546



>ref|XP_009782624.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana sylvestris]
Length=539

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = -1

Query  534  NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHS  355
            N+MVRPPQ +R  P YNEL+EK+ SMGYR DH++NVIQR+EESGQ VDFNAVLDRLNGHS
Sbjct  473  NIMVRPPQLVRTHP-YNELIEKMVSMGYRGDHVVNVIQRLEESGQTVDFNAVLDRLNGHS  531

Query  354  SGGSQKGW  331
            SG SQ+GW
Sbjct  532  SGASQRGW  539



>ref|XP_004248167.1| PREDICTED: bromodomain-containing protein 4 [Solanum lycopersicum]
Length=545

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 1/68 (1%)
 Frame = -1

Query  534  NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHS  355
            N M RPPQ MR  P YNEL+EKLASMGYR DH++NVIQR+EESGQ VDFN VLDRLNGHS
Sbjct  477  NHMFRPPQLMRTHP-YNELIEKLASMGYRGDHVVNVIQRLEESGQTVDFNTVLDRLNGHS  535

Query  354  SGGSQKGW  331
            SGG Q+GW
Sbjct  536  SGGPQRGW  543



>ref|XP_010110218.1| hypothetical protein L484_009824 [Morus notabilis]
 gb|EXC25515.1| hypothetical protein L484_009824 [Morus notabilis]
Length=527

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 1/68 (1%)
 Frame = -1

Query  534  NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHS  355
            NVMVR PQ MRN P Y EL+EKLASMG+R DHI++VIQRMEESGQP+DFN VLDRLN HS
Sbjct  459  NVMVRNPQFMRNHP-YAELIEKLASMGFRGDHIVSVIQRMEESGQPIDFNGVLDRLNVHS  517

Query  354  SGGSQKGW  331
            SG  Q+GW
Sbjct  518  SGAPQRGW  525



>emb|CDP14783.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = -1

Query  534  NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHS  355
            N++VRPPQ +RN P Y +L+EK+ SMGYR DH+++ IQR+EESGQPVDFNAVLDRLNGHS
Sbjct  471  NLVVRPPQFVRNHP-YGDLIEKVVSMGYRGDHVVSAIQRLEESGQPVDFNAVLDRLNGHS  529

Query  354  SGGSQKGW  331
            +GG Q+GW
Sbjct  530  AGGPQRGW  537



>ref|XP_007198900.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
 gb|EMJ00099.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
Length=529

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 3/76 (4%)
 Frame = -1

Query  552  PQPANX-NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            PQP    N+M R PQ +RN P Y+EL+EKLASMG+R DH+++VIQRMEE G+P+DFNAV+
Sbjct  453  PQPTTAPNLMARNPQFIRNHP-YSELIEKLASMGFRSDHVLSVIQRMEERGEPIDFNAVI  511

Query  375  DRL-NGHSSGGSQKGW  331
            DRL N HSSGG Q+GW
Sbjct  512  DRLSNVHSSGGPQRGW  527



>ref|XP_008229158.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X2 [Prunus mume]
Length=529

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 3/76 (4%)
 Frame = -1

Query  552  PQPANX-NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            PQP    N+M R PQ +RN P Y+EL+EKLASMG+R DH+++VIQRMEE G+P+DFNAV+
Sbjct  453  PQPTTAPNLMARNPQFIRNHP-YSELIEKLASMGFRSDHVLSVIQRMEERGEPIDFNAVI  511

Query  375  DRL-NGHSSGGSQKGW  331
            DRL N HSSGG Q+GW
Sbjct  512  DRLSNVHSSGGPQRGW  527



>ref|XP_008229157.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X1 [Prunus mume]
Length=530

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 3/76 (4%)
 Frame = -1

Query  552  PQPANX-NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            PQP    N+M R PQ +RN P Y+EL+EKLASMG+R DH+++VIQRMEE G+P+DFNAV+
Sbjct  454  PQPTTAPNLMARNPQFIRNHP-YSELIEKLASMGFRSDHVLSVIQRMEERGEPIDFNAVI  512

Query  375  DRL-NGHSSGGSQKGW  331
            DRL N HSSGG Q+GW
Sbjct  513  DRLSNVHSSGGPQRGW  528



>ref|XP_008337475.1| PREDICTED: altered inheritance of mitochondria protein 3-like 
[Malus domestica]
Length=521

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = -1

Query  552  PQPANX-NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            PQP    NVM R PQ   N P YNEL+EKL  MG+R DH+++VIQRMEE GQPVDFNAV+
Sbjct  446  PQPTTAPNVMARNPQFPGNHP-YNELIEKLVPMGFRSDHVVSVIQRMEEXGQPVDFNAVI  504

Query  375  DRLNGHSSGGSQKGW  331
            DRLN H SGG Q+GW
Sbjct  505  DRLNAHPSGGPQRGW  519



>ref|XP_010689008.1| PREDICTED: RNA polymerase II degradation factor 1 [Beta vulgaris 
subsp. vulgaris]
Length=542

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 60/77 (78%), Gaps = 4/77 (5%)
 Frame = -1

Query  552  PQPANXNVMVR---PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNA  382
            P P + + MVR   P Q +RN P YNEL++KL SMGYR DH+++VIQR+EESG  VDFNA
Sbjct  467  PAPGSSSHMVRNPGPQQYVRNHP-YNELIDKLVSMGYRSDHVVSVIQRLEESGLAVDFNA  525

Query  381  VLDRLNGHSSGGSQKGW  331
            VLDRLNGHSSG SQ+ W
Sbjct  526  VLDRLNGHSSGSSQRSW  542



>gb|KJB31694.1| hypothetical protein B456_005G201600 [Gossypium raimondii]
Length=546

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 60/75 (80%), Gaps = 5/75 (7%)
 Frame = -1

Query  543  ANXNVMVR---PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLD  373
            A  NVMVR    PQ +RN P Y+EL+EKL SMG+R DH+ +VIQRMEESGQP DFNAVLD
Sbjct  473  AGPNVMVRNTNHPQFVRNHP-YSELIEKLVSMGFRGDHVASVIQRMEESGQPPDFNAVLD  531

Query  372  RLNGHSSGGSQK-GW  331
            RLN HSSGGSQ+ GW
Sbjct  532  RLNAHSSGGSQRGGW  546



>ref|XP_009357856.1| PREDICTED: putative uncharacterized protein DDB_G0294196 [Pyrus 
x bretschneideri]
 ref|XP_009357877.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
[Pyrus x bretschneideri]
Length=521

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = -1

Query  552  PQPANX-NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            PQP    N+M R PQ   N P YNEL+EKL  MG+R DH+++VIQRMEESGQPVDFNAV+
Sbjct  446  PQPTTAPNLMARNPQFPHNHP-YNELIEKLVPMGFRSDHVVSVIQRMEESGQPVDFNAVI  504

Query  375  DRLNGHSSGGSQKGW  331
            DRLN H SG  Q+GW
Sbjct  505  DRLNAHPSGVPQRGW  519



>ref|XP_007043595.1| Structural constituent of cell wall [Theobroma cacao]
 gb|EOX99426.1| Structural constituent of cell wall [Theobroma cacao]
Length=552

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%), Gaps = 5/72 (7%)
 Frame = -1

Query  534  NVMVR---PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLN  364
            NVM+R     Q +R+ P Y++L+EKL SMG+RVDH+ +VIQRMEESGQPVDFNAVLDRLN
Sbjct  482  NVMIRNTSHSQFIRSHP-YSDLIEKLVSMGFRVDHVASVIQRMEESGQPVDFNAVLDRLN  540

Query  363  GHSSGGSQK-GW  331
             HSSGGSQ+ GW
Sbjct  541  VHSSGGSQRGGW  552



>ref|XP_008342911.1| PREDICTED: extensin-like isoform X2 [Malus domestica]
Length=521

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = -1

Query  552  PQPANX-NVMVRPPQGMRNPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNA  382
            PQP    N+M R     + PP  PYNEL+EKL  MG+R DH+ +VIQRMEESGQP+DFNA
Sbjct  446  PQPTTAPNLMAR---NQQFPPNHPYNELIEKLVPMGFRXDHVASVIQRMEESGQPIDFNA  502

Query  381  VLDRLNGHSSGGSQKGW  331
            V+DRLN H SGG Q+GW
Sbjct  503  VIDRLNSHPSGGPQRGW  519



>ref|XP_008342910.1| PREDICTED: extensin-like isoform X1 [Malus domestica]
Length=522

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 6/77 (8%)
 Frame = -1

Query  552  PQPANX-NVMVRPPQGMRNPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNA  382
            PQP    N+M R     + PP  PYNEL+EKL  MG+R DH+ +VIQRMEESGQP+DFNA
Sbjct  447  PQPTTAPNLMAR---NQQFPPNHPYNELIEKLVPMGFRXDHVASVIQRMEESGQPIDFNA  503

Query  381  VLDRLNGHSSGGSQKGW  331
            V+DRLN H SGG Q+GW
Sbjct  504  VIDRLNSHPSGGPQRGW  520



>ref|XP_002272844.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Vitis 
vinifera]
Length=550

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 10/80 (13%)
 Frame = -1

Query  552  PQPA-NXNVMVR-----PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVD  391
            PQP    N+MVR     PP+      PYNE +EKL +MGYR DH++NVIQRMEESGQP+D
Sbjct  473  PQPTVGSNLMVRNSGQPPPRNH----PYNEWIEKLMNMGYRGDHVVNVIQRMEESGQPID  528

Query  390  FNAVLDRLNGHSSGGSQKGW  331
            FN++LDRLN + SGGSQ+GW
Sbjct  529  FNSLLDRLNANPSGGSQRGW  548



>gb|EYU28592.1| hypothetical protein MIMGU_mgv1a004659mg [Erythranthe guttata]
Length=516

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 2/67 (3%)
 Frame = -1

Query  528  MVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSG  349
            MV P   MR+ P YNEL++KL +MGYR DH++ +IQRMEESGQ +DFN+VLDRLNGHSSG
Sbjct  449  MVVPQSSMRSHP-YNELIDKLVAMGYRTDHVVGIIQRMEESGQTIDFNSVLDRLNGHSSG  507

Query  348  GSQK-GW  331
             SQ+ GW
Sbjct  508  TSQRGGW  514



>ref|XP_004303103.1| PREDICTED: transcriptional regulator DEF1 [Fragaria vesca subsp. 
vesca]
Length=540

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 3/76 (4%)
 Frame = -1

Query  552  PQPANX-NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            PQP    + MVR PQ +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ +DFNAV+
Sbjct  464  PQPTTAPSHMVRNPQFIRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQTIDFNAVI  522

Query  375  DRLNGHSSGG-SQKGW  331
            DRLN HSSG   Q+GW
Sbjct  523  DRLNVHSSGAPPQRGW  538



>ref|XP_009341976.1| PREDICTED: ATP-dependent helicase brm-like isoform X1 [Pyrus 
x bretschneideri]
Length=522

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 56/77 (73%), Gaps = 6/77 (8%)
 Frame = -1

Query  552  PQPANX-NVMVRPPQGMRNPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNA  382
            PQP    N+M R     + PP  PYNEL+EKL  MG+R DHI +VIQRMEESGQP+DFNA
Sbjct  447  PQPTTAPNLMAR---NQQFPPNHPYNELIEKLVPMGFRSDHIASVIQRMEESGQPIDFNA  503

Query  381  VLDRLNGHSSGGSQKGW  331
            V+DRLN H SG  Q+GW
Sbjct  504  VIDRLNAHPSGVPQRGW  520



>ref|XP_009341977.1| PREDICTED: ATP-dependent helicase brm-like isoform X2 [Pyrus 
x bretschneideri]
Length=521

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 56/77 (73%), Gaps = 6/77 (8%)
 Frame = -1

Query  552  PQPANX-NVMVRPPQGMRNPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNA  382
            PQP    N+M R     + PP  PYNEL+EKL  MG+R DHI +VIQRMEESGQP+DFNA
Sbjct  446  PQPTTAPNLMAR---NQQFPPNHPYNELIEKLVPMGFRSDHIASVIQRMEESGQPIDFNA  502

Query  381  VLDRLNGHSSGGSQKGW  331
            V+DRLN H SG  Q+GW
Sbjct  503  VIDRLNAHPSGVPQRGW  519



>gb|KDP24130.1| hypothetical protein JCGZ_25787 [Jatropha curcas]
Length=532

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 5/74 (7%)
 Frame = -1

Query  543  ANXNVMVRPPQG---MRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLD  373
            A  NV+ R P     +RN P YNEL+EKL +MG+R+DH+I VIQRMEESGQPVDFNAVLD
Sbjct  459  AGANVLARNPNHSHLVRNHP-YNELIEKLVNMGFRMDHVIGVIQRMEESGQPVDFNAVLD  517

Query  372  RLNGHSSGGSQKGW  331
            RLN H +G SQ+GW
Sbjct  518  RLNVH-NGSSQRGW  530



>ref|XP_009336198.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Pyrus x bretschneideri]
Length=522

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 6/77 (8%)
 Frame = -1

Query  552  PQPANX-NVMVRPPQGMRNPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNA  382
            PQP    N+M R     + PP  PYNEL+EKL  MG+R DH+ +VIQRMEESGQP+DFNA
Sbjct  447  PQPTTAPNLMAR---NQQFPPNHPYNELIEKLVPMGFRSDHVASVIQRMEESGQPIDFNA  503

Query  381  VLDRLNGHSSGGSQKGW  331
            V+DRLN H SG  Q+GW
Sbjct  504  VIDRLNAHPSGVPQRGW  520



>ref|XP_009336199.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Pyrus x bretschneideri]
Length=521

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 6/77 (8%)
 Frame = -1

Query  552  PQPANX-NVMVRPPQGMRNPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNA  382
            PQP    N+M R     + PP  PYNEL+EKL  MG+R DH+ +VIQRMEESGQP+DFNA
Sbjct  446  PQPTTAPNLMAR---NQQFPPNHPYNELIEKLVPMGFRSDHVASVIQRMEESGQPIDFNA  502

Query  381  VLDRLNGHSSGGSQKGW  331
            V+DRLN H SG  Q+GW
Sbjct  503  VIDRLNAHPSGVPQRGW  519



>ref|XP_011098021.1| PREDICTED: extensin [Sesamum indicum]
Length=525

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PYNEL+EKL  MGYR DH++ VIQR+EESGQ +DFN+VLDRLNGH SGGSQ+ W
Sbjct  470  PYNELIEKLVGMGYRGDHVVGVIQRLEESGQTIDFNSVLDRLNGHPSGGSQRVW  523



>ref|XP_004506616.1| PREDICTED: transcription factor SPT20 homolog [Cicer arietinum]
Length=523

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 4/73 (5%)
 Frame = -1

Query  540  NXNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDR  370
            N N+MVR P   Q +RN P YNEL+EKL +MG+R DH+ +VIQRMEESGQ +DFN+VLDR
Sbjct  452  NPNLMVRNPSQSQFVRNHP-YNELIEKLVNMGFRGDHVASVIQRMEESGQTIDFNSVLDR  510

Query  369  LNGHSSGGSQKGW  331
            LN H+S G Q+GW
Sbjct  511  LNVHNSVGPQRGW  523



>gb|KEH17617.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=527

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 58/74 (78%), Gaps = 4/74 (5%)
 Frame = -1

Query  543  ANXNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLD  373
             N N++VR P   Q +RN P YNEL+EKL +MG+R DH+ +VIQRMEESGQ +DFN+VLD
Sbjct  453  TNPNLLVRNPSQSQFVRNHP-YNELIEKLVNMGFRGDHVASVIQRMEESGQTIDFNSVLD  511

Query  372  RLNGHSSGGSQKGW  331
            RLN HSS G Q+GW
Sbjct  512  RLNVHSSVGPQRGW  525



>ref|XP_007132659.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
 gb|ESW04653.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
Length=541

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -1

Query  546  PANXNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            P + N+MVR P   Q +RN P Y+EL+EKL SMG+R DH+++VIQRMEESGQ +DFN+VL
Sbjct  466  PPSHNLMVRNPNQSQFVRNHP-YSELIEKLVSMGFRGDHVMSVIQRMEESGQAIDFNSVL  524

Query  375  DRLNGHSSGGSQKGW  331
            DRLN HSS G  +GW
Sbjct  525  DRLNVHSSVGPPRGW  539



>gb|KDO51850.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=550

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 2/63 (3%)
 Frame = -1

Query  516  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  337
            PQ +RN   Y+EL+E L SMGYR DH  +VIQRMEESGQPVDFNAVLDRLN HSSGGSQ+
Sbjct  487  PQFIRNHT-YSELIENLVSMGYRGDHAASVIQRMEESGQPVDFNAVLDRLNVHSSGGSQR  545

Query  336  -GW  331
             GW
Sbjct  546  GGW  548



>gb|KDO51849.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=549

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 2/63 (3%)
 Frame = -1

Query  516  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  337
            PQ +RN   Y+EL+E L SMGYR DH  +VIQRMEESGQPVDFNAVLDRLN HSSGGSQ+
Sbjct  486  PQFIRNHT-YSELIENLVSMGYRGDHAASVIQRMEESGQPVDFNAVLDRLNVHSSGGSQR  544

Query  336  -GW  331
             GW
Sbjct  545  GGW  547



>ref|XP_006447363.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60603.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=554

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 2/63 (3%)
 Frame = -1

Query  516  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  337
            PQ +RN   Y+EL+E L SMGYR DH  +VIQRMEESGQPVDFNAVLDRLN HSSGGSQ+
Sbjct  491  PQFIRNHT-YSELIENLVSMGYRGDHAASVIQRMEESGQPVDFNAVLDRLNVHSSGGSQR  549

Query  336  -GW  331
             GW
Sbjct  550  GGW  552



>ref|XP_006447362.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60602.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=553

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 2/63 (3%)
 Frame = -1

Query  516  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  337
            PQ +RN   Y+EL+E L SMGYR DH  +VIQRMEESGQPVDFNAVLDRLN HSSGGSQ+
Sbjct  490  PQFIRNHT-YSELIENLVSMGYRGDHAASVIQRMEESGQPVDFNAVLDRLNVHSSGGSQR  548

Query  336  -GW  331
             GW
Sbjct  549  GGW  551



>gb|KHN31988.1| hypothetical protein glysoja_025822 [Glycine soja]
Length=505

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 5/76 (7%)
 Frame = -1

Query  546  PANXNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            P   N+MVR P   Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ +DFN+VL
Sbjct  429  PPGLNLMVRNPNQSQFIRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAIDFNSVL  487

Query  375  DRLNGHSSGGSQK-GW  331
            DRLN HSS G Q+ GW
Sbjct  488  DRLNVHSSVGPQRGGW  503



>ref|XP_010035753.1| PREDICTED: RNA polymerase II degradation factor 1-like [Eucalyptus 
grandis]
 gb|KCW47211.1| hypothetical protein EUGRSUZ_K01026 [Eucalyptus grandis]
Length=535

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY EL+EKL +MG+R DH+ +VIQR+EESGQPVDFNAVLDRLN H SG SQ+GW
Sbjct  480  PYGELIEKLVNMGFRGDHVASVIQRLEESGQPVDFNAVLDRLNVHPSGNSQRGW  533



>ref|XP_006592435.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoform X2 [Glycine max]
Length=534

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 5/76 (7%)
 Frame = -1

Query  546  PANXNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            P   N+MVR P   Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ +DFN+VL
Sbjct  458  PPGLNLMVRNPNQSQFIRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAIDFNSVL  516

Query  375  DRLNGHSSGGSQK-GW  331
            DRLN HSS G Q+ GW
Sbjct  517  DRLNVHSSVGPQRGGW  532



>ref|XP_003539922.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoformX1 [Glycine max]
Length=533

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 5/76 (7%)
 Frame = -1

Query  546  PANXNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            P   N+MVR P   Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ +DFN+VL
Sbjct  457  PPGLNLMVRNPNQSQFIRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAIDFNSVL  515

Query  375  DRLNGHSSGGSQK-GW  331
            DRLN HSS G Q+ GW
Sbjct  516  DRLNVHSSVGPQRGGW  531



>ref|XP_002325597.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE99978.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=537

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 57/79 (72%), Gaps = 6/79 (8%)
 Frame = -1

Query  552  PQPANXNVMV----RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFN  385
            PQPA    M+     P    RN P Y++L+EKL SMG+R DH  +VIQRMEESG+PVDFN
Sbjct  458  PQPAAGTGMLPRHSSPSHFFRNHP-YSDLIEKLVSMGFRGDHAASVIQRMEESGEPVDFN  516

Query  384  AVLDRLNGHSSGGSQK-GW  331
            AVLDRLN  SSGGSQ+ GW
Sbjct  517  AVLDRLNVQSSGGSQRGGW  535



>ref|XP_002517918.1| structural constituent of cell wall, putative [Ricinus communis]
 gb|EEF44436.1| structural constituent of cell wall, putative [Ricinus communis]
Length=536

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 5/71 (7%)
 Frame = -1

Query  534  NVMVRPPQG---MRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLN  364
            N+M R P     +RN P Y+EL++KL SMG+R +HI+ VIQRMEESGQP+DFNAVLDRL+
Sbjct  466  NMMARNPSHANFVRNHP-YSELIDKLVSMGFRAEHIVGVIQRMEESGQPLDFNAVLDRLS  524

Query  363  GHSSGGSQKGW  331
             +SSGGSQ+GW
Sbjct  525  -NSSGGSQRGW  534



>ref|XP_011002849.1| PREDICTED: calcium-binding protein P-like [Populus euphratica]
Length=549

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 57/79 (72%), Gaps = 6/79 (8%)
 Frame = -1

Query  552  PQPANXNVMV----RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFN  385
            PQPA    M+     P    RN P Y++L+EKL SMG+R DH  +VIQRMEESG+PVDFN
Sbjct  470  PQPAAGTSMLPRHSSPSHFFRNHP-YSDLIEKLVSMGFRGDHAASVIQRMEESGEPVDFN  528

Query  384  AVLDRLNGHSSGGSQK-GW  331
            AVLDRLN  SSGGSQ+ GW
Sbjct  529  AVLDRLNVLSSGGSQRGGW  547



>gb|KHG27956.1| S-adenosylmethionine synthase 1 [Gossypium arboreum]
Length=552

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 61/79 (77%), Gaps = 6/79 (8%)
 Frame = -1

Query  552  PQPA-NXNVMVR---PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFN  385
            PQP  + NVM+R     Q +RN P Y++L+EKL SMG+R DHI +VIQRMEESGQ VDFN
Sbjct  475  PQPGPSPNVMMRNSSHSQYVRNHP-YSDLIEKLVSMGFRGDHIASVIQRMEESGQAVDFN  533

Query  384  AVLDRLNGHSSGGSQK-GW  331
            AVLDRLN  SSGG+Q+ GW
Sbjct  534  AVLDRLNVQSSGGTQRGGW  552



>gb|KCW89535.1| hypothetical protein EUGRSUZ_A01820 [Eucalyptus grandis]
Length=471

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 8/71 (11%)
 Frame = -1

Query  519  PPQGMRNP--PPY------NELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLN  364
            PP  +RNP  P +      NELV++L SMG+RVDH+++VIQRMEESGQPVDFN+VLDRL+
Sbjct  399  PPIQVRNPAYPQFIRKHADNELVDRLVSMGFRVDHVLSVIQRMEESGQPVDFNSVLDRLS  458

Query  363  GHSSGGSQKGW  331
            G SSG  Q+ W
Sbjct  459  GPSSGNPQRAW  469



>gb|KEH39132.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=480

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = -1

Query  546  PANXNVMVRPP--QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLD  373
            PA  NV +R P  Q +    PYNEL+E L SMG R D ++++IQRMEE+GQPV+FN+VLD
Sbjct  405  PAPHNVTIRNPSQQKLMRSHPYNELIENLVSMGVRGDLVVSIIQRMEETGQPVNFNSVLD  464

Query  372  RLNGHSSGGSQKGW  331
            RLN HSS G Q+ W
Sbjct  465  RLNAHSSLGPQREW  478



>ref|XP_010051997.1| PREDICTED: LOW QUALITY PROTEIN: bromodomain-containing protein 
4 [Eucalyptus grandis]
Length=513

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 8/71 (11%)
 Frame = -1

Query  519  PPQGMRNP--PPY------NELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLN  364
            PP  +RNP  P +      NELV++L SMG+RVDH+++VIQRMEESGQPVDFN+VLDRL+
Sbjct  441  PPIQVRNPAYPQFIRKHADNELVDRLVSMGFRVDHVLSVIQRMEESGQPVDFNSVLDRLS  500

Query  363  GHSSGGSQKGW  331
            G SSG  Q+ W
Sbjct  501  GPSSGNPQRAW  511



>gb|KJB77269.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=342

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-GW  331
            PY+ L+EK  SMG+R DHI +VIQRMEESGQ VDFNAVLDRLN  SSGG+Q+ GW
Sbjct  288  PYSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFNAVLDRLNVQSSGGTQRGGW  342



>gb|KEH39131.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=500

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = -1

Query  546  PANXNVMVRPP--QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLD  373
            PA  NV +R P  Q +    PYNEL+E L SMG R D ++++IQRMEE+GQPV+FN+VLD
Sbjct  425  PAPHNVTIRNPSQQKLMRSHPYNELIENLVSMGVRGDLVVSIIQRMEETGQPVNFNSVLD  484

Query  372  RLNGHSSGGSQKGW  331
            RLN HSS G Q+ W
Sbjct  485  RLNAHSSLGPQREW  498



>gb|KJB77268.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77270.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77272.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=551

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 59/79 (75%), Gaps = 6/79 (8%)
 Frame = -1

Query  552  PQPA-NXNVMVR---PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFN  385
            PQP  + NVM+R     Q +RN P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFN
Sbjct  474  PQPGPSPNVMMRNSSHSQYVRNHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFN  532

Query  384  AVLDRLNGHSSGGSQK-GW  331
            AVLDRLN  SSGG+Q+ GW
Sbjct  533  AVLDRLNVQSSGGTQRGGW  551



>gb|KJB77274.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=461

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 59/79 (75%), Gaps = 6/79 (8%)
 Frame = -1

Query  552  PQPA-NXNVMVR---PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFN  385
            PQP  + NVM+R     Q +RN P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFN
Sbjct  384  PQPGPSPNVMMRNSSHSQYVRNHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFN  442

Query  384  AVLDRLNGHSSGGSQK-GW  331
            AVLDRLN  SSGG+Q+ GW
Sbjct  443  AVLDRLNVQSSGGTQRGGW  461



>gb|KJB77267.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=419

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 59/79 (75%), Gaps = 6/79 (8%)
 Frame = -1

Query  552  PQPA-NXNVMVR---PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFN  385
            PQP  + NVM+R     Q +RN P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFN
Sbjct  342  PQPGPSPNVMMRNSSHSQYVRNHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFN  400

Query  384  AVLDRLNGHSSGGSQK-GW  331
            AVLDRLN  SSGG+Q+ GW
Sbjct  401  AVLDRLNVQSSGGTQRGGW  419



>gb|KJB77271.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77273.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=566

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 59/79 (75%), Gaps = 6/79 (8%)
 Frame = -1

Query  552  PQPA-NXNVMVR---PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFN  385
            PQP  + NVM+R     Q +RN P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFN
Sbjct  489  PQPGPSPNVMMRNSSHSQYVRNHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFN  547

Query  384  AVLDRLNGHSSGGSQK-GW  331
            AVLDRLN  SSGG+Q+ GW
Sbjct  548  AVLDRLNVQSSGGTQRGGW  566



>ref|XP_002869511.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45770.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+G SSGG  +GW
Sbjct  442  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGW  494



>ref|NP_974630.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE85467.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=438

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFN +LDRL+G SSGG  +GW
Sbjct  386  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNTLLDRLSGQSSGGPPRGW  438



>ref|NP_194559.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL36251.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AAM20028.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AEE85466.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=496

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFN +LDRL+G SSGG  +GW
Sbjct  444  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNTLLDRLSGQSSGGPPRGW  496



>emb|CAB79632.1| predicted proline-rich protein [Arabidopsis thaliana]
Length=508

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFN +LDRL+G SSGG  +GW
Sbjct  456  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNTLLDRLSGQSSGGPPRGW  508



>ref|XP_006376495.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|ERP54292.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=532

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 48/54 (89%), Gaps = 1/54 (2%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-GW  331
            YN+L+EKL +MG+R DH+++VIQRMEE G+PVDFN+VLDRL  HSSGGSQ+ GW
Sbjct  477  YNDLIEKLVNMGFRGDHVVSVIQRMEEGGEPVDFNSVLDRLKVHSSGGSQRGGW  530



>ref|XP_009144355.1| PREDICTED: protein transport protein SEC31-like [Brassica rapa]
Length=476

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  424  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSAQSSGGPPRGW  476



>ref|XP_006283593.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
 gb|EOA16491.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
Length=497

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-GW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+G SSGG  + GW
Sbjct  444  YGELIEKLVSMGFRADHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  497



>ref|XP_009137778.1| PREDICTED: basic salivary proline-rich protein 1-like [Brassica 
rapa]
 emb|CDY29896.1| BnaA03g49170D [Brassica napus]
Length=487

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH+++VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  435  YGELIEKLVSMGFRGDHVMSVIQRMEESGQPIDFNALLDRLSVQSSGGPPRGW  487



>emb|CDY67879.1| BnaC07g50480D [Brassica napus]
Length=478

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  426  YGELIEKLVSMGFRGDHVMGVIQRMEESGQPIDFNALLDRLSVQSSGGPPRGW  478



>gb|KFK35898.1| hypothetical protein AALP_AA4G050800 [Arabis alpina]
Length=484

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  432  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSVQSSGGPPRGW  484



>emb|CDX89188.1| BnaA01g17050D [Brassica napus]
Length=470

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -1

Query  501  NPPP-----YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  337
             PPP     Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+  SSGG  +
Sbjct  409  TPPPVSRSKYGELIEKLVSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSAQSSGGPPR  468

Query  336  GW  331
            GW
Sbjct  469  GW  470



>ref|XP_010438481.1| PREDICTED: formin-like protein 5 [Camelina sativa]
Length=497

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-GW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+G SSGG  + GW
Sbjct  444  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  497



>ref|XP_010433239.1| PREDICTED: bromodomain-containing protein 4-like [Camelina sativa]
Length=494

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-GW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+G SSGG  + GW
Sbjct  441  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  494



>ref|XP_010448000.1| PREDICTED: vacuolar protein-sorting protein BRO1-like [Camelina 
sativa]
Length=495

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK-GW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+G SSGG  + GW
Sbjct  442  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  495



>emb|CDY18985.1| BnaC01g20830D [Brassica napus]
Length=479

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 5/62 (8%)
 Frame = -1

Query  501  NPPP-----YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  337
             PPP     Y EL+EKL SMG+R DH+I VIQRMEESGQP++FNA+LD+L+  SSGG  +
Sbjct  418  TPPPVLRTKYGELIEKLMSMGFRGDHVIAVIQRMEESGQPIEFNALLDKLSVQSSGGPPR  477

Query  336  GW  331
            GW
Sbjct  478  GW  479



>ref|XP_006412973.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
 gb|ESQ54426.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
Length=499

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  447  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSVPSSGGPPRGW  499



>emb|CDX97433.1| BnaC08g12980D [Brassica napus]
Length=492

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+  SSGG  +GW
Sbjct  440  YGELIEKLVSMGFRGDHVMTVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  492



>ref|XP_006582794.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Glycine max]
Length=486

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 55/75 (73%), Gaps = 6/75 (8%)
 Frame = -1

Query  546  PANXNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            P   N+MVR P   Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ VDFN+VL
Sbjct  413  PQGHNLMVRNPNQSQFVRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAVDFNSVL  471

Query  375  DRLNGHSSGGSQKGW  331
            DRL+  S G  + GW
Sbjct  472  DRLS--SVGPQRGGW  484



>emb|CDY25250.1| BnaA02g22060D [Brassica napus]
Length=492

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+  SSGG  +GW
Sbjct  440  YGELIEKLVSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  492



>gb|KHN35253.1| hypothetical protein glysoja_042323 [Glycine soja]
Length=531

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 55/75 (73%), Gaps = 6/75 (8%)
 Frame = -1

Query  546  PANXNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            P   N+MVR P   Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ VDFN+VL
Sbjct  458  PQGHNLMVRNPNQSQFVRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAVDFNSVL  516

Query  375  DRLNGHSSGGSQKGW  331
            DRL+  S G  + GW
Sbjct  517  DRLS--SVGPQRGGW  529



>ref|XP_010924426.1| PREDICTED: putative cyclin-dependent serine/threonine-protein 
kinase DDB_G0272797/DDB_G0274007 isoform X2 [Elaeis guineensis]
Length=425

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY E++EK  SMGY  DH  +VIQRMEESGQP+DFN++LDRLNG + G S + W
Sbjct  370  PYGEMIEKAVSMGYARDHAASVIQRMEESGQPIDFNSLLDRLNGQAGGASSRPW  423



>emb|CDY14248.1| BnaA08g13790D [Brassica napus]
Length=491

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+  SSGG  +GW
Sbjct  439  YGELIEKLVSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  491



>ref|XP_009109102.1| PREDICTED: formin-like protein 3 [Brassica rapa]
Length=500

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+  SSGG  +GW
Sbjct  448  YGELIEKLMSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  500



>ref|XP_010924425.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X1 [Elaeis guineensis]
Length=517

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY E++EK  SMGY  DH  +VIQRMEESGQP+DFN++LDRLNG + G S + W
Sbjct  462  PYGEMIEKAVSMGYARDHAASVIQRMEESGQPIDFNSLLDRLNGQAGGASSRPW  515



>ref|XP_010540875.1| PREDICTED: extensin [Tarenaya hassleriana]
Length=492

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = -1

Query  513  QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKG  334
            Q +R    Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNAVLDRL+  S    Q+G
Sbjct  435  QFLRASSAYGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNAVLDRLSVQS---PQRG  491

Query  333  W  331
            W
Sbjct  492  W  492



>gb|EPS62243.1| hypothetical protein M569_12549, partial [Genlisea aurea]
Length=512

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLN-GHSSGGSQKGW  331
            PYNEL+EKL  MGYR +H++ VIQR+EESGQ VDFN+VLDRLN G   GGSQ+GW
Sbjct  457  PYNELIEKLIGMGYRGEHVVGVIQRLEESGQAVDFNSVLDRLNGGGGGGGSQRGW  511



>ref|XP_010242911.1| PREDICTED: RNA polymerase II degradation factor 1 [Nelumbo nucifera]
Length=560

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = -1

Query  540  NXNVMVRP--PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL  367
            + N+M RP  P  M     Y EL+EK  SMGY  +H+ +VI R+EESGQPVDFN+VLDRL
Sbjct  487  SSNIMPRPRSPSHMMRNHVYAELIEKAVSMGYVREHVASVIHRLEESGQPVDFNSVLDRL  546

Query  366  NGHSSGGSQKGW  331
            N   S G Q+GW
Sbjct  547  NVQPSVGYQRGW  558



>ref|XP_008455322.1| PREDICTED: transcription factor SPT20 homolog [Cucumis melo]
Length=514

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 6/69 (9%)
 Frame = -1

Query  519  PPQGMRNP------PPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  358
            PPQ    P      P ++ L+EKL  MG+R DH+ ++IQRME+SGQPVDFNAVLDRL+  
Sbjct  446  PPQAPAGPHVSARNPSHSHLIEKLVGMGFRGDHVASIIQRMEDSGQPVDFNAVLDRLSSP  505

Query  357  SSGGSQKGW  331
            S  G Q+ W
Sbjct  506  SGPGPQRAW  514



>ref|XP_004136824.1| PREDICTED: uncharacterized protein LOC101206745 [Cucumis sativus]
 ref|XP_004155474.1| PREDICTED: uncharacterized protein LOC101231079 [Cucumis sativus]
 gb|KGN43616.1| hypothetical protein Csa_7G048000 [Cucumis sativus]
Length=515

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 6/69 (9%)
 Frame = -1

Query  519  PPQGMRNP------PPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  358
            PPQ    P      P ++ L+EKL  MG+R DH+ ++IQRME+SGQPVDFNAVLDRL+  
Sbjct  447  PPQAPAGPHVSARNPSHSHLIEKLVGMGFRGDHVASIIQRMEDSGQPVDFNAVLDRLSSP  506

Query  357  SSGGSQKGW  331
            S  G Q+ W
Sbjct  507  SGPGPQRAW  515



>ref|XP_008810226.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
 ref|XP_008810227.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
Length=493

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  516  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  337
            PQ MR+ P Y E++EK  SMGY  DH+ +VIQR+ ESGQP+DFN++LD LNG  +GGS +
Sbjct  431  PQLMRSHP-YGEMIEKAVSMGYARDHVASVIQRVGESGQPMDFNSLLDMLNGRVTGGSTR  489

Query  336  GW  331
             W
Sbjct  490  VW  491



>ref|XP_003540363.1| PREDICTED: integrator complex subunit 3 homolog isoform 1 [Glycine 
max]
 gb|KHN27890.1| hypothetical protein glysoja_007622 [Glycine soja]
Length=532

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 7/75 (9%)
 Frame = -1

Query  546  PANXNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
            PA+ N+MV  P   Q +R+ P YN+L+EK  SMG+R +H+ ++IQRMEE+ QP+DFN+V 
Sbjct  460  PASHNLMVPSPSQSQFIRSHP-YNDLIEKFVSMGFRGNHVASIIQRMEETQQPIDFNSVH  518

Query  375  DRLNGHSSGGSQKGW  331
            DRLN H     Q+GW
Sbjct  519  DRLNVH---NPQRGW  530



>ref|XP_008810225.1| PREDICTED: ataxin-2 homolog isoform X1 [Phoenix dactylifera]
Length=516

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  516  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  337
            PQ MR+ P Y E++EK  SMGY  DH+ +VIQR+ ESGQP+DFN++LD LNG  +GGS +
Sbjct  454  PQLMRSHP-YGEMIEKAVSMGYARDHVASVIQRVGESGQPMDFNSLLDMLNGRVTGGSTR  512

Query  336  GW  331
             W
Sbjct  513  VW  514



>ref|XP_008455323.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like [Cucumis melo]
Length=542

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 5/65 (8%)
 Frame = -1

Query  516  PQGMRNP---PPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
            P  MRN     PY E+VEKL  MG+R DH+ +VI RMEESGQPVDFNAVLD L+  +SGG
Sbjct  480  PHYMRNQNQNHPYGEIVEKLVGMGFRSDHVASVIHRMEESGQPVDFNAVLDGLS--NSGG  537

Query  345  SQKGW  331
             Q+ W
Sbjct  538  PQRVW  542



>ref|XP_004136823.1| PREDICTED: uncharacterized protein LOC101206501 [Cucumis sativus]
 ref|XP_004155475.1| PREDICTED: uncharacterized protein LOC101231301 [Cucumis sativus]
 gb|KGN43615.1| Structural constituent of cell wall [Cucumis sativus]
Length=545

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 2/54 (4%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY E+VEKL  MG+R DH+ ++I RMEESGQPVDFNAVLD L+  +SGG Q+ W
Sbjct  494  PYGEIVEKLVGMGFRSDHVASIIHRMEESGQPVDFNAVLDGLS--NSGGPQRVW  545



>ref|XP_008798248.1| PREDICTED: putative cyclin-dependent serine/threonine-protein 
kinase DDB_G0272797/DDB_G0274007 [Phoenix dactylifera]
Length=514

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY E++EK  SMGY  DH  + IQRM ESGQP+DFN++LDRLNG + G S + W
Sbjct  459  PYGEMIEKAVSMGYARDHAASAIQRMGESGQPIDFNSLLDRLNGQAGGASPRIW  512



>ref|XP_007149849.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
 gb|ESW21843.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
Length=513

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 3/54 (6%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P NEL+EK  SMG+R DH+++ IQRM+E+ QP+DFN+VLDRLN H     Q+GW
Sbjct  461  PNNELIEKFVSMGFRGDHVVSTIQRMQETEQPIDFNSVLDRLNVH---NLQRGW  511



>ref|XP_011037330.1| PREDICTED: putative uncharacterized protein DDB_G0294196 isoform 
X2 [Populus euphratica]
Length=526

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  343
            YN+L+EKL +MG+R DH+++VIQRMEE G+PVDFN+VLDRL   SSG S
Sbjct  477  YNDLIEKLVNMGFRGDHVVSVIQRMEEVGEPVDFNSVLDRLKVPSSGWS  525



>ref|XP_011037329.1| PREDICTED: bromodomain-containing protein 4-like isoform X1 [Populus 
euphratica]
Length=527

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  343
            YN+L+EKL +MG+R DH+++VIQRMEE G+PVDFN+VLDRL   SSG S
Sbjct  478  YNDLIEKLVNMGFRGDHVVSVIQRMEEVGEPVDFNSVLDRLKVPSSGWS  526



>gb|EEC71500.1| hypothetical protein OsI_03777 [Oryza sativa Indica Group]
Length=595

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY E++EK  +MGY  + ++NVIQRM ESGQP+DFN +LDRLN   SG   + W
Sbjct  542  PYGEMIEKAITMGYPREQVMNVIQRMTESGQPMDFNTLLDRLNEAGSGAPPRAW  595



>ref|NP_001044280.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAD87289.1| putative calcium-binding protein [Oryza sativa Japonica Group]
 dbj|BAF06194.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAG93651.1| unnamed protein product [Oryza sativa Japonica Group]
Length=594

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY E++EK  +MGY  + ++NVIQRM ESGQP+DFN +LDRLN   SG   + W
Sbjct  541  PYGEMIEKAITMGYPREQVMNVIQRMTESGQPMDFNTLLDRLNEAGSGAPPRAW  594



>ref|XP_006644725.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Oryza brachyantha]
Length=586

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY E++EK  +MGY  + ++NVIQRM ESGQP+DFN +LDRLN   SG   + W
Sbjct  533  PYGEMIEKAITMGYPREQVLNVIQRMTESGQPMDFNTLLDRLNEAGSGAHPRAW  586



>ref|XP_006644724.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Oryza brachyantha]
Length=587

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY E++EK  +MGY  + ++NVIQRM ESGQP+DFN +LDRLN   SG   + W
Sbjct  534  PYGEMIEKAITMGYPREQVLNVIQRMTESGQPMDFNTLLDRLNEAGSGAHPRAW  587



>dbj|BAK01177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY +++EK  +MGY  D ++NVIQRM ESGQ +DFNA+LDRLN   SG   + W
Sbjct  550  PYGDMIEKAITMGYPRDQVLNVIQRMTESGQQIDFNALLDRLNESGSGAPPRAW  603



>ref|XP_004969990.1| PREDICTED: trithorax group protein osa-like [Setaria italica]
Length=590

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY E++EK  +MGY  + ++NV QRM ESGQP+DFN +LDRLN   SG   + W
Sbjct  537  PYGEMIEKAITMGYPREQVLNVTQRMAESGQPMDFNTLLDRLNEAGSGAPPRAW  590



>ref|XP_003543336.1| PREDICTED: RNA polymerase II degradation factor 1-like [Glycine 
max]
Length=537

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 3/53 (6%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            YN+L+EK  SMG+R DH+ N+IQRMEE+  P+DFN+V DRL+ H+    Q+GW
Sbjct  486  YNDLIEKFVSMGFRGDHVANIIQRMEETQLPIDFNSVHDRLDVHN---PQRGW  535



>ref|XP_010919602.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X2 [Elaeis guineensis]
Length=488

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY E++EK   MGY  +H+ +VIQRM E+GQP+DFN++LD LNG ++  S + W
Sbjct  433  PYGEMIEKAVGMGYAREHVASVIQRMGETGQPMDFNSLLDMLNGRATSASARVW  486



>gb|KHN36637.1| hypothetical protein glysoja_001368 [Glycine soja]
Length=537

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 3/53 (6%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            YN+L+EK  SMG+R DH+ N+IQRMEE+  P+DFN+V DRL+ H+    Q+GW
Sbjct  486  YNDLIEKFVSMGFRGDHVANIIQRMEETQLPIDFNSVNDRLDVHN---PQRGW  535



>ref|XP_010919593.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X1 [Elaeis guineensis]
Length=515

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY E++EK   MGY  +H+ +VIQRM E+GQP+DFN++LD LNG ++  S + W
Sbjct  460  PYGEMIEKAVGMGYAREHVASVIQRMGETGQPMDFNSLLDMLNGRATSASARVW  513



>gb|EMT05386.1| hypothetical protein F775_26441 [Aegilops tauschii]
Length=606

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY +++EK  +MGY  D ++NVIQRM ESGQ +DFNA+LDRLN   SG   + W
Sbjct  553  PYGDMIEKANTMGYPRDQVLNVIQRMTESGQQIDFNALLDRLNESGSGAPPRPW  606



>ref|XP_009395702.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Musa acuminata subsp. malaccensis]
Length=581

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -1

Query  507  MRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            MRN P Y +++EK   MGY  + +++++QRM E+GQP+DFN++LDRLNG ++G + + W
Sbjct  524  MRNHP-YGDMIEKAIGMGYDGNQVMSLVQRMAETGQPMDFNSLLDRLNGQAAGATPRAW  581



>emb|CDM84126.1| unnamed protein product [Triticum aestivum]
Length=603

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY +++EK  +MGY  D ++NVIQRM +SGQ +DFNA+LDRLN   SG   + W
Sbjct  550  PYGDMIEKAITMGYPRDQVLNVIQRMTDSGQQIDFNALLDRLNESGSGAPPRPW  603



>gb|EMS50510.1| hypothetical protein TRIUR3_23019 [Triticum urartu]
Length=606

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY +++EK  +MGY  + ++NVIQRM ESGQ +DFNA+LDRLN   SG   + W
Sbjct  553  PYGDMIEKAITMGYPREQVLNVIQRMTESGQQIDFNALLDRLNESGSGAPPRPW  606



>ref|XP_002458505.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
 gb|EES03625.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
Length=587

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG-SQKGW  331
            PY E++EK  +MGY  D ++NV QRM ESGQP+DFN +LDRLN   SG    + W
Sbjct  533  PYGEMMEKAITMGYPRDQVLNVTQRMAESGQPMDFNTLLDRLNEAGSGAPPPRAW  587



>ref|NP_001169238.1| uncharacterized protein LOC100383096 [Zea mays]
 gb|ACN32051.1| unknown [Zea mays]
Length=507

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
            PY E++EK  +MGY  D ++NV QRM ESGQ +DFN +LDRLN   SG 
Sbjct  453  PYGEMMEKAITMGYPRDQVLNVTQRMAESGQSMDFNTLLDRLNEAGSGA  501



>ref|XP_008655245.1| PREDICTED: uncharacterized protein LOC100383096 isoform X1 [Zea 
mays]
 gb|AFW85062.1| putative DUF1421 domain family protein [Zea mays]
Length=584

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
            PY E++EK  +MGY  D ++NV QRM ESGQ +DFN +LDRLN   SG 
Sbjct  530  PYGEMMEKAITMGYPRDQVLNVTQRMAESGQSMDFNTLLDRLNEAGSGA  578



>ref|XP_009396506.1| PREDICTED: pinin-like [Musa acuminata subsp. malaccensis]
Length=512

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y E++EK   MGY  + II  +QRM ESGQP+DF+++LDRLNG ++    + W
Sbjct  460  YGEMIEKAVGMGYDRNQIIGAVQRMVESGQPMDFHSLLDRLNGQAAAAPARAW  512



>gb|KEH24794.1| DNA-binding protein, putative [Medicago truncatula]
Length=565

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS---QKGW  331
            P +++VEK+A+MG+  DH+   ++++ E+GQ VD N VLD+L     GG    Q+GW
Sbjct  506  PVDDIVEKVATMGFPRDHVRATVRKLTENGQAVDLNTVLDKLMNEGGGGDMQQQRGW  562



>ref|XP_008795992.1| PREDICTED: protein transport protein SEC31-like [Phoenix dactylifera]
Length=553

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++VEK+A+MG+  D +   ++++ ESGQ VD N VLD+L        QKGW
Sbjct  497  PIDDVVEKVATMGFSRDQVRATVRKLTESGQSVDLNVVLDKLMNDEEIQPQKGW  550



>ref|XP_006446566.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
 gb|ESR59806.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
Length=574

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V+K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  518  PIDDVVDKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  571



>ref|XP_006470271.1| PREDICTED: COPII coat assembly protein sec16-like [Citrus sinensis]
Length=574

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V+K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  518  PIDDVVDKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  571



>ref|XP_006643803.1| PREDICTED: vegetative cell wall protein gp1-like [Oryza brachyantha]
Length=573

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++VEK+A+MG+  + +   ++R+ E+GQ VD N VLD+L   S    QKGW
Sbjct  517  PVDDVVEKVATMGFSREQVRATVRRLTENGQNVDLNVVLDKLMNDSDVQPQKGW  570



>gb|KDO55180.1| hypothetical protein CISIN_1g0084162mg, partial [Citrus sinensis]
Length=462

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  406  PIDDVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  459



>ref|XP_001784568.1| predicted protein [Physcomitrella patens]
 gb|EDQ50633.1| predicted protein [Physcomitrella patens]
Length=378

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -1

Query  486  NELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQ-----KGW  331
            +E+++K+ASMG+  D +  +++++ E+G  VD N VLD+L NG SSGG++     KGW
Sbjct  318  DEVIDKVASMGFGRDQVRAIVRKLMENGTTVDLNVVLDKLMNGDSSGGNEGQQPAKGW  375



>ref|XP_010940140.1| PREDICTED: protein diaphanous homolog 1-like [Elaeis guineensis]
Length=549

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++VEK+A+MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  493  PIDDVVEKVATMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  546



>gb|KDO55179.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=566

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  510  PIDDVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  563



>gb|KDO55178.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=564

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  508  PIDDVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  561



>ref|XP_006655038.1| PREDICTED: vegetative cell wall protein gp1-like, partial [Oryza 
brachyantha]
Length=495

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQKGW  331
            P +++V+K+A+MG+  + +   ++++ ESGQ VD N VLD+L NG S    Q+GW
Sbjct  438  PIDDVVDKVATMGFSREEVRAAVRQLTESGQNVDLNVVLDKLMNGSSDAQPQRGW  492



>ref|XP_008801947.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Phoenix 
dactylifera]
Length=539

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V+K+A+MG+  D +   ++R+ E+GQ VD N VLD+L        QKGW
Sbjct  483  PIDDVVDKVATMGFSRDQVRAAVRRLTENGQSVDLNVVLDKLMNDGEIQPQKGW  536



>ref|XP_001770189.1| predicted protein [Physcomitrella patens]
 gb|EDQ65023.1| predicted protein [Physcomitrella patens]
Length=403

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 40/60 (67%), Gaps = 6/60 (10%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQ-----KGW  331
            P +E+++K+ASMG+  D +   ++++ E+G  VD N VLD+L NG SSG ++     KGW
Sbjct  341  PVDEVIDKVASMGFGRDQVRATVRKLTENGTSVDLNVVLDKLMNGDSSGRNESQQPAKGW  400



>emb|CAJ44247.1| hypothetical protein [Cocos nucifera]
Length=120

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -1

Query  501  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            N  P +++V+K+ +MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  56   NRMPIDDVVDKVVTMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  112



>ref|XP_011097415.1| PREDICTED: protein enabled-like [Sesamum indicum]
Length=543

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V+K+ +MG+  D +   ++++ E+GQ VD N VLD+L     G +Q+GW
Sbjct  487  PIDDVVDKVTNMGFPRDQVRATVRKLTENGQSVDLNIVLDKLMNDGDGQAQRGW  540



>ref|XP_001758183.1| predicted protein [Physcomitrella patens]
 gb|EDQ77005.1| predicted protein [Physcomitrella patens]
Length=437

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -1

Query  486  NELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQKGW  331
            +E+++K+A MG+  D +  V++R+ E+GQ VD N VLD+L NG       KGW
Sbjct  381  DEVIDKVAVMGFSKDQVRAVVRRLTENGQSVDLNVVLDKLMNGDGGAQPPKGW  433



>ref|XP_010108811.1| hypothetical protein L484_020546 [Morus notabilis]
 gb|EXC20326.1| hypothetical protein L484_020546 [Morus notabilis]
Length=591

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++++K+ +MG+  DH+   ++++ E+GQ VD N VLD+L     G   +GW
Sbjct  535  PIDDVIDKVTTMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNEGEGQLPRGW  588



>ref|XP_009388841.1| PREDICTED: bromodomain-containing protein 4 [Musa acuminata subsp. 
malaccensis]
Length=538

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  486  NELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            +++VEK+A+MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  484  DDVVEKVATMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  535



>ref|XP_002300038.2| hypothetical protein POPTR_0001s34990g [Populus trichocarpa]
 gb|EEE84843.2| hypothetical protein POPTR_0001s34990g [Populus trichocarpa]
Length=337

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V+K+ SMG+  +H+   ++++ E+GQ VD N VLD+L        Q+GW
Sbjct  281  PLDDVVDKVTSMGFPREHVEATVRKLTENGQSVDLNIVLDKLMNDGDVQPQRGW  334



>ref|XP_007031556.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
 gb|EOY02482.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
Length=541

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++++K+ SMG+  DH+   ++++ E+GQ VD N VLD+L   S     +GW
Sbjct  485  PVDDVIDKVTSMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNDSEVQPPRGW  538



>ref|XP_011047322.1| PREDICTED: vacuolar protein sorting-associated protein 37C [Populus 
euphratica]
Length=552

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V+K+ +MG+  +H+   ++++ E+GQ VD N VLD+L        Q+GW
Sbjct  496  PLDDVVDKVTTMGFPREHVEATVRKLTENGQSVDLNVVLDKLMNDGDVQPQRGW  549



>gb|KHG02060.1| Myosin-2 [Gossypium arboreum]
Length=542

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++++K+ +MG+  DH+   ++++ E+GQ VD N VLD+L   S     +GW
Sbjct  486  PIDDVIDKVTTMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNDSDVQPPRGW  539



>gb|KJB75894.1| hypothetical protein B456_012G063600 [Gossypium raimondii]
Length=622

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++++K+ +MG+  DH+   ++++ E+GQ VD N VLD+L   S     +GW
Sbjct  566  PIDDVIDKVTTMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNDSDVQPPRGW  619



>ref|NP_001042136.2| Os01g0169900 [Oryza sativa Japonica Group]
 dbj|BAD68319.1| vegetative cell wall protein gp1 -like [Oryza sativa Japonica 
Group]
 gb|EAY72703.1| hypothetical protein OsI_00570 [Oryza sativa Indica Group]
 gb|EAZ10703.1| hypothetical protein OsJ_00537 [Oryza sativa Japonica Group]
 dbj|BAH00414.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04050.2| Os01g0169900 [Oryza sativa Japonica Group]
Length=580

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQKGW  331
            P +++VEK+A+MG+  + +   ++R+ E+GQ VD N VLD+L N       QKGW
Sbjct  523  PVDDVVEKVATMGFSREQVRATVRRLTENGQNVDLNVVLDKLMNDSDVQQPQKGW  577



>ref|XP_010906083.1| PREDICTED: protein transport protein SEC31 [Elaeis guineensis]
Length=541

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V+K+ +MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  485  PIDDVVDKVVTMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  538



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760