BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF044E10

Length=425
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             101   2e-28   Vitis vinifera
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             102   3e-28   Nelumbo nucifera [Indian lotus]
gb|KJB37873.1|  hypothetical protein B456_006G223900                  97.4    4e-28   Gossypium raimondii
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                97.4    5e-28   Gossypium arboreum [tree cotton]
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like         97.4    5e-28   Tarenaya hassleriana [spider flower]
gb|KJB19538.1|  hypothetical protein B456_003G108500                    101   5e-28   Gossypium raimondii
gb|KJB28098.1|  hypothetical protein B456_005G027700                  97.4    6e-28   Gossypium raimondii
emb|CDP11183.1|  unnamed protein product                              98.2    8e-28   Coffea canephora [robusta coffee]
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                96.7    9e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like           98.6    1e-27   Phoenix dactylifera
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  100   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1              97.1    1e-27   Eucalyptus grandis [rose gum]
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                100   1e-27   
dbj|BAA03710.1|  cytokinin binding protein CBP57                      99.4    1e-27   Nicotiana sylvestris
gb|KDP39327.1|  hypothetical protein JCGZ_01084                       95.9    2e-27   Jatropha curcas
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                    97.4    2e-27   Gossypium hirsutum [American cotton]
gb|KJB72029.1|  hypothetical protein B456_011G154000                  97.4    2e-27   Gossypium raimondii
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like           99.0    2e-27   Nicotiana sylvestris
gb|KJB72024.1|  hypothetical protein B456_011G154000                  97.4    2e-27   Gossypium raimondii
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1              95.1    2e-27   Tarenaya hassleriana [spider flower]
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                  98.2    2e-27   Pinus pinaster [cluster pine]
gb|KHG17040.1|  Adenosylhomocysteinase                                97.4    3e-27   Gossypium arboreum [tree cotton]
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                99.0    3e-27   Gossypium arboreum [tree cotton]
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                99.0    3e-27   Nelumbo nucifera [Indian lotus]
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                97.8    3e-27   Sesamum indicum [beniseed]
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like           97.8    4e-27   Nicotiana tomentosiformis
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like           96.7    4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g           96.3    4e-27   Phaseolus vulgaris [French bean]
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                   97.4    4e-27   Nicotiana tabacum [American tobacco]
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like           97.8    5e-27   
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                95.1    5e-27   Eucalyptus grandis [rose gum]
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like           95.9    7e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                97.1    7e-27   
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516           93.6    8e-27   Arabidopsis lyrata subsp. lyrata
emb|CDP15078.1|  unnamed protein product                              97.1    8e-27   Coffea canephora [robusta coffee]
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like           93.6    9e-27   Sesamum indicum [beniseed]
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                   94.4    9e-27   Eucalyptus grandis [rose gum]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg           93.2    1e-26   Capsella rubella
gb|ABK25129.1|  unknown                                               94.4    1e-26   Picea sitchensis
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like           93.2    1e-26   Sesamum indicum [beniseed]
gb|ABK24229.1|  unknown                                               94.4    1e-26   Picea sitchensis
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like           95.1    1e-26   Glycine max [soybeans]
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein             95.1    1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|KJB72028.1|  hypothetical protein B456_011G154000                  94.7    1e-26   Gossypium raimondii
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                  93.2    1e-26   Arabis alpina [alpine rockcress]
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed           95.1    1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010097949.1|  hypothetical protein L484_026840                 93.6    2e-26   Morus notabilis
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                95.5    2e-26   Vitis vinifera
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                    93.6    2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like           92.0    2e-26   Cucumis sativus [cucumbers]
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...  92.0    2e-26   
ref|NP_001265954.1|  adenosylhomocysteinase-like                      93.6    2e-26   Cicer arietinum [garbanzo]
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like           92.4    2e-26   Setaria italica
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like           95.1    3e-26   Elaeis guineensis
ref|XP_003601687.1|  Adenosylhomocysteinase                           93.6    3e-26   Medicago truncatula
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like           94.4    3e-26   Glycine max [soybeans]
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...  93.6    3e-26   Medicago sativa [alfalfa]
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like           92.4    3e-26   Solanum tuberosum [potatoes]
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like           93.6    3e-26   Oryza brachyantha
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase              96.7    3e-26   Chlorella variabilis
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                91.3    4e-26   Fragaria vesca subsp. vesca
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886           92.8    4e-26   Selaginella moellendorffii
ref|NP_001067845.2|  Os11g0455500                                     93.6    4e-26   
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like           94.4    5e-26   Phoenix dactylifera
gb|AGT16642.1|  Adenosylhomocysteinase                                92.8    5e-26   Saccharum hybrid cultivar R570
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120        93.6    5e-26   Amborella trichopoda
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like           92.8    5e-26   Solanum lycopersicum
gb|ACN34730.1|  unknown                                               92.8    5e-26   Zea mays [maize]
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                  90.5    6e-26   Arabis alpina [alpine rockcress]
gb|EPS72602.1|  adenosylhomocysteinase                                90.1    6e-26   Genlisea aurea
ref|NP_001148534.1|  adenosylhomocysteinase                           92.4    6e-26   
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2              90.5    7e-26   Brassica rapa
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...  94.0    7e-26   
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                     93.2    7e-26   Nicotiana suaveolens
gb|ABR16547.1|  unknown                                               93.2    7e-26   Picea sitchensis
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...  90.9    7e-26   Lupinus luteus
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant          92.0    8e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16138.1|  unknown                                               93.2    8e-26   Picea sitchensis
gb|ABR17322.1|  unknown                                               93.2    8e-26   Picea sitchensis
gb|ACN40278.1|  unknown                                               93.2    8e-26   Picea sitchensis
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg              89.7    8e-26   Erythranthe guttata [common monkey flower]
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...  95.1    8e-26   Phalaenopsis sp.
ref|NP_001289538.1|  adenosylhomocysteinase                           93.2    9e-26   Nicotiana sylvestris
ref|NP_193130.1|  adenosylhomocysteinase 1                            92.0    9e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002522805.1|  adenosylhomocysteinase, putative                 92.8    9e-26   Ricinus communis
ref|NP_001031628.1|  adenosylhomocysteinase 1                         92.8    9e-26   Arabidopsis thaliana [mouse-ear cress]
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...  92.8    9e-26   Petroselinum crispum
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...  90.9    9e-26   Lupinus luteus
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg           90.1    9e-26   Eutrema salsugineum [saltwater cress]
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like           92.0    1e-25   Pyrus x bretschneideri [bai li]
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1              92.4    1e-25   Tarenaya hassleriana [spider flower]
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like           92.8    1e-25   Cicer arietinum [garbanzo]
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                   92.8    1e-25   Nicotiana tabacum [American tobacco]
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                     92.0    1e-25   Gentiana triflora
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                     92.8    1e-25   Nicotiana benthamiana
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg           90.5    1e-25   
gb|ABR16573.1|  unknown                                               92.8    1e-25   Picea sitchensis
emb|CDY50423.1|  BnaCnng19320D                                        90.5    1e-25   Brassica napus [oilseed rape]
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                92.4    1e-25   Solanum lycopersicum
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                     91.3    1e-25   Gentiana triflora
emb|CDY47309.1|  BnaAnng08830D                                        90.5    1e-25   Brassica napus [oilseed rape]
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like           91.3    1e-25   Setaria italica
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                 92.4    1e-25   Populus tomentosa [Chinese white poplar]
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like           92.4    1e-25   Cucumis melo [Oriental melon]
gb|AAM62888.1|  adenosylhomocysteinase                                91.3    1e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                 92.4    1e-25   Populus tomentosa [Chinese white poplar]
emb|CDY01177.1|  BnaA04g06420D                                        90.5    1e-25   
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like           92.4    1e-25   Populus euphratica
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                 92.4    1e-25   Populus tomentosa [Chinese white poplar]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                   92.4    1e-25   Populus tomentosa [Chinese white poplar]
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                  92.4    1e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                 92.4    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase              92.8    2e-25   
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                 92.4    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                 92.4    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                 92.4    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                 92.4    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A            92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like              92.0    2e-25   Solanum tuberosum [potatoes]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...  92.0    2e-25   Catharanthus roseus [chatas]
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|KJB72027.1|  hypothetical protein B456_011G154000                  91.3    2e-25   Gossypium raimondii
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                 91.7    2e-25   Populus tomentosa [Chinese white poplar]
ref|XP_003629610.1|  Adenosylhomocysteinase                           90.5    2e-25   Medicago truncatula
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    2e-25   Populus tomentosa [Chinese white poplar]
gb|ABR16616.1|  unknown                                               91.7    2e-25   Picea sitchensis
gb|KJB72026.1|  hypothetical protein B456_011G154000                  91.3    2e-25   Gossypium raimondii
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like         90.1    2e-25   Brassica rapa
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein             94.0    2e-25   Capsicum annuum
dbj|BAE71233.1|  putative adenosylhomocysteinase                      90.5    2e-25   Trifolium pratense [peavine clover]
gb|KJB72025.1|  hypothetical protein B456_011G154000                  91.7    3e-25   Gossypium raimondii
ref|XP_008671500.1|  PREDICTED: adenosylhomocysteinase-like           90.5    3e-25   
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                91.7    3e-25   Pyrus x bretschneideri [bai li]
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                89.7    3e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant          90.1    3e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AEI54335.1|  adenosylhomocysteinase                                90.1    3e-25   Glycine max [soybeans]
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg           89.0    3e-25   
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2      89.4    3e-25   
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                 90.9    3e-25   Populus tomentosa [Chinese white poplar]
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                  89.4    4e-25   Arabis alpina [alpine rockcress]
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                    91.3    4e-25   Petunia x hybrida [garden petunia]
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...  90.9    4e-25   
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2           90.1    4e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                   89.7    4e-25   Phaseolus vulgaris [French bean]
gb|AAM19782.1|  AT3g23810/MYM9_15                                     90.9    4e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                           90.9    4e-25   Arabidopsis thaliana [mouse-ear cress]
gb|EMT01272.1|  Adenosylhomocysteinase                                87.8    4e-25   
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1              90.9    4e-25   Brassica rapa
ref|NP_189023.1|  adenosylhomocysteinase 2                            90.9    4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g           89.7    5e-25   Phaseolus vulgaris [French bean]
ref|XP_001755929.1|  predicted protein                                89.4    5e-25   
ref|XP_001755926.1|  predicted protein                                89.4    5e-25   
gb|KHN12344.1|  Adenosylhomocysteinase                                89.7    5e-25   Glycine soja [wild soybean]
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2     89.4    6e-25   
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                 90.5    6e-25   Populus tomentosa [Chinese white poplar]
gb|AFV46215.1|  hypothetical protein                                  89.4    6e-25   Scutellaria baicalensis [Baikal skullcap]
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg              89.0    7e-25   Erythranthe guttata [common monkey flower]
gb|KIZ05177.1|  adenosylhomocysteinase                                92.0    8e-25   Monoraphidium neglectum
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant          92.0    8e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                 90.1    8e-25   Populus tomentosa [Chinese white poplar]
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg           89.7    8e-25   Citrus clementina [clementine]
ref|XP_001755906.1|  predicted protein                                88.6    8e-25   
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like           89.7    8e-25   Citrus sinensis [apfelsine]
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                 89.7    9e-25   Citrus sinensis [apfelsine]
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                 89.7    9e-25   Populus tomentosa [Chinese white poplar]
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                88.2    9e-25   Malus domestica [apple tree]
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    9e-25   Populus tomentosa [Chinese white poplar]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2              87.8    9e-25   Camelina sativa [gold-of-pleasure]
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    9e-25   Populus tomentosa [Chinese white poplar]
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like         87.8    1e-24   Camelina sativa [gold-of-pleasure]
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    1e-24   Populus tomentosa [Chinese white poplar]
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                  88.2    1e-24   Linum usitatissimum
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...  90.9    1e-24   Mesembryanthemum crystallinum
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg              88.2    1e-24   Erythranthe guttata [common monkey flower]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    1e-24   Populus tomentosa [Chinese white poplar]
ref|NP_001234012.1|  adenosylhomocysteinase                           89.0    1e-24   
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                   90.1    1e-24   Cucumis sativus [cucumbers]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602            93.2    1e-24   Volvox carteri f. nagariensis
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...  87.8    1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                87.4    1e-24   Populus euphratica
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                91.7    1e-24   Chlamydomonas reinhardtii
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like           89.4    1e-24   Elaeis guineensis
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    1e-24   Populus tomentosa [Chinese white poplar]
ref|XP_003057172.1|  adenosylhomocysteinase                           91.7    1e-24   Micromonas pusilla CCMP1545
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                      89.4    1e-24   Kalanchoe daigremontiana
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                 89.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                   87.4    1e-24   Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                 89.0    1e-24   Populus tomentosa [Chinese white poplar]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    1e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                   87.0    1e-24   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                 92.0    1e-24   Populus tomentosa [Chinese white poplar]
ref|XP_006373090.1|  adenosylhomocysteinase family protein            88.2    1e-24   Populus trichocarpa [western balsam poplar]
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like           89.4    2e-24   
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                  86.3    2e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                 88.6    2e-24   Citrus sinensis [apfelsine]
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1              89.4    2e-24   Cucumis melo [Oriental melon]
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2              87.0    2e-24   Brassica rapa
gb|KHN44476.1|  Adenosylhomocysteinase                                89.0    2e-24   Glycine soja [wild soybean]
ref|XP_002505983.1|  adenosylhomocysteinase                           91.3    2e-24   Micromonas commoda
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1     86.3    2e-24   Prunus mume [ume]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg           86.7    3e-24   Prunus persica
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site  90.5    3e-24   Ostreococcus tauri
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                   86.3    3e-24   Populus tomentosa [Chinese white poplar]
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                     89.4    4e-24   Chlamydomonas sp. ICE-L
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                86.7    4e-24   Malus domestica [apple tree]
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein           87.8    4e-24   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57232.1|  AT4G13940                                            87.0    4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|EMS57266.1|  Adenosylhomocysteinase                                87.4    5e-24   Triticum urartu
ref|XP_002300147.1|  adenosylhomocysteinase family protein            87.0    5e-24   Populus trichocarpa [western balsam poplar]
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                87.0    5e-24   Phoenix dactylifera
gb|AFK46472.1|  unknown                                               87.4    6e-24   Lotus japonicus
emb|CAH69227.1|  putative adenosylhomocysteinase                      87.4    6e-24   Nicotiana glauca [glaucous tobacco]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                   85.1    7e-24   Populus tomentosa [Chinese white poplar]
ref|NP_001031627.1|  adenosylhomocysteinase 1                         86.3    7e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                     88.2    7e-24   Dunaliella salina
gb|EMS57067.1|  Adenosylhomocysteinase                                84.0    8e-24   Triticum urartu
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                   84.7    8e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                   84.7    9e-24   Populus tomentosa [Chinese white poplar]
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                   87.8    9e-24   Populus tomentosa [Chinese white poplar]
gb|EMT11613.1|  Adenosylhomocysteinase                                85.5    1e-23   
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                   84.7    1e-23   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase              88.2    2e-23   Bathycoccus prasinos
tpg|DAA38860.1|  TPA: hypothetical protein ZEAMMB73_022938            84.3    2e-23   
ref|XP_010466741.1|  PREDICTED: adenosylhomocysteinase 2-like iso...  84.0    2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_001419579.1|  predicted protein                                87.0    3e-23   Ostreococcus lucimarinus CCE9901
gb|AAA33855.1|  S-adenosylhomocysteine hydrolase                      85.5    3e-23   Petroselinum crispum
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                    86.7    4e-23   Polytomella sp. Pringsheim 198.80
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...  81.3    5e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003081254.1|  SAHH_PETCR Adenosylhomocysteinase (ISS)          85.1    3e-22   
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                   80.9    2e-21   Helicosporidium sp. ATCC 50920
gb|KFK36282.1|  hypothetical protein AALP_AA4G102500                  82.0    2e-21   Arabis alpina [alpine rockcress]
gb|ABJ53283.1|  S-adenosyl-L-homocysteine hydrolase                   76.6    4e-21   
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                79.3    5e-21   Coccomyxa subellipsoidea C-169
gb|AAL09400.1|AF307335_1  cytokinin binding protein                   81.6    5e-21   Petunia x hybrida [garden petunia]
dbj|BAF01736.1|  adenosylhomocysteinase                               85.1    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011397211.1|  Adenosylhomocysteinase                           79.3    7e-21   Auxenochlorella protothecoides
ref|WP_021266239.1|  adenosylhomocysteinase                           82.8    2e-20   Bacteriovorax sp. BAL6_X
ref|XP_008872075.1|  adenosylhomocysteinase 2                         78.6    2e-20   Aphanomyces invadans
ref|XP_005708566.1|  adenosylhomocysteinase                           77.4    2e-20   
ref|WP_013817471.1|  S-adenosyl-L-homocysteine hydrolase              79.7    4e-20   
ref|WP_038031735.1|  adenosylhomocysteinase                           78.2    7e-20   
ref|WP_026147028.1|  adenosylhomocysteinase                           78.6    7e-20   
ref|WP_014245567.1|  S-adenosyl-L-homocysteine hydrolase              79.7    9e-20   
ref|WP_013164653.1|  S-adenosyl-L-homocysteine hydrolase              77.4    1e-19   
ref|WP_036277747.1|  adenosylhomocysteinase                           78.2    1e-19   
ref|WP_021273157.1|  adenosylhomocysteinase                           79.7    1e-19   
ref|WP_036273174.1|  adenosylhomocysteinase                           77.8    1e-19   
ref|WP_033157853.1|  adenosylhomocysteinase                           77.4    2e-19   
ref|XP_008611237.1|  adenosylhomocysteinase                           75.1    3e-19   
ref|WP_044401865.1|  adenosylhomocysteinase                           76.6    4e-19   
ref|WP_012975209.1|  S-adenosyl-L-homocysteine hydrolase              78.2    5e-19   
gb|ADY54122.1|  adenosylhomocysteinase                                76.3    5e-19   
gb|ACI31554.1|  S-adenosyl homocysteine hydrolase                     70.9    6e-19   
ref|WP_013664531.1|  S-adenosyl-L-homocysteine hydrolase              75.9    6e-19   
ref|WP_020590636.1|  S-adenosyl-L-homocysteine hydrolase              76.6    6e-19   
ref|WP_025609025.1|  adenosylhomocysteinase                           75.5    6e-19   
ref|WP_041537150.1|  adenosylhomocysteinase                           75.9    7e-19   
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase              72.0    7e-19   
ref|WP_028607543.1|  adenosylhomocysteinase                           74.7    7e-19   
ref|WP_026869144.1|  adenosylhomocysteinase                           78.2    7e-19   
ref|WP_022926989.1|  S-adenosyl-L-homocysteine hydrolase              80.5    8e-19   
ref|XP_009833581.1|  adenosylhomocysteinase 2                         73.6    8e-19   
ref|WP_028289662.1|  adenosylhomocysteinase                           74.3    9e-19   
ref|WP_011629999.1|  S-adenosyl-L-homocysteine hydrolase              75.1    1e-18   
ref|XP_002177758.1|  adenosylhomocysteinase                           70.9    1e-18   
ref|WP_009520877.1|  S-adenosyl-L-homocysteine hydrolase              75.9    1e-18   
gb|EOZ95806.1|  Adenosylhomocysteinase                                74.3    1e-18   
ref|WP_009033568.1|  S-adenosyl-L-homocysteine hydrolase              74.3    1e-18   
ref|WP_026814658.1|  adenosylhomocysteinase                           74.7    1e-18   
ref|WP_026998046.1|  adenosylhomocysteinase                           77.0    1e-18   
ref|WP_020569867.1|  S-adenosyl-L-homocysteine hydrolase              75.1    2e-18   
ref|WP_035634402.1|  adenosylhomocysteinase                           73.2    2e-18   
ref|WP_042691048.1|  adenosylhomocysteinase                           75.9    2e-18   
ref|WP_012789710.1|  S-adenosyl-L-homocysteine hydrolase              73.9    2e-18   
ref|WP_026716775.1|  adenosylhomocysteinase                           72.8    3e-18   
ref|WP_013992718.1|  S-adenosyl-L-homocysteine hydrolase              73.2    3e-18   
gb|KDO17385.1|  hypothetical protein SPRG_17078                       72.0    3e-18   
ref|WP_037452032.1|  adenosylhomocysteinase                           75.9    3e-18   
ref|WP_014217427.1|  S-adenosyl-L-homocysteine hydrolase              74.3    3e-18   
ref|WP_021271961.1|  adenosylhomocysteinase                           74.3    3e-18   
ref|WP_010185446.1|  S-adenosyl-L-homocysteine hydrolase              75.1    3e-18   
ref|WP_021277051.1|  adenosylhomocysteinase                           74.7    3e-18   
ref|WP_020039523.1|  S-adenosyl-L-homocysteine hydrolase              79.0    3e-18   
ref|WP_028061676.1|  hypothetical protein                             78.2    3e-18   
ref|WP_014373727.1|  S-adenosyl-L-homocysteine hydrolase              73.2    3e-18   
ref|WP_043959717.1|  S-adenosyl-L-homocysteine hydrolase              75.1    4e-18   
ref|WP_014085452.1|  S-adenosyl-L-homocysteine hydrolase              72.0    4e-18   
ref|WP_044211631.1|  adenosylhomocysteinase                           72.8    4e-18   
ref|WP_008641860.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  73.9    4e-18   
ref|WP_002659990.1|  S-adenosyl-L-homocysteine hydrolase              73.2    4e-18   
ref|WP_035881275.1|  S-adenosyl-L-homocysteine hydrolase              73.9    5e-18   
gb|EJK64241.1|  hypothetical protein THAOC_15047                      70.5    5e-18   
ref|WP_024569279.1|  S-adenosyl-L-homocysteine hydrolase              73.9    5e-18   
ref|WP_033921247.1|  S-adenosyl-L-homocysteine hydrolase              74.3    5e-18   
ref|WP_027420126.1|  adenosylhomocysteinase                           72.8    5e-18   
ref|XP_009493630.1|  adenosylhomocysteinase 1                         69.3    5e-18   
ref|WP_042566226.1|  adenosylhomocysteinase                           71.6    5e-18   
ref|WP_041516432.1|  adenosylhomocysteinase                           71.6    5e-18   
ref|WP_039117485.1|  adenosylhomocysteinase                           71.6    5e-18   
ref|WP_039111837.1|  adenosylhomocysteinase                           71.6    5e-18   
ref|WP_035685897.1|  adenosylhomocysteinase                           71.6    5e-18   
ref|WP_029271915.1|  adenosylhomocysteinase                           71.6    5e-18   
ref|WP_026983772.1|  adenosylhomocysteinase                           71.6    5e-18   
ref|WP_007805093.1|  S-adenosyl-L-homocysteine hydrolase              71.6    5e-18   
ref|WP_034918438.1|  adenosylhomocysteinase                           72.8    5e-18   
ref|WP_009505589.1|  S-adenosyl-L-homocysteine hydrolase              78.2    5e-18   
ref|WP_009778569.1|  S-adenosyl-L-homocysteine hydrolase              72.8    5e-18   
ref|WP_022829157.1|  S-adenosyl-L-homocysteine hydrolase              72.8    6e-18   
gb|ESS70277.1|  adenosylhomocysteinase AhcY                           71.6    6e-18   
ref|WP_036308342.1|  adenosylhomocysteinase                           71.6    6e-18   
ref|WP_018476816.1|  S-adenosyl-L-homocysteine hydrolase              72.0    6e-18   
ref|WP_044425347.1|  adenosylhomocysteinase                           75.1    6e-18   
ref|WP_037530116.1|  S-adenosyl-L-homocysteine hydrolase              73.2    6e-18   
ref|WP_031439895.1|  S-adenosyl-L-homocysteine hydrolase              73.2    6e-18   
ref|WP_031394782.1|  S-adenosyl-L-homocysteine hydrolase              73.2    6e-18   
ref|WP_010402859.1|  S-adenosyl-L-homocysteine hydrolase              73.2    6e-18   
dbj|BAQ16042.1|  adenosylhomocysteinase                               72.4    6e-18   
ref|WP_044229607.1|  adenosylhomocysteinase                           72.0    6e-18   
ref|WP_035623705.1|  adenosylhomocysteinase                           71.6    6e-18   
ref|WP_019864392.1|  S-adenosyl-L-homocysteine hydrolase              72.4    6e-18   
ref|WP_029167185.1|  adenosylhomocysteinase                           72.0    6e-18   
ref|WP_029133360.1|  S-adenosyl-L-homocysteine hydrolase              72.4    7e-18   
ref|WP_029037337.1|  adenosylhomocysteinase                           72.4    7e-18   
ref|XP_002290951.1|  hypothetical protein THAPSDRAFT_28496            68.6    7e-18   
ref|WP_017355275.1|  S-adenosyl-L-homocysteine hydrolase              73.9    7e-18   
ref|WP_029704012.1|  adenosylhomocysteinase                           72.8    7e-18   
ref|WP_018078465.1|  S-adenosyl-L-homocysteine hydrolase              74.3    8e-18   
ref|WP_017509613.1|  S-adenosyl-L-homocysteine hydrolase              72.4    8e-18   
ref|WP_031434523.1|  adenosylhomocysteinase                           72.8    8e-18   
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013           70.9    8e-18   
ref|WP_029416908.1|  S-adenosyl-L-homocysteine hydrolase              78.2    8e-18   
ref|WP_013169144.1|  S-adenosyl-L-homocysteine hydrolase              80.1    8e-18   
gb|AAZ98472.1|  S-adenosyl-L-homocysteine hydrolase                   73.9    8e-18   
ref|WP_015753611.1|  S-adenosyl-L-homocysteine hydrolase              71.6    8e-18   
ref|WP_011296403.1|  S-adenosyl-L-homocysteine hydrolase              72.8    8e-18   
ref|WP_029033999.1|  adenosylhomocysteinase                           72.0    9e-18   
ref|WP_020557949.1|  S-adenosyl-L-homocysteine hydrolase              75.5    9e-18   
ref|WP_037447629.1|  S-adenosyl-L-homocysteine hydrolase              73.2    9e-18   
ref|WP_013846693.1|  S-adenosyl-L-homocysteine hydrolase              73.2    9e-18   
ref|WP_036825409.1|  adenosylhomocysteinase                           72.8    9e-18   
ref|XP_009033133.1|  hypothetical protein AURANDRAFT_69644            72.0    9e-18   
ref|WP_026712577.1|  adenosylhomocysteinase                           70.9    9e-18   
ref|WP_014076680.1|  S-adenosyl-L-homocysteine hydrolase              73.2    1e-17   
ref|WP_027298975.1|  adenosylhomocysteinase                           75.9    1e-17   
ref|WP_007646806.1|  Adenosylhomocysteinase                           71.2    1e-17   
ref|WP_028283194.1|  adenosylhomocysteinase                           72.0    1e-17   
ref|WP_008889059.1|  S-adenosyl-L-homocysteine hydrolase              72.4    1e-17   
ref|WP_029640941.1|  adenosylhomocysteinase                           71.2    1e-17   
ref|WP_027412930.1|  adenosylhomocysteinase                           70.5    1e-17   
ref|WP_007088263.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  72.4    1e-17   
ref|WP_019386012.1|  S-adenosyl-L-homocysteine hydrolase              70.5    1e-17   
ref|WP_005850713.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  78.2    1e-17   
ref|WP_033963836.1|  S-adenosyl-L-homocysteine hydrolase              72.8    1e-17   
ref|WP_037965658.1|  S-adenosyl-L-homocysteine hydrolase              78.2    1e-17   
ref|WP_009825689.1|  S-adenosyl-L-homocysteine hydrolase              78.2    1e-17   
ref|WP_044637347.1|  adenosylhomocysteinase                           70.5    1e-17   
ref|WP_040280491.1|  adenosylhomocysteinase                           70.5    1e-17   
ref|WP_020158974.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  73.6    1e-17   
ref|WP_034158458.1|  S-adenosyl-L-homocysteine hydrolase              72.4    1e-17   
ref|WP_024981943.1|  adenosylhomocysteinase                           70.5    1e-17   
emb|CBJ28078.1|  S-Adenosyl homocysteine hydrolase                    70.9    1e-17   
ref|WP_039751703.1|  adenosylhomocysteinase                           72.0    1e-17   
gb|EDM44261.1|  S-adenosylhomocysteine hydrolase                      72.0    1e-17   
ref|WP_029015961.1|  adenosylhomocysteinase                           70.9    1e-17   
gb|AHG90399.1|  Adenosylhomocysteinase                                71.6    1e-17   
ref|WP_026932687.1|  adenosylhomocysteinase                           71.2    1e-17   
gb|ETZ21451.1|  S-adenosyl-L-homocysteine hydrolase                   71.2    1e-17   
ref|WP_034260308.1|  adenosylhomocysteinase                           71.2    1e-17   
gb|AGU10344.1|  S-adenosyl-L-homocysteine hydrolase                   71.2    1e-17   
ref|WP_026724403.1|  adenosylhomocysteinase                           70.9    1e-17   
ref|WP_041579323.1|  adenosylhomocysteinase                           71.2    2e-17   
emb|CCA20123.1|  unnamed protein product                              68.2    2e-17   
ref|WP_044830294.1|  adenosylhomocysteinase                           71.6    2e-17   
ref|WP_010227584.1|  S-adenosyl-L-homocysteine hydrolase              71.2    2e-17   
gb|ADF54772.1|  S-adenosylhomocysteine hydrolase                      70.9    2e-17   
ref|WP_039008370.1|  S-adenosyl-L-homocysteine hydrolase              72.0    2e-17   
ref|WP_002977614.1|  S-adenosyl-L-homocysteine hydrolase              70.5    2e-17   
ref|WP_028488271.1|  S-adenosyl-L-homocysteine hydrolase              74.3    2e-17   
ref|WP_015481697.1|  S-adenosyl-L-homocysteine hydrolase              70.9    2e-17   
ref|WP_018633571.1|  S-adenosyl-L-homocysteine hydrolase              72.4    2e-17   
ref|WP_009103322.1|  adenosylhomocysteinase                           72.8    2e-17   
ref|WP_042883859.1|  S-adenosyl-L-homocysteine hydrolase              72.8    2e-17   
ref|WP_011614423.1|  S-adenosyl-L-homocysteine hydrolase              72.8    2e-17   
ref|WP_010959508.1|  S-adenosyl-L-homocysteine hydrolase              70.9    2e-17   
ref|WP_013869862.1|  S-adenosyl-L-homocysteine hydrolase              69.7    2e-17   
ref|WP_017365992.1|  S-adenosyl-L-homocysteine hydrolase              70.9    2e-17   
ref|WP_012351529.1|  S-adenosyl-L-homocysteine hydrolase              72.8    2e-17   
ref|WP_027006534.1|  hypothetical protein                             76.3    2e-17   
ref|WP_035870442.1|  S-adenosyl-L-homocysteine hydrolase              73.2    2e-17   
ref|WP_029012526.1|  adenosylhomocysteinase                           72.8    2e-17   
ref|WP_018004682.1|  S-adenosyl-L-homocysteine hydrolase              72.8    2e-17   
ref|WP_018312297.1|  S-adenosyl-L-homocysteine hydrolase              72.8    2e-17   
ref|WP_026910859.1|  S-adenosyl-L-homocysteine hydrolase              74.3    2e-17   
ref|WP_026989957.1|  adenosylhomocysteinase                           70.9    2e-17   
emb|CCD17213.1|  unnamed protein product                              72.0    2e-17   
emb|CCC95537.1|  unnamed protein product                              72.0    2e-17   
ref|WP_022533304.1|  S-adenosyl-L-homocysteine hydrolase              72.4    2e-17   
ref|WP_031454371.1|  adenosylhomocysteinase                           69.7    2e-17   
ref|WP_008243328.1|  S-adenosyl-L-homocysteine hydrolase              70.5    2e-17   
ref|WP_043803716.1|  S-adenosyl-L-homocysteine hydrolase              72.4    2e-17   
gb|AII52536.1|  S-adenosyl-L-homocysteine hydrolase                   70.1    2e-17   
ref|WP_029047363.1|  S-adenosyl-L-homocysteine hydrolase              72.4    3e-17   
ref|WP_026914682.1|  adenosylhomocysteinase                           70.5    3e-17   
ref|WP_006914979.1|  S-adenosyl-L-homocysteine hydrolase              70.5    3e-17   
dbj|GAL84085.1|  S-adenosyl-L-homocysteine hydrolase                  70.5    3e-17   
ref|WP_044018634.1|  adenosylhomocysteinase                           70.1    3e-17   
ref|WP_020214791.1|  S-adenosyl-L-homocysteine hydrolase              70.5    3e-17   
ref|WP_015809474.1|  S-adenosyl-L-homocysteine hydrolase              70.5    3e-17   
ref|WP_013219512.1|  S-adenosyl-L-homocysteine hydrolase              70.5    3e-17   
ref|WP_028826009.1|  adenosylhomocysteinase                           70.5    3e-17   
ref|WP_018473207.1|  S-adenosyl-L-homocysteine hydrolase              70.5    3e-17   
ref|WP_022733905.1|  S-adenosyl-L-homocysteine hydrolase              70.9    3e-17   
ref|WP_021777722.1|  cytoplasmic protein                              69.7    3e-17   
ref|WP_019451117.1|  S-adenosyl-L-homocysteine hydrolase              71.2    3e-17   
ref|WP_014203164.1|  S-adenosyl-L-homocysteine hydrolase              70.5    3e-17   
ref|WP_038690480.1|  S-adenosyl-L-homocysteine hydrolase              72.0    3e-17   
ref|WP_010813332.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  72.4    3e-17   
ref|WP_039128839.1|  adenosylhomocysteinase                           70.5    3e-17   
dbj|BAP57208.1|  S-adenosylhomocysteine hydrolase                     70.9    3e-17   
ref|WP_011934524.1|  S-adenosyl-L-homocysteine hydrolase              70.5    3e-17   
ref|WP_019974351.1|  S-adenosyl-L-homocysteine hydrolase              69.3    3e-17   
ref|WP_041881374.1|  adenosylhomocysteinase                           70.9    3e-17   
ref|WP_042482948.1|  S-adenosyl-L-homocysteine hydrolase              71.6    3e-17   
ref|WP_019669127.1|  S-adenosyl-L-homocysteine hydrolase              69.7    3e-17   
ref|WP_025497172.1|  adenosylhomocysteinase                           70.5    3e-17   
ref|WP_028887271.1|  adenosylhomocysteinase                           69.3    3e-17   
ref|WP_022683191.1|  S-adenosyl-L-homocysteine hydrolase              71.6    3e-17   
ref|WP_023264995.1|  S-adenosyl-L-homocysteine hydrolase              72.0    3e-17   
ref|WP_039352085.1|  adenosylhomocysteinase                           68.9    3e-17   
ref|WP_038660164.1|  S-adenosyl-L-homocysteine hydrolase              71.2    3e-17   
ref|XP_001023087.1|  adenosylhomocysteinase family protein            69.3    3e-17   
ref|WP_027374361.1|  MULTISPECIES: adenosylhomocysteinase             68.9    3e-17   
ref|WP_043059568.1|  S-adenosyl-L-homocysteine hydrolase              71.2    3e-17   
ref|WP_017978608.1|  S-adenosyl-L-homocysteine hydrolase              71.2    3e-17   
ref|WP_007404117.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  71.2    3e-17   
ref|WP_029008569.1|  adenosylhomocysteinase                           72.4    4e-17   
ref|WP_037509838.1|  S-adenosyl-L-homocysteine hydrolase              71.2    4e-17   
ref|WP_007689212.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  71.2    4e-17   
ref|WP_035669645.1|  adenosylhomocysteinase                           68.9    4e-17   
ref|WP_028769932.1|  S-adenosyl-L-homocysteine hydrolase              71.6    4e-17   
emb|CBL87172.1|  S-adenosyl-L-homocysteine hydrolase                  70.9    4e-17   
ref|WP_010523072.1|  S-adenosyl-L-homocysteine hydrolase              69.7    4e-17   
gb|KIX21766.1|  adenosylhomocysteinase                                68.9    4e-17   
ref|WP_028880176.1|  S-adenosyl-L-homocysteine hydrolase              70.1    4e-17   
gb|EDN69065.1|  S-adenosylhomocysteine hydrolase                      70.5    4e-17   
gb|ACV25657.1|  adenosylhomocysteinase                                73.6    4e-17   
dbj|BAP32755.1|  adenosylhomocysteinase                               68.9    4e-17   
ref|WP_028891325.1|  adenosylhomocysteinase                           69.3    4e-17   
ref|WP_018507253.1|  S-adenosyl-L-homocysteine hydrolase              71.6    4e-17   
ref|WP_025145589.1|  adenosylhomocysteinase                           69.3    4e-17   
gb|EKD39460.1|  hypothetical protein ACD_75C00400G0011                69.3    4e-17   
emb|CEG61910.1|  Adenosylhomocysteinase                               68.9    4e-17   
ref|WP_008674504.1|  adenosylhomocysteinase                           70.5    4e-17   
ref|WP_015403886.1|  adenosylhomocysteinase                           69.3    4e-17   
ref|WP_029350387.1|  S-adenosyl-L-homocysteine hydrolase              77.8    4e-17   
ref|WP_026809083.1|  adenosylhomocysteinase                           70.1    4e-17   
ref|WP_041295981.1|  S-adenosyl-L-homocysteine hydrolase              73.6    4e-17   
ref|WP_043580304.1|  S-adenosyl-L-homocysteine hydrolase              70.5    4e-17   
gb|EGZ40840.1|  Adenosylhomocysteinase                                71.2    4e-17   



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   101 bits (251),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+PEQAAYIS+PVEGPYK
Sbjct  420  QLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSPEQAAYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PTHYRY  485


 Score = 50.8 bits (120),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GIIILAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIILAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   102 bits (253),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 63/66 (95%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYIS+PVEGPYK
Sbjct  420  QLELWKEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 49.7 bits (117),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score = 97.4 bits (241),  Expect(2) = 4e-28, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYK
Sbjct  420  QLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 53.5 bits (127),  Expect(2) = 4e-28, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score = 97.4 bits (241),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYK
Sbjct  420  QLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 53.5 bits (127),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score = 97.4 bits (241),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYK
Sbjct  420  QLELWKEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSTDQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 53.5 bits (127),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score =   101 bits (251),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKE+ +GKYEKKVYVLPKHLDEKVA+LHLGKLGAKLTKLTP+QAAYIS+PVEGPYK
Sbjct  420  QLELWKERGSGKYEKKVYVLPKHLDEKVASLHLGKLGAKLTKLTPDQAAYISVPVEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 49.7 bits (117),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score = 97.4 bits (241),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK+TGKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT +QA YIS+P+EGPYK
Sbjct  420  QLELWTEKSTGKYEKKVYVLPKHLDEKVAALHLVKLGAKLTKLTKDQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 53.1 bits (126),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score = 98.2 bits (243),  Expect(2) = 8e-28, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 52.0 bits (123),  Expect(2) = 8e-28, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score = 96.7 bits (239),  Expect(2) = 9e-28, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P+EGPYK
Sbjct  420  QLELWKEKTTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 53.1 bits (126),  Expect(2) = 9e-28, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score = 98.6 bits (244),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P EGPYK
Sbjct  420  QLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISVPTEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   100 bits (250),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            Q+ELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYIS+PVEGPYK
Sbjct  420  QIELWKEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 48.9 bits (115),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LA+GRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLADGRLMNLGCATGHPSFVMSC  411



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score = 97.1 bits (240),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 52.4 bits (124),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   100 bits (248),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKE+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYIS+PVEGPYK
Sbjct  420  QLELWKERGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYK  479

Query  179  PPHYRY  162
            PP YRY
Sbjct  480  PPRYRY  485


 Score = 49.3 bits (116),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSC  411



>dbj|BAA03710.1| cytokinin binding protein CBP57 [Nicotiana sylvestris]
Length=450

 Score = 99.4 bits (246),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  385  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVEGPYK  444

Query  179  PPHYRY  162
            PPHYRY
Sbjct  445  PPHYRY  450


 Score = 50.1 bits (118),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  350  SGIIVLAEGRLMNLGCATGHPSFVMSC  376



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score = 95.9 bits (237),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW+EK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWREKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 53.5 bits (127),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score = 97.4 bits (241),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYK
Sbjct  420  QLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KJB72029.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=456

 Score = 97.4 bits (241),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYK
Sbjct  391  QLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYK  450

Query  179  PPHYRY  162
            PPHYRY
Sbjct  451  PPHYRY  456


 Score = 51.6 bits (122),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  356  TGIIVLAEGRLMNLGCATGHPSFVMSC  382



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score = 99.0 bits (245),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score = 97.4 bits (241),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYK
Sbjct  420  QLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score = 95.1 bits (235),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+P+EGPYK
Sbjct  420  QLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISVPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 53.5 bits (127),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score = 98.2 bits (243),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVAALHL KLGA LTKL+PEQAAYI++PVEGPYK
Sbjct  420  QLELWNEKKSGKYEKKVYVLPKHLDEKVAALHLPKLGAHLTKLSPEQAAYINVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score = 97.4 bits (241),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYK
Sbjct  420  QLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGI++LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIVVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score = 99.0 bits (245),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKE+ +GKYEKKVYVLPKHLDE V +LHLGKLGAKLTKLTP+QAAYIS+PVEGPYK
Sbjct  420  QLELWKERGSGKYEKKVYVLPKHLDEMVGSLHLGKLGAKLTKLTPDQAAYISVPVEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 49.7 bits (117),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score = 99.0 bits (245),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 62/66 (94%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQAAYIS+PVEGPYK
Sbjct  420  QLELWKEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTSEQAAYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 49.7 bits (117),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +G+I+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGVIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score = 97.8 bits (242),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKE+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYK
Sbjct  420  QLELWKERATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score = 97.8 bits (242),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PV+GPYK
Sbjct  420  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVDGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score = 96.7 bits (239),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKE+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+PVEGPYK
Sbjct  420  QLELWKERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PVHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score = 96.3 bits (238),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVA+LHLG+LGAKLTKLT EQA YIS+PVEGPYK
Sbjct  420  QLELWKEKGTGKYEKKVYVLPKHLDEKVASLHLGQLGAKLTKLTKEQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PVHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score = 97.4 bits (241),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PV+GPYK
Sbjct  414  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVDGPYK  473

Query  179  PPHYRY  162
            PPHYRY
Sbjct  474  PPHYRY  479


 Score = 50.1 bits (118),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  379  SGIIVLAEGRLMNLGCATGHPSFVMSC  405



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score = 97.8 bits (242),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+P QA YIS+PVEGPYK
Sbjct  420  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSPAQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 49.7 bits (117),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score = 95.1 bits (235),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK++GKY+K+VYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYK
Sbjct  420  QLELWKEKSSGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 52.4 bits (124),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score = 95.9 bits (237),  Expect(2) = 7e-27, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKE+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P+EGPYK
Sbjct  420  QLELWKERETGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 7e-27, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score = 97.1 bits (240),  Expect(2) = 7e-27, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P+EGPYK
Sbjct  420  QLELWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPAQAEYISVPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 7e-27, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score = 93.6 bits (231),  Expect(2) = 8e-27, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YISIP+EGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 53.1 bits (126),  Expect(2) = 8e-27, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score = 97.1 bits (240),  Expect(2) = 8e-27, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QAAYI++PVEGPYK
Sbjct  420  QLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTSGQAAYINVPVEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 49.7 bits (117),  Expect(2) = 8e-27, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            +TGIIILAEGRL NLGCATGHPS  +SC
Sbjct  384  ETGIIILAEGRLTNLGCATGHPSFVMSC  411



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score = 93.6 bits (231),  Expect(2) = 9e-27, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+P+EGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 53.5 bits (127),  Expect(2) = 9e-27, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score = 94.4 bits (233),  Expect(2) = 9e-27, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK++GKY+K+VYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYK
Sbjct  402  QLELWKEKSSGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYK  461

Query  179  PPHYRY  162
            PPHYRY
Sbjct  462  PPHYRY  467


 Score = 52.4 bits (124),  Expect(2) = 9e-27, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  366  KSGIIVLAEGRLMNLGCATGHPSFVMSC  393



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score = 93.2 bits (230),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 53.1 bits (126),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score = 94.4 bits (233),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+P+QA YI++PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSPDQAEYINVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 52.4 bits (124),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score = 93.2 bits (230),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+P+EGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 53.5 bits (127),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score = 94.4 bits (233),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+P+QA YI++PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSPDQAEYINVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 52.4 bits (124),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score = 95.1 bits (235),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+  QA YIS+PVEGPYK
Sbjct  420  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score = 95.1 bits (235),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+PVEGPYK
Sbjct  420  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score = 94.7 bits (234),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYK
Sbjct  420  QLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYK  479

Query  179  PPHYR  165
            PPHYR
Sbjct  480  PPHYR  484


 Score = 51.6 bits (122),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score = 93.2 bits (230),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ YISIP++GPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYISIPIQGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 53.1 bits (126),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ABA93500.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA93501.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG93815.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score = 95.1 bits (235),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+PVEGPYK
Sbjct  385  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYK  444

Query  179  PPHYRY  162
            P HYRY
Sbjct  445  PAHYRY  450


 Score = 51.2 bits (121),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  350  TGIIVLAEGRLMNLGCATGHPSFVMSC  376



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score = 93.6 bits (231),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT EQA YIS+PVEGPYK
Sbjct  420  QLELWNERTTGKYEKKVYVLPKHLDEKVAALHLSKLGAKLTKLTKEQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 52.0 bits (123),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGIIILAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIILAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score = 95.5 bits (236),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYK
Sbjct  420  QLELWKEKASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score = 93.6 bits (231),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 52.0 bits (123),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYK
Sbjct  420  QLELWNERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 53.5 bits (127),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYK
Sbjct  420  QLELWNERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 53.5 bits (127),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score = 93.6 bits (231),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+N+GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+  QA YIS+PVEGPYK
Sbjct  420  QLELWNERNSGKYEKKVYVLPKHLDEKVAALHLNKLGAKLTKLSQSQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+P+EGPYK
Sbjct  420  QLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 53.1 bits (126),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score = 95.1 bits (235),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YISIP+EGPYK
Sbjct  420  QLELWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISIPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score = 93.6 bits (231),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            Q+ELWKEK +GKYEKKVYVLPKHLDEKVAALHLG+LGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QIELWKEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score = 94.4 bits (233),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK +GKYEKKVYVLPKHLDEKVA+LHLG+LGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWKEKGSGKYEKKVYVLPKHLDEKVASLHLGQLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.8 bits (120),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KRGIIVLAEGRLMNLGCATGHPSFVMSC  411



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score = 93.6 bits (231),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            Q+ELWKEK +GKYEKKVYVLPKHLDEKVAALHLG+LGAKLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QIELWKEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGAKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK +GKYEKKVYVLPKHLDEKVAALHLG+LG KLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWKEKASGKYEKKVYVLPKHLDEKVAALHLGQLGVKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 52.4 bits (124),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score = 93.6 bits (231),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  QA YIS+PVEGPYK
Sbjct  420  QLELWNEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_005843353.1| S-adenosyl-L-homocysteine hydrolase [Chlorella variabilis]
 gb|EFN51251.1| S-adenosyl-L-homocysteine hydrolase [Chlorella variabilis]
Length=483

 Score = 96.7 bits (239),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLTP+QA YI++P+EGPYK
Sbjct  418  QLELWNERASGKYEKKVYVLPKHLDEKVAALHLNKLGAKLTKLTPDQATYINVPIEGPYK  477

Query  179  PPHYRY  162
            PPHYRY
Sbjct  478  PPHYRY  483


 Score = 48.1 bits (113),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            G+I+LAEGRL+NLGCATGHPS  +SC
Sbjct  384  GVIVLAEGRLLNLGCATGHPSFVMSC  409



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score = 91.3 bits (225),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+P+EGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 53.5 bits (127),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score = 92.8 bits (229),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ +QAAYI++PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSADQAAYINVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score = 93.6 bits (231),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+PVEGPYK
Sbjct  450  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYK  509

Query  179  PPHYRY  162
            P HYRY
Sbjct  510  PAHYRY  515


 Score = 50.8 bits (120),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  415  TGIIVLAEGRLMNLGCATGHPSFVMSC  441



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score = 94.4 bits (233),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P+EGPYK
Sbjct  420  QLELWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score = 92.8 bits (229),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YIS+P+EGPYK
Sbjct  420  QLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score = 93.6 bits (231),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKY+K+VYVLPKHLDEKVA+LHLGKLGA LTKL+P+QA YI++P+EGPYK
Sbjct  420  QLELWKEKGTGKYQKQVYVLPKHLDEKVASLHLGKLGAHLTKLSPDQAEYINVPIEGPYK  479

Query  179  PPHYRY  162
            PP YRY
Sbjct  480  PPQYRY  485


 Score = 50.4 bits (119),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score = 92.8 bits (229),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK +GKYEKKVYVLPKHLDEKVAALHLG+LG KLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWKEKASGKYEKKVYVLPKHLDEKVAALHLGQLGVKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GI++LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGILVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score = 92.8 bits (229),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YIS+P+EGPYK
Sbjct  420  QLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score = 90.5 bits (223),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YISIP+EGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 53.5 bits (127),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score = 90.1 bits (222),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKE+++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+ VEGPYK
Sbjct  502  QLELWKERSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVAVEGPYK  561

Query  179  PPHYRY  162
            P HYRY
Sbjct  562  PAHYRY  567


 Score = 53.5 bits (127),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGIIILAEGRLMNLGCATGHPS  +SC
Sbjct  466  KTGIIILAEGRLMNLGCATGHPSFVMSC  493



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YIS+P+EGPYK
Sbjct  420  QLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score = 90.5 bits (223),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PVHYRY  485


 Score = 53.5 bits (127),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score = 94.0 bits (232),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKE++TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YISIP+EGPYK
Sbjct  420  QLELWKERSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISIPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 49.7 bits (117),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score = 93.2 bits (230),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score = 93.2 bits (230),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score = 90.9 bits (224),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLEKLGAKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PFHYRY  485


 Score = 52.4 bits (124),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGIIILAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIILAEGRLMNLGCATGHPSFVMSC  411



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KAGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score = 93.2 bits (230),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score = 93.2 bits (230),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score = 93.2 bits (230),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score = 89.7 bits (221),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKY K+VYVLPKHLDEKVAALHLGKLGAKLTKLT EQ+ YISIPVEGPYK
Sbjct  420  QLELWNERKSGKYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQSDYISIPVEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 53.9 bits (128),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGIIILAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIILAEGRLMNLGCATGHPSFVMSC  411



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score = 95.1 bits (235),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+PVEGPYK
Sbjct  420  QLELWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 48.1 bits (113),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPSL  353
            +GI++LAEGRLMNLGCATGHPS 
Sbjct  385  SGILVLAEGRLMNLGCATGHPSF  407



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score = 93.2 bits (230),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KAGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score = 92.8 bits (229),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW+EK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWREKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|NP_001031628.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83347.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=440

 Score = 92.8 bits (229),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYK
Sbjct  375  QLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYK  434

Query  179  PPHYRY  162
            PPHYRY
Sbjct  435  PPHYRY  440


 Score = 50.4 bits (119),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  339  KAGIIVLAEGRLMNLGCATGHPSFVMSC  366



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score = 92.8 bits (229),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            GIIILAEGRLMNLGCATGHPS  +SC
Sbjct  386  GIIILAEGRLMNLGCATGHPSFVMSC  411



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score = 90.9 bits (224),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ +QA YIS+PVEGPYK
Sbjct  423  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLEKLGAKLTKLSKDQADYISVPVEGPYK  482

Query  179  PPHYRY  162
            P HYRY
Sbjct  483  PFHYRY  488


 Score = 52.4 bits (124),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGIIILAEGRLMNLGCATGHPS  +SC
Sbjct  388  TGIIILAEGRLMNLGCATGHPSFVMSC  414



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score = 90.1 bits (222),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PVHYRY  485


 Score = 53.1 bits (126),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKY+K+VYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P++GPYK
Sbjct  420  QLELWKEKGTGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIDGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score = 92.8 bits (229),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            Q+ELWKEK +GKYEKKVYVLPKHLDEKVAALHLG+LGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QIELWKEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score = 92.8 bits (229),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PLHYRY  485


 Score = 50.8 bits (120),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GIIILAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIILAEGRLMNLGCATGHPSFVMSC  411



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score = 92.8 bits (229),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score = 90.5 bits (223),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YISIP+EGPYK
Sbjct  523  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYK  582

Query  179  PPHYRY  162
            P HYRY
Sbjct  583  PAHYRY  588


 Score = 52.4 bits (124),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  487  KTGIIVLAEGRLMNLGCATGHPSFVMSC  514



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score = 92.8 bits (229),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++P+EGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score = 90.5 bits (223),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 52.4 bits (124),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score = 91.3 bits (225),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYK
Sbjct  420  QLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PLAYRY  485


 Score = 51.6 bits (122),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score = 90.5 bits (223),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYK
Sbjct  421  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYK  480

Query  179  PPHYRY  162
            P HYRY
Sbjct  481  PAHYRY  486


 Score = 52.4 bits (124),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  KSGIIVLAEGRLMNLGCATGHPSFVMSC  412



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score = 91.3 bits (225),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+  Q+ YIS+P+EGPYK
Sbjct  420  QLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKSQSDYISVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYK
Sbjct  420  QLELWNERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score = 91.3 bits (225),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q  Y+SIP+EGPYK
Sbjct  420  QLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQXDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KAGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score = 90.5 bits (223),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>emb|CAB09795.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
Length=467

 Score = 92.4 bits (228),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+L KL+ +Q+ Y+SIP+EGPYK
Sbjct  402  QLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLRKLSKDQSDYVSIPIEGPYK  461

Query  179  PPHYRY  162
            PPHYRY
Sbjct  462  PPHYRY  467


 Score = 50.1 bits (118),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K GII+LA+GRLMNLGCATGHPS  +SC
Sbjct  366  KAGIIVLAQGRLMNLGCATGHPSFVMSC  393



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+L KL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLAKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score = 92.8 bits (229),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 57/65 (88%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK TGKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ EQA YIS+PVEGPYK
Sbjct  420  QLELWNEKATGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSKEQADYISVPVEGPYK  479

Query  179  PPHYR  165
            P HYR
Sbjct  480  PAHYR  484


 Score = 49.7 bits (117),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.4 bits (228),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYK
Sbjct  419  QLELWNERSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYK  478

Query  179  PPHYRY  162
            P HYRY
Sbjct  479  PAHYRY  484


 Score = 50.4 bits (119),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  SGIIVLAEGRLMNLGCATGHPSFVMSC  410



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+P+EGPYK
Sbjct  420  QLELWNERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KJB72027.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=423

 Score = 91.3 bits (225),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  362  PQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPY  183
             QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPY
Sbjct  357  AQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPY  416

Query  182  KPPHYRY  162
            KPPHYRY
Sbjct  417  KPPHYRY  423


 Score = 50.8 bits (120),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
             TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  322  NTGIIVLAEGRLMNLGCATGHPSFVMSC  349



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 91.7 bits (226),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVAPLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score = 90.5 bits (223),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+  QA YIS+PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSQSQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ABR16616.1| unknown [Picea sitchensis]
Length=450

 Score = 91.7 bits (226),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PV+GPYK
Sbjct  385  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVDGPYK  444

Query  179  PPHYRY  162
            P HYRY
Sbjct  445  PAHYRY  450


 Score = 50.4 bits (119),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  350  SGIIVLAEGRLMNLGCATGHPSFVMSC  376



>gb|KJB72026.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=345

 Score = 91.3 bits (225),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  362  PQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPY  183
             QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPY
Sbjct  279  AQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPY  338

Query  182  KPPHYRY  162
            KPPHYRY
Sbjct  339  KPPHYRY  345


 Score = 50.8 bits (120),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
             TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  244  NTGIIVLAEGRLMNLGCATGHPSFVMSC  271



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score = 90.1 bits (222),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PGHYRY  485


 Score = 52.0 bits (123),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score = 94.0 bits (232),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 48.1 bits (113),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +G+I+LAEGRLMNLGCA GHPS  +SC
Sbjct  385  SGVIVLAEGRLMNLGCAAGHPSFVMSC  411



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score = 90.5 bits (223),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+  QA YIS+PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSQSQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KJB72025.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=265

 Score = 91.7 bits (226),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  362  PQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPY  183
             QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPY
Sbjct  199  AQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPY  258

Query  182  KPPHYRY  162
            KPPHYRY
Sbjct  259  KPPHYRY  265


 Score = 50.1 bits (118),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
             TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  164  NTGIIVLAEGRLMNLGCATGHPSFVMSC  191



>ref|XP_008671500.1| PREDICTED: adenosylhomocysteinase-like [Zea mays]
Length=426

 Score = 90.5 bits (223),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEKN+GKYEKKVYVLPKHLDEKV ALHLGK GAKLTKLT  QA YI +P+EGPYK
Sbjct  361  QLELWKEKNSGKYEKKVYVLPKHLDEKVNALHLGKHGAKLTKLTKSQADYIRVPIEGPYK  420

Query  179  PPHYRY  162
              HYRY
Sbjct  421  LAHYRY  426


 Score = 51.2 bits (121),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGIIILAEGRLMNLGCATGHPS  +SC
Sbjct  326  TGIIILAEGRLMNLGCATGHPSFVMSC  352



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score = 91.7 bits (226),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score = 89.7 bits (221),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT +Q+ Y+SIPVEGPYK
Sbjct  422  QLELWNEKASGKYEKKVYVLPKHLDEKVAALHLNKLGAKLTKLTKDQSDYLSIPVEGPYK  481

Query  179  PPHYRY  162
            P HYRY
Sbjct  482  PAHYRY  487


 Score = 52.0 bits (123),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+G+IILAEGRLMNLGCATGHPS  +SC
Sbjct  386  KSGVIILAEGRLMNLGCATGHPSFVMSC  413



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score = 90.1 bits (222),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHL+EKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKASGKYEKKVYVLPKHLNEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KAGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score = 90.1 bits (222),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QL LWKEK+ GKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+  QA YIS+PVEGPYK
Sbjct  420  QLGLWKEKSIGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score = 89.0 bits (219),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYK
Sbjct  442  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYK  501

Query  179  PPHYRY  162
            P HYRY
Sbjct  502  PVHYRY  507


 Score = 52.4 bits (124),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GIIILAEGRLMNLGCATGHPS  +SC
Sbjct  406  KSGIIILAEGRLMNLGCATGHPSFVMSC  433



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score = 89.4 bits (220),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PVHYRY  485


 Score = 52.0 bits (123),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 90.9 bits (224),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKH DEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHFDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score = 89.4 bits (220),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKASGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PVHYRY  485


 Score = 52.0 bits (123),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score = 91.3 bits (225),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PVHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSVVMSC  411



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score = 90.9 bits (224),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score = 90.1 bits (222),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIPVEGPYK
Sbjct  420  QLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKAQSEYISIPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PSAYRY  485


 Score = 51.2 bits (121),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score = 89.7 bits (221),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+ VEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVAVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PTHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score = 90.9 bits (224),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PVHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score = 90.9 bits (224),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PVHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIPVEGPYK
Sbjct  420  QLELWNEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISIPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAAYRY  485


 Score = 53.1 bits (126),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KTGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score = 90.9 bits (224),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score = 90.9 bits (224),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PVHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score = 89.7 bits (221),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+ VEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVAVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PTHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score = 89.4 bits (220),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA LHL KLGA+LTKL+ +QA+YI++PV GPYK
Sbjct  420  QLELWNEKKSGKYEKKVYVLPKHLDEKVALLHLEKLGARLTKLSEDQASYINVPVGGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K G+IILAEGRLMNLGCATGHPS  +SC
Sbjct  384  KRGVIILAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score = 89.4 bits (220),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA LHL KLGA+LTKL+ +QA+YI++PV GPYK
Sbjct  420  QLELWNEKKSGKYEKKVYVLPKHLDEKVALLHLEKLGARLTKLSEDQASYINVPVGGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K G+IILAEGRLMNLGCATGHPS  +SC
Sbjct  384  KRGVIILAEGRLMNLGCATGHPSFVMSC  411



>gb|KHN12344.1| Adenosylhomocysteinase [Glycine soja]
Length=408

 Score = 89.7 bits (221),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  362  PQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPY  183
             QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+  QA YIS+PVEGPY
Sbjct  342  AQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISVPVEGPY  401

Query  182  KPPHYRY  162
            KP HYRY
Sbjct  402  KPAHYRY  408


 Score = 51.2 bits (121),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
             TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  307  NTGIIVLAEGRLMNLGCATGHPSFVMSC  334



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score = 89.4 bits (220),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYK  479

Query  179  PPHYR  165
            P HYR
Sbjct  480  PAHYR  484


 Score = 51.2 bits (121),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGIIILAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIILAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 90.5 bits (223),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKV+VLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVHVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AFV46215.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=302

 Score = 89.4 bits (220),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = -1

Query  362  PQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPY  183
             QLELWKE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ YISIPVEGPY
Sbjct  236  AQLELWKERTSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYISIPVEGPY  295

Query  182  KPPHYRY  162
            KPPHYRY
Sbjct  296  KPPHYRY  302


 Score = 51.2 bits (121),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  201  KSGIIVLAEGRLMNLGCATGHPSFVMSC  228



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score = 89.0 bits (219),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKY K+VYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ YISIPVEGPYK
Sbjct  509  QLELWNERKSGKYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYISIPVEGPYK  568

Query  179  PPHYRY  162
            PPHYRY
Sbjct  569  PPHYRY  574


 Score = 51.6 bits (122),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  473  KSGIIVLAEGRLMNLGCATGHPSFVMSC  500



>gb|KIZ05177.1| adenosylhomocysteinase [Monoraphidium neglectum]
Length=1031

 Score = 92.0 bits (227),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359   QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
             QLELW E+N+G+YEKKVYVLPKHLDEKVAALHL KLG KLT+LTP QA YI++PV+GPYK
Sbjct  966   QLELWNERNSGRYEKKVYVLPKHLDEKVAALHLPKLGVKLTRLTPSQATYINVPVDGPYK  1025

Query  179   PPHYRY  162
             PP YRY
Sbjct  1026  PPAYRY  1031


 Score = 48.1 bits (113),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            G+I+LAEGRL+NLGCATGHPS  +SC
Sbjct  932  GVIVLAEGRLLNLGCATGHPSFVMSC  957



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            PPHYRY
Sbjct  480  PPHYRY  485


 Score = 48.1 bits (113),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K  II+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KAEIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 90.1 bits (222),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWSEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYR+
Sbjct  480  PAHYRH  485


 Score = 50.1 bits (118),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score = 89.7 bits (221),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+  +GPYK
Sbjct  420  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PLHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score = 88.6 bits (218),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVA LHL KLGA+LTKL+ +QA+YI++PV GPYK
Sbjct  420  QLELWNERTSGKYEKKVYVLPKHLDEKVALLHLEKLGARLTKLSDDQASYINVPVGGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 51.6 bits (122),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K G+IILAEGRLMNLGCATGHPS  +SC
Sbjct  384  KRGVIILAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score = 89.7 bits (221),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+  +GPYK
Sbjct  420  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PLHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score = 89.7 bits (221),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+  +GPYK
Sbjct  420  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PLHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 89.7 bits (221),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK + KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSSKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score = 88.2 bits (217),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYK
Sbjct  420  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAAYRY  485


 Score = 52.0 bits (123),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            P +YRY
Sbjct  480  PANYRY  485


 Score = 52.0 bits (123),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.4 bits (124),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.4 bits (124),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.4 bits (124),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            P +YRY
Sbjct  480  PANYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score = 88.2 bits (217),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  496  QLELWNERASGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  555

Query  179  PPHYRY  162
            P  YRY
Sbjct  556  PAQYRY  561


 Score = 51.6 bits (122),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  460  KSGIIVLAEGRLMNLGCATGHPSFVMSC  487



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score = 90.9 bits (224),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 48.9 bits (115),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLM LGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMKLGCATGHPSFVMSC  411



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.4 bits (124),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.4 bits (124),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.4 bits (124),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score = 88.2 bits (217),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKY K+VYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIPVEGPYK
Sbjct  482  QLELWNERKSGKYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPVEGPYK  541

Query  179  PPHYRY  162
            PPHYRY
Sbjct  542  PPHYRY  547


 Score = 51.6 bits (122),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GIIILAEGRLMNLGCATGHPS  +SC
Sbjct  446  KSGIIILAEGRLMNLGCATGHPSFVMSC  473



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score = 89.0 bits (219),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+++GKYEKKVYVLPKHLDEKVAALHLGK GAKLTKLT +QA YI +PVEGPYK
Sbjct  420  QLELWNERSSGKYEKKVYVLPKHLDEKVAALHLGKFGAKLTKLTKDQADYIYVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+L LGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLRLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 51/66 (77%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LT+L+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTELSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.4 bits (124),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score = 90.1 bits (222),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 49.7 bits (117),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_002950429.1| hypothetical protein VOLCADRAFT_74602 [Volvox carteri f. nagariensis]
 gb|EFJ48630.1| hypothetical protein VOLCADRAFT_74602 [Volvox carteri f. nagariensis]
Length=483

 Score = 93.2 bits (230),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+++G+YEKKVYVLPKHLDEKVAALHL KLGAKLT+L+PEQA YI++PV+GPYK
Sbjct  418  QLELWNERSSGRYEKKVYVLPKHLDEKVAALHLPKLGAKLTRLSPEQATYINVPVDGPYK  477

Query  179  PPHYRY  162
            P HYRY
Sbjct  478  PLHYRY  483


 Score = 46.2 bits (108),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
             +IILAEGRL+NLGCATGHPS  +SC
Sbjct  384  AVIILAEGRLLNLGCATGHPSFVMSC  409



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYK  479

Query  179  PPHYRY  162
            P +YRY
Sbjct  480  PANYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_001693339.1| S-Adenosyl homocysteine hydrolase [Chlamydomonas reinhardtii]
 gb|EDP03365.1| S-Adenosyl homocysteine hydrolase [Chlamydomonas reinhardtii]
Length=483

 Score = 91.7 bits (226),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E++TG+YEKKVYVLPKHLDEKVAALHL KLG KLTKL+ +QAAYI++PV+GPYK
Sbjct  418  QLELWNERSTGRYEKKVYVLPKHLDEKVAALHLPKLGVKLTKLSADQAAYINVPVDGPYK  477

Query  179  PPHYRY  162
            P HYRY
Sbjct  478  PAHYRY  483


 Score = 48.1 bits (113),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            G+I+LAEGRL+NLGCATGHPS  +SC
Sbjct  384  GVIVLAEGRLLNLGCATGHPSFVMSC  409



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score = 89.4 bits (220),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  362  PQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPY  183
             QLELWKE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YISIP+EGPY
Sbjct  419  AQLELWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISIPIEGPY  478

Query  182  KPPHYRY  162
            KP HYRY
Sbjct  479  KPAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_003057172.1| adenosylhomocysteinase [Micromonas pusilla CCMP1545]
 gb|EEH58817.1| adenosylhomocysteinase [Micromonas pusilla CCMP1545]
Length=487

 Score = 91.7 bits (226),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYEKKVYVLPKHLDEKVAALHL K+G KLTKL+ EQAAYI++PVEGPYK
Sbjct  422  QLELWNERKTGKYEKKVYVLPKHLDEKVAALHLEKIGVKLTKLSAEQAAYINVPVEGPYK  481

Query  179  PPHYRY  162
            P  YRY
Sbjct  482  PAAYRY  487


 Score = 48.1 bits (113),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            GII+LAEGRL+NLGCATGHPS  +SC
Sbjct  388  GIIMLAEGRLLNLGCATGHPSFVMSC  413



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSEDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score = 89.4 bits (220),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT EQA YIS+P+EGPYK
Sbjct  420  QLELWNEKASGKYEKKVYVLPKHLDEKVAALHLSKLGAKLTKLTKEQADYISVPIEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAAYRY  485


 Score = 50.1 bits (118),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 89.4 bits (220),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLD KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDGKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.4 bits (215),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 89.0 bits (219),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            Q ELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QPELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.4 bits (119),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 47.4 bits (111),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGR MNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRPMNLGCATGHPSFVMSC  411



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 87.0 bits (214),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.4 bits (124),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 92.0 bits (227),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 47.4 bits (111),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGR MNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRPMNLGCATGHPSFVMSC  411



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score = 88.2 bits (217),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 51.2 bits (121),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GI++LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGILVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score = 89.4 bits (220),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSC  411



>emb|CAJ01706.1| S-adenosyl-L-homocysteine hydrolase [Hordeum vulgare subsp. vulgare]
Length=450

 Score = 86.3 bits (212),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIP+EGPYK
Sbjct  385  QLELWNEKASGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISIPIEGPYK  444

Query  179  PPHYRY  162
            P  YRY
Sbjct  445  PAAYRY  450


 Score = 53.1 bits (126),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            KTGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  349  KTGIIVLAEGRLMNLGCATGHPSFVMSC  376



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score = 88.6 bits (218),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+  +GPYK
Sbjct  380  QLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYK  439

Query  179  PPHYRY  162
            P HYRY
Sbjct  440  PLHYRY  445


 Score = 50.4 bits (119),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  345  SGIIVLAEGRLMNLGCATGHPSFVMSC  371



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score = 89.4 bits (220),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++PVEGPYK
Sbjct  420  QLELWNERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PAHYRY  485


 Score = 49.7 bits (117),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  386  GIIVLAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score = 87.0 bits (214),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PVSYRY  485


 Score = 52.0 bits (123),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|KHN44476.1| Adenosylhomocysteinase [Glycine soja]
Length=291

 Score = 89.0 bits (219),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  362  PQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPY  183
             QLELWKEK +GKYEKKVYVLPKHLDEKVA+LHLG+LGA+LTKL+ +QA YIS+PVEGPY
Sbjct  225  AQLELWKEKGSGKYEKKVYVLPKHLDEKVASLHLGQLGARLTKLSKDQADYISVPVEGPY  284

Query  182  KPPHYRY  162
            KP HYRY
Sbjct  285  KPAHYRY  291


 Score = 50.1 bits (118),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  190  KRGIIVLAEGRLMNLGCATGHPSFVMSC  217



>ref|XP_002505983.1| adenosylhomocysteinase [Micromonas sp. RCC299]
 gb|ACO67241.1| adenosylhomocysteinase [Micromonas sp. RCC299]
Length=487

 Score = 91.3 bits (225),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYEKKVYVLPKHLDEKVAALHL K+G KLTKLT EQAAYI++PVEGPYK
Sbjct  422  QLELWNERKTGKYEKKVYVLPKHLDEKVAALHLEKIGVKLTKLTTEQAAYINVPVEGPYK  481

Query  179  PPHYRY  162
            P  YRY
Sbjct  482  PAAYRY  487


 Score = 47.4 bits (111),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            G+I+LAEGRL+NLGCATGHPS  +SC
Sbjct  388  GVIMLAEGRLLNLGCATGHPSFVMSC  413



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score = 86.3 bits (212),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  362  PQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPY  183
             QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPY
Sbjct  419  AQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPY  478

Query  182  KPPHYRY  162
            KP HYRY
Sbjct  479  KPAHYRY  485


 Score = 52.0 bits (123),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGIIILAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIILAEGRLMNLGCATGHPSFVMSC  411



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score = 86.7 bits (213),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  362  PQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPY  183
             QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPY
Sbjct  419  AQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPY  478

Query  182  KPPHYRY  162
            KP HYRY
Sbjct  479  KPAHYRY  485


 Score = 52.0 bits (123),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGIIILAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIILAEGRLMNLGCATGHPSFVMSC  411



>emb|CEF99088.1| S-adenosyl-L-homocysteine hydrolase, conserved site [Ostreococcus 
tauri]
Length=486

 Score = 90.5 bits (223),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGK+GAKLTKL+ EQAAYI++PVEGPYK
Sbjct  421  QLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKIGAKLTKLSTEQAAYINVPVEGPYK  480

Query  179  PPHYRY  162
            P  YRY
Sbjct  481  PAAYRY  486


 Score = 48.1 bits (113),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            GII+LAEGRL+NLGCATGHPS  +SC
Sbjct  387  GIIMLAEGRLLNLGCATGHPSFVMSC  412



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 86.3 bits (212),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI+ PVEGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINAPVEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 52.0 bits (123),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K+GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  384  KSGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|ADQ00183.1| S-adenosyl homocysteine hydrolase [Chlamydomonas sp. ICE-L]
Length=487

 Score = 89.4 bits (220),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E++TG+YE KVYVLPKHLDEKVA LHL KLG KLTKL+PEQAAYI++P+ GPYK
Sbjct  422  QLELWNERSTGRYENKVYVLPKHLDEKVATLHLDKLGCKLTKLSPEQAAYINVPIGGPYK  481

Query  179  PPHYRY  162
            P +YRY
Sbjct  482  PANYRY  487


 Score = 48.5 bits (114),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 2/26 (8%)
 Frame = -2

Query  418  GIIILAEGRLMNLGCATGHPS--LSC  347
            G+IILAEGRL+NLGCATGHPS  +SC
Sbjct  388  GVIILAEGRLLNLGCATGHPSFVMSC  413



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score = 86.7 bits (213),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  362  PQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPY  183
             QLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPY
Sbjct  419  AQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPY  478

Query  182  KPPHYRY  162
            KP HYRY
Sbjct  479  KPAHYRY  485


 Score = 51.2 bits (121),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  TGIIVLAEGRLMNLGCATGHPSFVMSC  411



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score = 87.8 bits (216),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK++GKYEKKVYVLPK LDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYK
Sbjct  420  QLELWNEKSSGKYEKKVYVLPKRLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYK  479

Query  179  PPHYRY  162
            P HYRY
Sbjct  480  PVHYRY  485


 Score = 50.1 bits (118),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



>dbj|BAH57232.1| AT4G13940 [Arabidopsis thaliana]
Length=291

 Score = 87.0 bits (214),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  362  PQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPY  183
             QLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPY
Sbjct  225  AQLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPY  284

Query  182  KPPHYRY  162
            KPPHYRY
Sbjct  285  KPPHYRY  291


 Score = 50.8 bits (120),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = -2

Query  424  KTGIIILAEGRLMNLGCATGHPS--LSC  347
            K GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  190  KAGIIVLAEGRLMNLGCATGHPSFVMSC  217



>gb|EMS57266.1| Adenosylhomocysteinase [Triticum urartu]
Length=752

 Score = 87.4 bits (215),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW EK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIPV+GPYK
Sbjct  687  QLELWNEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKAQSEYISIPVDGPYK  746

Query  179  PPHYRY  162
            P  YRY
Sbjct  747  PAAYRY  752


 Score = 50.4 bits (119),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            TGII+LAEGRLMNLGCATGHPS  +SC
Sbjct  652  TGIIVLAEGRLMNLGCATGHPSFVMSC  678



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score = 87.0 bits (214),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 51/66 (77%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -1

Query  359  QLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYK  180
            QLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++P+EGPYK
Sbjct  420  QLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPIEGPYK  479

Query  179  PPHYRY  162
            P  YRY
Sbjct  480  PAQYRY  485


 Score = 50.4 bits (119),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 2/27 (7%)
 Frame = -2

Query  421  TGIIILAEGRLMNLGCATGHPS--LSC  347
            +GII+LAEGRLMNLGCATGHPS  +SC
Sbjct  385  SGIIVLAEGRLMNLGCATGHPSFVMSC  411



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555628969350