BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF044B14

Length=646
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP00803.1|  unnamed protein product                              80.1    2e-15   Coffea canephora [robusta coffee]
ref|XP_008467130.1|  PREDICTED: uncharacterized protein LOC103504558  75.1    1e-13   
ref|XP_004150595.1|  PREDICTED: uncharacterized protein LOC101204652  74.7    2e-13   Cucumis sativus [cucumbers]
gb|KJB15416.1|  hypothetical protein B456_002G177100                  72.8    8e-13   Gossypium raimondii
gb|KHG14735.1|  hypothetical protein F383_02623                       72.8    8e-13   Gossypium arboreum [tree cotton]
ref|XP_010552701.1|  PREDICTED: uncharacterized protein At4g22758     71.2    3e-12   Tarenaya hassleriana [spider flower]
ref|XP_009600493.1|  PREDICTED: uncharacterized protein At4g22758...  70.9    5e-12   Nicotiana tomentosiformis
ref|XP_004504564.1|  PREDICTED: uncharacterized protein LOC101507525  70.5    5e-12   
ref|XP_006355080.1|  PREDICTED: uncharacterized protein LOC102584968  70.5    7e-12   Solanum tuberosum [potatoes]
ref|XP_004236949.1|  PREDICTED: uncharacterized protein LOC101244859  70.1    9e-12   Solanum lycopersicum
gb|KJB50372.1|  hypothetical protein B456_008G167200                  69.7    1e-11   Gossypium raimondii
gb|KHG22133.1|  hypothetical protein F383_27486                       69.3    1e-11   Gossypium arboreum [tree cotton]
ref|NP_565000.1|  uncharacterized protein                             69.3    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KDP38078.1|  hypothetical protein JCGZ_04721                       68.9    2e-11   Jatropha curcas
gb|KHN12462.1|  hypothetical protein glysoja_018592                   68.9    2e-11   Glycine soja [wild soybean]
ref|XP_006364850.1|  PREDICTED: uncharacterized protein LOC102578189  68.6    2e-11   Solanum tuberosum [potatoes]
ref|XP_002527797.1|  conserved hypothetical protein                   68.2    3e-11   Ricinus communis
ref|XP_004237906.1|  PREDICTED: uncharacterized protein At4g22758...  67.8    5e-11   Solanum lycopersicum
ref|XP_011070610.1|  PREDICTED: uncharacterized protein At4g22758...  67.4    6e-11   Sesamum indicum [beniseed]
gb|EYU30083.1|  hypothetical protein MIMGU_mgv1a016062mg              67.0    7e-11   Erythranthe guttata [common monkey flower]
ref|XP_010415767.1|  PREDICTED: uncharacterized protein At4g22758...  66.6    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_007153400.1|  hypothetical protein PHAVU_003G031800g           66.6    1e-10   Phaseolus vulgaris [French bean]
ref|XP_002888795.1|  hypothetical protein ARALYDRAFT_894896           66.6    1e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_004498287.1|  PREDICTED: uncharacterized protein LOC101497295  66.2    1e-10   Cicer arietinum [garbanzo]
ref|NP_001236734.1|  uncharacterized protein LOC100305791             65.9    2e-10   Glycine max [soybeans]
ref|XP_004297386.1|  PREDICTED: uncharacterized protein At4g22758     65.9    2e-10   Fragaria vesca subsp. vesca
ref|XP_008221421.1|  PREDICTED: uncharacterized protein LOC103321407  65.5    3e-10   Prunus mume [ume]
ref|XP_007223777.1|  hypothetical protein PRUPE_ppa013143mg           65.5    3e-10   Prunus persica
ref|XP_002890566.1|  hypothetical protein ARALYDRAFT_889841           65.5    3e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_010471079.1|  PREDICTED: uncharacterized protein At4g22758...  65.1    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010044204.1|  PREDICTED: uncharacterized protein At4g22758     64.7    5e-10   Eucalyptus grandis [rose gum]
ref|XP_010670141.1|  PREDICTED: uncharacterized protein At4g22758...  65.1    6e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009351504.1|  PREDICTED: uncharacterized protein At4g22758...  63.9    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_009349522.1|  PREDICTED: uncharacterized protein At4g22758...  63.9    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_002311509.2|  hypothetical protein POPTR_0008s13080g           63.5    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_002284639.1|  PREDICTED: uncharacterized protein At4g22758     63.2    2e-09   Vitis vinifera
gb|KFK22025.1|  hypothetical protein AALP_AAs45940U000100             62.8    3e-09   Arabis alpina [alpine rockcress]
emb|CDX68330.1|  BnaA07g23700D                                        62.4    4e-09   
ref|XP_009104937.1|  PREDICTED: uncharacterized protein At4g22758...  62.0    5e-09   Brassica rapa
ref|XP_011023710.1|  PREDICTED: uncharacterized protein At4g22758...  61.6    7e-09   Populus euphratica
ref|XP_003589658.1|  hypothetical protein MTR_1g031680                61.6    8e-09   Medicago truncatula
ref|XP_006448227.1|  hypothetical protein CICLE_v10017117mg           61.2    8e-09   Citrus clementina [clementine]
ref|XP_006469193.1|  PREDICTED: uncharacterized protein LOC102613615  61.2    8e-09   Citrus sinensis [apfelsine]
dbj|BAB33412.1|  putative senescence-associated protein               62.8    9e-09   Pisum sativum [garden pea]
ref|XP_007047987.1|  Uncharacterized protein TCM_001138               62.0    1e-08   
ref|XP_006390840.1|  hypothetical protein EUTSA_v10019542mg           60.5    2e-08   Eutrema salsugineum [saltwater cress]
emb|CBI33520.3|  unnamed protein product                              60.5    2e-08   Vitis vinifera
gb|AFK44881.1|  unknown                                               60.1    2e-08   Lotus japonicus
ref|XP_002270144.3|  PREDICTED: uncharacterized protein At4g22758     60.5    2e-08   Vitis vinifera
ref|XP_011038615.1|  PREDICTED: uncharacterized protein At4g22758...  59.7    3e-08   Populus euphratica
ref|XP_002315875.1|  hypothetical protein POPTR_0010s12090g           59.7    3e-08   Populus trichocarpa [western balsam poplar]
gb|EPS61325.1|  hypothetical protein M569_13473                       60.5    3e-08   Genlisea aurea
gb|KCW64559.1|  hypothetical protein EUGRSUZ_G02164                   58.9    4e-08   Eucalyptus grandis [rose gum]
ref|XP_010274728.1|  PREDICTED: uncharacterized protein At4g22758     59.3    5e-08   Nelumbo nucifera [Indian lotus]
gb|AAL16139.1|AF428307_1  At1g70780/F5A18_4                           59.3    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010066603.1|  PREDICTED: uncharacterized protein LOC104453692  58.9    6e-08   Eucalyptus grandis [rose gum]
ref|XP_010553810.1|  PREDICTED: uncharacterized protein LOC104823786  58.5    8e-08   Tarenaya hassleriana [spider flower]
ref|XP_006301002.1|  hypothetical protein CARUB_v10021392mg           58.2    1e-07   Capsella rubella
ref|XP_011099466.1|  PREDICTED: uncharacterized protein At4g22758...  58.2    1e-07   Sesamum indicum [beniseed]
ref|NP_001236932.1|  uncharacterized protein LOC100499853             57.8    2e-07   Glycine max [soybeans]
gb|ACJ84118.1|  unknown                                               57.4    2e-07   Medicago truncatula
ref|XP_010264360.1|  PREDICTED: uncharacterized protein At4g22758...  57.4    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_008356300.1|  PREDICTED: uncharacterized protein LOC103420001  57.4    2e-07   
gb|ABK96329.1|  unknown                                               57.0    2e-07   Populus trichocarpa x Populus deltoides
ref|XP_007033029.1|  Uncharacterized protein TCM_019175               57.4    2e-07   
ref|XP_007153591.1|  hypothetical protein PHAVU_003G048500g           57.0    4e-07   Phaseolus vulgaris [French bean]
ref|XP_002534031.1|  conserved hypothetical protein                   57.0    4e-07   Ricinus communis
ref|XP_007045196.1|  Uncharacterized protein isoform 2                56.6    4e-07   
ref|XP_010681883.1|  PREDICTED: uncharacterized protein LOC104896789  56.6    5e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007163388.1|  hypothetical protein PHAVU_001G230600g           56.2    7e-07   Phaseolus vulgaris [French bean]
emb|CDY71620.1|  BnaC05g50380D                                        55.8    7e-07   Brassica napus [oilseed rape]
emb|CDY23481.1|  BnaC06g24500D                                        55.8    8e-07   Brassica napus [oilseed rape]
gb|KHN46081.1|  Hypothetical protein glysoja_030082                   55.1    1e-06   Glycine soja [wild soybean]
ref|XP_008782287.1|  PREDICTED: uncharacterized protein LOC103701859  55.1    2e-06   Phoenix dactylifera
ref|XP_009334449.1|  PREDICTED: uncharacterized protein At4g22758...  55.1    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_010667680.1|  PREDICTED: uncharacterized protein LOC104884693  54.7    3e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010926482.1|  PREDICTED: uncharacterized protein LOC105048744  53.5    6e-06   Elaeis guineensis
ref|XP_003552877.1|  PREDICTED: uncharacterized protein LOC100810542  53.5    6e-06   Glycine max [soybeans]
ref|XP_009774976.1|  PREDICTED: uncharacterized protein At4g22758...  53.5    6e-06   Nicotiana sylvestris
ref|XP_009605387.1|  PREDICTED: uncharacterized protein LOC104099956  52.8    9e-06   Nicotiana tomentosiformis
ref|XP_003537448.2|  PREDICTED: uncharacterized protein LOC100775979  53.1    1e-05   Glycine max [soybeans]
ref|XP_007216024.1|  hypothetical protein PRUPE_ppa014882mg           52.4    1e-05   
gb|EYU33134.1|  hypothetical protein MIMGU_mgv1a016072mg              52.4    1e-05   Erythranthe guttata [common monkey flower]
gb|EYU25602.1|  hypothetical protein MIMGU_mgv1a024525mg              52.4    1e-05   Erythranthe guttata [common monkey flower]
ref|XP_008229193.1|  PREDICTED: uncharacterized protein LOC103328...  52.8    1e-05   Prunus mume [ume]
gb|KHN17944.1|  hypothetical protein glysoja_017995                   52.4    2e-05   Glycine soja [wild soybean]
gb|EPS67816.1|  hypothetical protein M569_06958                       51.6    3e-05   Genlisea aurea
gb|KFK41506.1|  hypothetical protein AALP_AA2G138600                  51.6    3e-05   Arabis alpina [alpine rockcress]
emb|CDP02694.1|  unnamed protein product                              51.2    4e-05   Coffea canephora [robusta coffee]
ref|XP_008343057.1|  PREDICTED: uncharacterized protein LOC103405829  51.2    4e-05   
gb|ACJ83930.1|  unknown                                               50.4    7e-05   Medicago truncatula
gb|AGU36354.1|  hypothetical protein                                  50.1    7e-05   Helianthus annuus
emb|CAN65811.1|  hypothetical protein VITISV_031711                   50.4    7e-05   Vitis vinifera
ref|XP_007045195.1|  Uncharacterized protein isoform 1                50.1    1e-04   
ref|XP_006416119.1|  hypothetical protein EUTSA_v10009597mg           49.7    2e-04   Eutrema salsugineum [saltwater cress]
ref|XP_006357767.1|  PREDICTED: uncharacterized protein LOC102592157  49.3    2e-04   Solanum tuberosum [potatoes]
gb|AGU36351.1|  hypothetical protein                                  48.9    2e-04   Helianthus argophyllus
ref|XP_006430618.1|  hypothetical protein CICLE_v10012986mg           49.7    2e-04   Citrus clementina [clementine]
ref|XP_006482133.1|  PREDICTED: uncharacterized protein LOC102630256  49.3    2e-04   Citrus sinensis [apfelsine]
ref|XP_011073847.1|  PREDICTED: uncharacterized protein LOC105158703  49.7    3e-04   Sesamum indicum [beniseed]
ref|XP_010032694.1|  PREDICTED: uncharacterized protein At4g22758...  49.3    3e-04   Eucalyptus grandis [rose gum]
ref|XP_006305759.1|  hypothetical protein CARUB_v10010592mg           48.9    3e-04   Capsella rubella
ref|XP_009586822.1|  PREDICTED: uncharacterized protein LOC104084618  48.5    3e-04   Nicotiana tomentosiformis
emb|CDY09482.1|  BnaC02g20240D                                        48.5    3e-04   Brassica napus [oilseed rape]
gb|AGU36357.1|  hypothetical protein                                  48.1    4e-04   Helianthus annuus
ref|XP_010095717.1|  hypothetical protein L484_002689                 48.1    4e-04   Morus notabilis
gb|AGU36353.1|  hypothetical protein                                  47.8    5e-04   Helianthus annuus
gb|AGU36367.1|  hypothetical protein                                  47.4    7e-04   Helianthus annuus



>emb|CDP00803.1| unnamed protein product [Coffea canephora]
Length=138

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 9/81 (11%)
 Frame = -1

Query  514  FLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAAR  335
            F+ +  C + +       ALSPW+TIGSLG RNF+LCKKP  +K  SGDG Q + ++ +R
Sbjct  67   FMLYCPCATTE-------ALSPWETIGSLGFRNFMLCKKPETQK-MSGDGNQTSPSM-SR  117

Query  334  KSGSIWKTLFNKSLNAKVMSH  272
            KS   WK  FNKSLN KV SH
Sbjct  118  KSSGNWKAWFNKSLNLKVSSH  138



>ref|XP_008467130.1| PREDICTED: uncharacterized protein LOC103504558 [Cucumis melo]
Length=139

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPWDTIGS G RNF+LCKKP  EK  S +GK        RKS   WK+  NKSLN K+
Sbjct  78   ALSPWDTIGSHGARNFMLCKKPQPEK-VSEEGKSPPGPTIPRKSAGSWKSWINKSLNLKI  136

Query  280  MSH  272
             SH
Sbjct  137  YSH  139



>ref|XP_004150595.1| PREDICTED: uncharacterized protein LOC101204652 [Cucumis sativus]
 ref|XP_004161989.1| PREDICTED: uncharacterized protein LOC101229683 [Cucumis sativus]
 gb|KGN51491.1| hypothetical protein Csa_5G569870 [Cucumis sativus]
Length=139

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPWDTIGS G RNF+LCKKP  EK    +GK  +     RKS   WK+  NKSLN K+
Sbjct  78   ALSPWDTIGSHGARNFMLCKKPQPEKVPE-EGKTPSGPAIPRKSAGSWKSWINKSLNLKI  136

Query  280  MSH  272
             SH
Sbjct  137  YSH  139



>gb|KJB15416.1| hypothetical protein B456_002G177100 [Gossypium raimondii]
Length=137

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 3/63 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+TIGS G RNF+LCKKP  EK    DGK AAE++  + SG+ WK  FNKSLN K+
Sbjct  78   ALSPWETIGSQGARNFMLCKKPRTEKVKD-DGK-AAESINRKASGN-WKAWFNKSLNLKI  134

Query  280  MSH  272
             SH
Sbjct  135  SSH  137



>gb|KHG14735.1| hypothetical protein F383_02623 [Gossypium arboreum]
Length=137

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 3/63 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+TIGS G RNF+LCKKP  EK    DGK AAE++  + SG+ WK  FNKSLN K+
Sbjct  78   ALSPWETIGSQGARNFMLCKKPRTEKVKD-DGK-AAESINRKASGN-WKAWFNKSLNLKI  134

Query  280  MSH  272
             SH
Sbjct  135  SSH  137



>ref|XP_010552701.1| PREDICTED: uncharacterized protein At4g22758 [Tarenaya hassleriana]
Length=142

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 48/89 (54%), Gaps = 9/89 (10%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEK-ATSGDGKQ  359
            GS F    LY   C      V    AL PW+TIGSLG RNF+LC+KP E+K    GD + 
Sbjct  62   GSDFNDFLLY---CP-----VAGPEALRPWNTIGSLGARNFMLCRKPEEKKLGDGGDRRP  113

Query  358  AAEAVAARKSGSIWKTLFNKSLNAKVMSH  272
             +     RK G  WKT  NKS + K+ SH
Sbjct  114  NSTINGGRKGGGSWKTWINKSFSLKIPSH  142



>ref|XP_009600493.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
tomentosiformis]
 ref|XP_009757100.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
sylvestris]
Length=136

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = -1

Query  457  LSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKVM  278
            LSPW+TIGS+GVRNFVL KKP  E A   DGKQAA    ARK  + WK  FNKSL  K++
Sbjct  79   LSPWETIGSVGVRNFVLFKKPQAENAIL-DGKQAA---MARKRAASWKAWFNKSLTRKIV  134

Query  277  SH  272
            S+
Sbjct  135  SY  136



>ref|XP_004504564.1| PREDICTED: uncharacterized protein LOC101507525 [Cicer arietinum]
Length=137

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            AL PWDTIGS G RNF+LCKKP   +A+  DG        +R+ G  WK  FNKSLN K+
Sbjct  78   ALRPWDTIGSHGARNFMLCKKP---QASDADGAGNETTTISRRGGGSWKAWFNKSLNLKI  134

Query  280  MSH  272
             +H
Sbjct  135  STH  137



>ref|XP_006355080.1| PREDICTED: uncharacterized protein LOC102584968 [Solanum tuberosum]
Length=143

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 51/94 (54%), Gaps = 17/94 (18%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEE------KATS  374
            GS F    LY    ++ D        LSPW+TIGSLGVRNFVL KKP  E      K   
Sbjct  61   GSNFNNFVLYCPTVVTED--------LSPWETIGSLGVRNFVLVKKPQSENPILDAKQPI  112

Query  373  GDGKQAAEAVAARKSGSIWKTLFNKSLNAKVMSH  272
             DGKQ    V ARK    WK  FNKSL+ K++S+
Sbjct  113  LDGKQ---VVMARKGSGSWKAWFNKSLSRKIVSY  143



>ref|XP_004236949.1| PREDICTED: uncharacterized protein LOC101244859 [Solanum lycopersicum]
Length=144

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 51/93 (55%), Gaps = 14/93 (15%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQ-  359
            GS F    LY    ++ D        LSPW+TIGSLGVRNFVL KKP  E     +GKQ 
Sbjct  61   GSNFNNFVLYCPTAVTED--------LSPWETIGSLGVRNFVLVKKPQSENPIL-NGKQQ  111

Query  358  ----AAEAVAARKSGSIWKTLFNKSLNAKVMSH  272
                  + V ARK    WK  FNKSL+ K++S+
Sbjct  112  RILDGKQVVMARKGSGSWKAWFNKSLSRKIVSY  144



>gb|KJB50372.1| hypothetical protein B456_008G167200 [Gossypium raimondii]
Length=138

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 53/88 (60%), Gaps = 11/88 (13%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS  +  FLY   C S  +      AL+PW+TIGS G RNF+LC+KP+ EK    D  ++
Sbjct  61   GSAISGFFLY---CPSAGSD-----ALNPWETIGSQGARNFILCRKPSNEKME--DDGRS  110

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMSH  272
            A +V  + SG+ WK   NKSLN K+ SH
Sbjct  111  ANSVTGKGSGN-WKAWINKSLNLKISSH  137



>gb|KHG22133.1| hypothetical protein F383_27486 [Gossypium arboreum]
Length=138

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 11/88 (13%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS  +  FLY   C S  +      AL+PW+TIGS G RNF+LC+KP+ EK    D  ++
Sbjct  61   GSAISDFFLY---CPSAGSD-----ALNPWETIGSQGARNFILCRKPSNEKME--DDGRS  110

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMSH  272
            A ++  + SG+ WK   NKSLN K+ SH
Sbjct  111  ANSITGKGSGN-WKAWINKSLNLKISSH  137



>ref|NP_565000.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD55493.1|AC008148_3 Unknown protein [Arabidopsis thaliana]
 gb|AAG40399.1|AF325047_1 At1g70780 [Arabidopsis thaliana]
 gb|AAG52330.1|AC011663_9 unknown protein; 8615-9128 [Arabidopsis thaliana]
 gb|AAK83590.1| At1g70780/F5A18_4 [Arabidopsis thaliana]
 gb|AAN31119.1| At1g70780/F5A18_4 [Arabidopsis thaliana]
 gb|AEE35114.1| uncharacterized protein AT1G70780 [Arabidopsis thaliana]
Length=140

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 48/88 (55%), Gaps = 9/88 (10%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS F    LY  +        V   ALS WD IGSLG RNF+LC+KP E+K    +G+  
Sbjct  62   GSDFNDFLLYCPM--------VGPEALSTWDAIGSLGARNFMLCRKPEEKKVEESNGRSD  113

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMSH  272
            +    ARK GS+ K   NKS N KV SH
Sbjct  114  STINGARKGGSL-KAWINKSFNLKVSSH  140



>gb|KDP38078.1| hypothetical protein JCGZ_04721 [Jatropha curcas]
Length=138

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+TIGSLG RNF+LCKKP ++   + D +  A A+  + SGS WK+  NKSLN K+
Sbjct  78   ALSPWETIGSLGSRNFMLCKKPQQQVKAAEDPRPNA-AITRKGSGS-WKSWINKSLNLKI  135

Query  280  MSH  272
             SH
Sbjct  136  SSH  138



>gb|KHN12462.1| hypothetical protein glysoja_018592 [Glycine soja]
Length=151

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = -1

Query  463  VALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAK  284
            VALSPWD IGS GVRNF+LCKKP  E     DG  +  + ++R  GS WK  FNKSLN K
Sbjct  91   VALSPWDRIGSHGVRNFMLCKKP--EGVADADGDASGISRSSRGIGS-WKAWFNKSLNLK  147

Query  283  VMSH  272
            + +H
Sbjct  148  ISTH  151



>ref|XP_006364850.1| PREDICTED: uncharacterized protein LOC102578189 [Solanum tuberosum]
Length=136

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 51/88 (58%), Gaps = 12/88 (14%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS F+   LY   C S         AL PW+TIGSLGVRNF+L KK ++ + T  DGKQ+
Sbjct  61   GSDFSNFVLY---CPSAGT-----EALGPWETIGSLGVRNFMLFKKSSQGENTVDDGKQS  112

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMSH  272
                  RK    WKT FNKS++ K+ SH
Sbjct  113  ----PIRKGAGSWKTWFNKSISRKIASH  136



>ref|XP_002527797.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34607.1| conserved hypothetical protein [Ricinus communis]
Length=138

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 50/88 (57%), Gaps = 11/88 (13%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS     FLY   C +  +      ALSPW+TIGS G RNF+LCKKP   K    DG + 
Sbjct  62   GSDLNDFFLY---CANAGS-----EALSPWETIGSFGFRNFMLCKKPQPVKVD--DGARP  111

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMSH  272
              A+  + SGS WK+  NKSLN K+ SH
Sbjct  112  HAAITQKGSGS-WKSWINKSLNLKISSH  138



>ref|XP_004237906.1| PREDICTED: uncharacterized protein At4g22758-like [Solanum lycopersicum]
Length=155

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 12/88 (14%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS F+   LY   C S         AL PW+TIGSLGVRNF+L KK ++ + T+  GKQ+
Sbjct  80   GSDFSNFVLY---CPSAGT-----EALGPWETIGSLGVRNFMLFKKSSQGEKTADGGKQS  131

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMSH  272
                  RK    WKT FNKS+++K+ SH
Sbjct  132  ----PIRKGAGSWKTWFNKSISSKIASH  155



>ref|XP_011070610.1| PREDICTED: uncharacterized protein At4g22758-like [Sesamum indicum]
Length=136

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+TIGS GVRNF+LCKKP  E +      + + A++ + SGS WK  F+KSLN K+
Sbjct  78   ALSPWETIGSAGVRNFMLCKKPQTENSIDS---EKSSAISRKGSGS-WKAWFHKSLNLKI  133

Query  280  MSH  272
             SH
Sbjct  134  SSH  136



>gb|EYU30083.1| hypothetical protein MIMGU_mgv1a016062mg [Erythranthe guttata]
Length=136

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 4/63 (6%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+TIGS+GVRNF+LCKKP     T+ D  +  ++  +RK    W+  F+KSL+ K+
Sbjct  78   ALSPWETIGSVGVRNFMLCKKP----QTTEDSDEVEKSAMSRKGSGSWRAWFHKSLSLKI  133

Query  280  MSH  272
             SH
Sbjct  134  SSH  136



>ref|XP_010415767.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
 ref|XP_010427868.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
Length=140

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 48/88 (55%), Gaps = 9/88 (10%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS F    LY  +        V   ALS W+ IGSLG RNF+LC+KP E+K    +G+  
Sbjct  62   GSDFNDFLLYCPM--------VGPEALSTWNAIGSLGARNFMLCRKPEEKKVEETNGRAN  113

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMSH  272
            +    ARK GS+ K   NKS N KV SH
Sbjct  114  STINGARKGGSL-KAWLNKSFNLKVPSH  140



>ref|XP_007153400.1| hypothetical protein PHAVU_003G031800g [Phaseolus vulgaris]
 gb|ESW25394.1| hypothetical protein PHAVU_003G031800g [Phaseolus vulgaris]
Length=138

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAE-EKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAK  284
            AL PWDTIGS G RNF LC+K A  ++A   DG     A+  R SG+ W++ FNKSLN K
Sbjct  76   ALRPWDTIGSHGARNFTLCRKAANADEAAVDDGSGPTAALPRRGSGT-WRSWFNKSLNLK  134

Query  283  VMSH  272
            + SH
Sbjct  135  ISSH  138



>ref|XP_002888795.1| hypothetical protein ARALYDRAFT_894896 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65054.1| hypothetical protein ARALYDRAFT_894896 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 48/88 (55%), Gaps = 9/88 (10%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS F    LY  +        V   AL+ W+ IGSLG RNF+LC+KP E+K    +G+  
Sbjct  62   GSDFNDFLLYCPM--------VGPEALTTWNAIGSLGARNFMLCRKPEEKKVEESNGRSN  113

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMSH  272
            +    ARK GS+ K   NKS N KV SH
Sbjct  114  SNINGARKGGSL-KAWINKSFNLKVPSH  140



>ref|XP_004498287.1| PREDICTED: uncharacterized protein LOC101497295 [Cicer arietinum]
Length=140

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = -1

Query  457  LSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKVM  278
            LSPWD IGS G RNFVLCK P +    + DG     +++ R SGS W+  FNKSLN KV 
Sbjct  81   LSPWDKIGSHGARNFVLCKNP-QATNEAADGGSGTTSLSRRGSGS-WRAWFNKSLNLKVS  138

Query  277  SH  272
            SH
Sbjct  139  SH  140



>ref|NP_001236734.1| uncharacterized protein LOC100305791 [Glycine max]
 gb|ACU13651.1| unknown [Glycine max]
Length=137

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPWD IGS GVRNF+LCKKP  E     DG  +  + ++R  GS WK  FNKSLN K+
Sbjct  78   ALSPWDRIGSHGVRNFMLCKKP--EGVADVDGDASGISRSSRGIGS-WKAWFNKSLNLKI  134

Query  280  MSH  272
             +H
Sbjct  135  STH  137



>ref|XP_004297386.1| PREDICTED: uncharacterized protein At4g22758 [Fragaria vesca 
subsp. vesca]
Length=138

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPWDTIGS G RNF+LCKKP   K    D +  A  ++ + SGS WK   NKSLN K+
Sbjct  79   ALSPWDTIGSQGSRNFMLCKKPQPVKMV--DAEIPAATISRKGSGS-WKAWINKSLNLKI  135

Query  280  MSH  272
             SH
Sbjct  136  SSH  138



>ref|XP_008221421.1| PREDICTED: uncharacterized protein LOC103321407 [Prunus mume]
Length=138

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPWDTIG+ G RNF+LCKKP   K    D  +   A   RK    WK   NKSLN K+
Sbjct  79   ALSPWDTIGAQGARNFMLCKKPQPVKM---DSDEIPAAAITRKGSGSWKAWINKSLNLKI  135

Query  280  MSH  272
             SH
Sbjct  136  SSH  138



>ref|XP_007223777.1| hypothetical protein PRUPE_ppa013143mg [Prunus persica]
 gb|EMJ24976.1| hypothetical protein PRUPE_ppa013143mg [Prunus persica]
Length=138

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPWDTIG+ G RNF+LCKKP   K    D  +   A   RK    WK   NKSLN K+
Sbjct  79   ALSPWDTIGAQGARNFMLCKKPQPVKM---DSDEIPAAAITRKGSGSWKAWINKSLNLKI  135

Query  280  MSH  272
             SH
Sbjct  136  SSH  138



>ref|XP_002890566.1| hypothetical protein ARALYDRAFT_889841 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66825.1| hypothetical protein ARALYDRAFT_889841 [Arabidopsis lyrata subsp. 
lyrata]
Length=141

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = -1

Query  475  VVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARK-SGSIWKTLFNK  299
            +V   ALSPW+ IGS+GVRNF+LCKKP E+K    +G+       ARK SG  +K   NK
Sbjct  73   MVGPAALSPWEAIGSVGVRNFMLCKKPEEKKVEGDNGRSNFPNNGARKGSGGSFKAWINK  132

Query  298  SLNAKVMSH  272
            S + KV +H
Sbjct  133  SFSLKVTTH  141



>ref|XP_010471079.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
Length=140

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 47/88 (53%), Gaps = 9/88 (10%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS F    LY  +        V   ALS W+ IGSLG RNF+LC+KP E+K    +G+  
Sbjct  62   GSDFNDFLLYCPM--------VGPEALSTWNAIGSLGARNFMLCRKPEEKKVEETNGRAN  113

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMSH  272
            +     RK GS+ K   NKS N KV SH
Sbjct  114  STINGTRKGGSL-KAWLNKSFNLKVPSH  140



>ref|XP_010044204.1| PREDICTED: uncharacterized protein At4g22758 [Eucalyptus grandis]
 gb|KCW86246.1| hypothetical protein EUGRSUZ_B02935 [Eucalyptus grandis]
Length=138

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPWD IGS G RNF+LCKKP  +     D +++ +A  ARK    WK+  NKS + KV
Sbjct  78   ALSPWDMIGSPGARNFLLCKKPKTD--VVADDRRSPDAGIARKGNGSWKSWINKSFSLKV  135

Query  280  MSH  272
             SH
Sbjct  136  SSH  138



>ref|XP_010670141.1| PREDICTED: uncharacterized protein At4g22758-like [Beta vulgaris 
subsp. vulgaris]
Length=160

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 4/63 (6%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPWD IGS G RNFVLCKKP ++   +    ++   + +RK  + WK+ FNKSL+ K+
Sbjct  102  ALSPWDEIGSCGSRNFVLCKKPEQQPNMT----ESRSHLISRKRSANWKSWFNKSLSFKI  157

Query  280  MSH  272
             SH
Sbjct  158  SSH  160



>ref|XP_009351504.1| PREDICTED: uncharacterized protein At4g22758-like [Pyrus x bretschneideri]
Length=138

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPWDTIG+ G RNF+LCKKP   K    +    A A+  + SGS WK   NKSLN KV
Sbjct  79   ALSPWDTIGAQGARNFMLCKKPQPVKMEKDE--IPAAAITRKGSGS-WKAWINKSLNLKV  135

Query  280  MSH  272
             SH
Sbjct  136  SSH  138



>ref|XP_009349522.1| PREDICTED: uncharacterized protein At4g22758-like [Pyrus x bretschneideri]
Length=138

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPWDTIG+ G RNF+LCKKP   K    +    A A+  + SGS WK   NKSLN KV
Sbjct  79   ALSPWDTIGAQGARNFMLCKKPQPVKMEKDE--IPAAAITRKGSGS-WKAWINKSLNLKV  135

Query  280  MSH  272
             SH
Sbjct  136  SSH  138



>ref|XP_002311509.2| hypothetical protein POPTR_0008s13080g [Populus trichocarpa]
 gb|EEE88876.2| hypothetical protein POPTR_0008s13080g [Populus trichocarpa]
Length=146

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            A+SPW+TIGSLG RNF+LCKKP   KA   DG+  A       SGS WK   NKSLN K+
Sbjct  78   AISPWETIGSLGARNFMLCKKPQHLKAAD-DGRSTAAFAQKGGSGS-WKAWINKSLNLKI  135



>ref|XP_002284639.1| PREDICTED: uncharacterized protein At4g22758 [Vitis vinifera]
 emb|CBI26875.3| unnamed protein product [Vitis vinifera]
Length=139

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+TIGS G RNF+LCKKP  +  T   G +    +  + SGS WK   NKSLN K+
Sbjct  79   ALSPWETIGSNGTRNFMLCKKPQPQNTTE-VGVEGRAGMPRKGSGS-WKAWINKSLNLKI  136

Query  280  MSH  272
             SH
Sbjct  137  SSH  139



>gb|KFK22025.1| hypothetical protein AALP_AAs45940U000100 [Arabis alpina]
Length=139

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+ IGSLG RNF+LCKKP E+K    +G+       ARK    +K   NKS + KV
Sbjct  79   ALSPWEAIGSLGARNFMLCKKPVEKKVEENNGRSGFTINGARKGS--FKAWINKSFSLKV  136

Query  280  MSH  272
             +H
Sbjct  137  TTH  139



>emb|CDX68330.1| BnaA07g23700D [Brassica napus]
Length=142

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 49/90 (54%), Gaps = 11/90 (12%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKAT-SGDGKQ  359
            GS F    LY  +        V   ALS W  IGSLG RNF LC+KP E+K    G+G+ 
Sbjct  62   GSDFNDFLLYCPM--------VGPEALSAWSAIGSLGARNFTLCRKPEEKKVVKEGEGEG  113

Query  358  AAEAV-AARKSGSIWKTLFNKSLNAKVMSH  272
             + ++  ARK GS+ K   NKS N KV SH
Sbjct  114  RSNSINGARKGGSL-KAWINKSFNLKVSSH  142



>ref|XP_009104937.1| PREDICTED: uncharacterized protein At4g22758-like [Brassica rapa]
Length=142

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 49/90 (54%), Gaps = 11/90 (12%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKAT-SGDGKQ  359
            GS F    LY  +        V   ALS W  IGSLG RNF LC+KP E+K    G+G+ 
Sbjct  62   GSDFNDFLLYCPM--------VGPEALSAWSAIGSLGARNFTLCRKPEEKKVVKEGEGEG  113

Query  358  AAEAV-AARKSGSIWKTLFNKSLNAKVMSH  272
             + ++  ARK GS+ K   NKS N KV SH
Sbjct  114  RSNSINGARKGGSL-KAWINKSFNLKVSSH  142



>ref|XP_011023710.1| PREDICTED: uncharacterized protein At4g22758-like [Populus euphratica]
Length=138

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            A+SPW+TIGSLG RNF+LCKKP   KA   DG+  +       SGS WK   NKSLN K+
Sbjct  78   AISPWETIGSLGARNFMLCKKPQHLKAVD-DGRSTSAFSMKGGSGS-WKAWINKSLNLKI  135



>ref|XP_003589658.1| hypothetical protein MTR_1g031680 [Medicago truncatula]
 ref|XP_003609749.1| hypothetical protein MTR_4g121810 [Medicago truncatula]
 gb|ABD32641.1| Senescence-associated protein, putative [Medicago truncatula]
 gb|AES59909.1| senescence-associated protein, putative [Medicago truncatula]
 gb|AFK43979.1| unknown [Medicago truncatula]
Length=141

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 51/90 (57%), Gaps = 13/90 (14%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKP--AEEKATSGDGK  362
            G+  +  FLY   C  + +      ALSPWD IGS G RNFVLCKKP  A  +A + DG 
Sbjct  63   GNDHSAFFLY---CPHLGSDA----ALSPWDKIGSHGARNFVLCKKPQAATNEAAAEDG-  114

Query  361  QAAEAVAARKSGSIWKTLFNKSLNAKVMSH  272
                ++  R SGS WK+ FN  LN KV SH
Sbjct  115  SGTSSLPRRGSGS-WKSWFN--LNLKVSSH  141



>ref|XP_006448227.1| hypothetical protein CICLE_v10017117mg [Citrus clementina]
 gb|ESR61467.1| hypothetical protein CICLE_v10017117mg [Citrus clementina]
Length=139

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGS-IWKTLFNKSLNAK  284
            ALSPWDTIG  G+RNF+LCKK   EK T+ +G+    A+A R SGS  WK   NKSL  K
Sbjct  78   ALSPWDTIGRHGMRNFLLCKKQQTEK-TAENGR-LDNAIARRGSGSGSWKAWINKSLMFK  135

Query  283  VMSH  272
            + SH
Sbjct  136  IPSH  139



>ref|XP_006469193.1| PREDICTED: uncharacterized protein LOC102613615 [Citrus sinensis]
 gb|KDO64605.1| hypothetical protein CISIN_1g032525mg [Citrus sinensis]
Length=139

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGS-IWKTLFNKSLNAK  284
            ALSPWDTIG  G+RNF+LCKK   EK T+ +G+    A+A R SGS  WK   NKSL  K
Sbjct  78   ALSPWDTIGRHGMRNFLLCKKQQTEK-TAENGR-LDNAIARRGSGSGSWKAWINKSLMFK  135

Query  283  VMSH  272
            + SH
Sbjct  136  IPSH  139



>dbj|BAB33412.1| putative senescence-associated protein [Pisum sativum]
Length=221

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 5/65 (8%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGD--GKQAAEAVAARKSGSIWKTLFNKSLNA  287
            ALSPWDTIGS+G RNF+LCKKP   +AT+GD         V +R  G   K  F++SLN 
Sbjct  115  ALSPWDTIGSVGARNFMLCKKP---QATTGDEAANGTGTEVVSRSRGGSGKAWFHQSLNL  171

Query  286  KVMSH  272
            K+  H
Sbjct  172  KISIH  176



>ref|XP_007047987.1| Uncharacterized protein TCM_001138 [Theobroma cacao]
 gb|EOX92144.1| Uncharacterized protein TCM_001138 [Theobroma cacao]
Length=228

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+T+ S G RNF LCKKP  EK    DG+ + +A+   + G+ WK   NK LN K+
Sbjct  168  ALSPWETVISQGARNFKLCKKPRTEKMDD-DGRSSTQAITTNEDGN-WKAWINKFLNLKI  225

Query  280  MSH  272
             SH
Sbjct  226  SSH  228



>ref|XP_006390840.1| hypothetical protein EUTSA_v10019542mg [Eutrema salsugineum]
 dbj|BAJ34604.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ28126.1| hypothetical protein EUTSA_v10019542mg [Eutrema salsugineum]
Length=141

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 46/88 (52%), Gaps = 8/88 (9%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS F    LY  +        V   ALS W+ IGSLG RNF+LC+KP E+K  + +G+ +
Sbjct  62   GSDFNDFLLYCPM--------VGPEALSTWNAIGSLGARNFMLCRKPEEKKKEATNGRSS  113

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMSH  272
            +      + G   K   NKS + KV SH
Sbjct  114  STINGGARKGGSLKAWINKSFSLKVPSH  141



>emb|CBI33520.3| unnamed protein product [Vitis vinifera]
Length=145

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 5/63 (8%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+ IGS G RNFVLCKK  E +      ++    +  RK    WKT  NKS N K+
Sbjct  88   ALSPWELIGSCGGRNFVLCKKQIEPQM-----RETRPEMLGRKGSGSWKTWLNKSFNFKI  142

Query  280  MSH  272
            +SH
Sbjct  143  LSH  145



>gb|AFK44881.1| unknown [Lotus japonicus]
Length=138

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAA-EAVAARKSGSIWKTLFNKSLNAK  284
            ALSPWD IGS G RNF+LCKKP   + + G  + A    +  R+S   WK  FNKSL+ K
Sbjct  78   ALSPWDRIGSHGARNFMLCKKP---QGSPGVAEFAGTTPLPRRRSSGSWKAWFNKSLSLK  134

Query  283  VMSH  272
            + SH
Sbjct  135  ISSH  138



>ref|XP_002270144.3| PREDICTED: uncharacterized protein At4g22758 [Vitis vinifera]
 ref|XP_010660315.1| PREDICTED: uncharacterized protein At4g22758 [Vitis vinifera]
Length=149

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 5/63 (8%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+ IGS G RNFVLCKK  E +      ++    +  RK    WKT  NKS N K+
Sbjct  92   ALSPWELIGSCGGRNFVLCKKQIEPQM-----RETRPEMLGRKGSGSWKTWLNKSFNFKI  146

Query  280  MSH  272
            +SH
Sbjct  147  LSH  149



>ref|XP_011038615.1| PREDICTED: uncharacterized protein At4g22758-like [Populus euphratica]
Length=133

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNK  299
            A+SPW+TIGSLG RNF+LCKKP   K    DG+  A A++ + SGS WK   NK
Sbjct  78   AISPWETIGSLGARNFMLCKKPQHLKVAEKDGRSNA-AISQKGSGS-WKAWINK  129



>ref|XP_002315875.1| hypothetical protein POPTR_0010s12090g [Populus trichocarpa]
 gb|EEF02046.1| hypothetical protein POPTR_0010s12090g [Populus trichocarpa]
Length=133

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNK  299
            A+SPW+TIGSLG RNF+LCKKP   K    DG+  A A++ + SGS WK   NK
Sbjct  78   AISPWETIGSLGARNFMLCKKPQHLKVAEKDGRSNA-AISQKGSGS-WKAWINK  129



>gb|EPS61325.1| hypothetical protein M569_13473, partial [Genlisea aurea]
Length=167

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 9/63 (14%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            AL+PW+TIGS GVRNF+L KKP  E + SG          +RKS   WK+ FNKS++ K+
Sbjct  114  ALNPWETIGSSGVRNFMLFKKPVTENSISGQK-------PSRKSS--WKSWFNKSISRKI  164

Query  280  MSH  272
             SH
Sbjct  165  SSH  167



>gb|KCW64559.1| hypothetical protein EUGRSUZ_G02164 [Eucalyptus grandis]
Length=112

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 5/63 (8%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+TIGS G RNF+L KK   E+A  G     +   A  + GS WK   NKSLN K+
Sbjct  55   ALSPWETIGSQGARNFLLWKKQKAEEADEG-----SPPSAIGRKGSGWKAWINKSLNLKI  109

Query  280  MSH  272
             SH
Sbjct  110  PSH  112



>ref|XP_010274728.1| PREDICTED: uncharacterized protein At4g22758 [Nelumbo nucifera]
Length=146

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 42/74 (57%), Gaps = 14/74 (19%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKK-----------PAEEKATSGDGKQAAEAVAARKSGSIWK  314
            ALSPW+TIGS G RNFVLCKK             + + T+GDG+     + ARK    WK
Sbjct  76   ALSPWETIGSRGGRNFVLCKKPQAQPQQPQQPQPQLQTTNGDGQL---TMIARKGSGSWK  132

Query  313  TLFNKSLNAKVMSH  272
               NKSLN K+ SH
Sbjct  133  AWLNKSLNLKISSH  146



>gb|AAL16139.1|AF428307_1 At1g70780/F5A18_4 [Arabidopsis thaliana]
Length=149

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 40/72 (56%), Gaps = 8/72 (11%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS F    LY   C      +V   ALS WD IGSLG RNF+LC+KP E+K    +G+  
Sbjct  62   GSDFNDFLLY---CP-----MVGPEALSTWDAIGSLGARNFMLCRKPEEKKVEESNGRSD  113

Query  355  AEAVAARKSGSI  320
            +    ARK GSI
Sbjct  114  STINGARKGGSI  125



>ref|XP_010066603.1| PREDICTED: uncharacterized protein LOC104453692 [Eucalyptus grandis]
Length=140

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 5/63 (8%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+TIGS G RNF+L KK   E+A  G     +   A  + GS WK   NKSLN K+
Sbjct  83   ALSPWETIGSQGARNFLLWKKQKAEEADEG-----SPPSAIGRKGSGWKAWINKSLNLKI  137

Query  280  MSH  272
             SH
Sbjct  138  PSH  140



>ref|XP_010553810.1| PREDICTED: uncharacterized protein LOC104823786 [Tarenaya hassleriana]
Length=140

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 35/63 (56%), Gaps = 2/63 (3%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            AL PW+ IG  G RNF+LCKKP  E    G+ K +   V  RK+   WK   NKSL   +
Sbjct  80   ALKPWEMIGVTGSRNFILCKKP--ETGEVGESKSSTPLVTNRKTSGSWKAWLNKSLALMI  137

Query  280  MSH  272
             SH
Sbjct  138  PSH  140



>ref|XP_006301002.1| hypothetical protein CARUB_v10021392mg [Capsella rubella]
 gb|EOA33900.1| hypothetical protein CARUB_v10021392mg [Capsella rubella]
Length=137

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 46/88 (52%), Gaps = 12/88 (14%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS F    LY  +        V   AL+ W+ IGSLG RNF+LC+KP E+K    +    
Sbjct  62   GSDFNDFLLYCPM--------VGPEALNTWNAIGSLGARNFMLCRKPDEKKVEEANN---  110

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMSH  272
            +    ARK GS+ K   NKS N KV SH
Sbjct  111  STINGARKGGSL-KAWLNKSFNLKVSSH  137



>ref|XP_011099466.1| PREDICTED: uncharacterized protein At4g22758-like [Sesamum indicum]
Length=151

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 49/99 (49%), Gaps = 17/99 (17%)
 Frame = -1

Query  535  GSIFTTLFLYF-----------VLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAE  389
            G I TTL +Y            + C  I  +   F AL PW+ IGS GVRNF+LCK  ++
Sbjct  59   GVIQTTLKIYAREGRLPVLGSDINCFVIYPVNAGFDALKPWEAIGSRGVRNFLLCKNQSK  118

Query  388  EKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKVMSH  272
               T     +A   VA RK G  W+T    SL  K++SH
Sbjct  119  PNMT-----EARSQVADRK-GRGWRTWLQNSLTLKILSH  151



>ref|NP_001236932.1| uncharacterized protein LOC100499853 [Glycine max]
 gb|ACU13908.1| unknown [Glycine max]
Length=135

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+ IGS GVRNFVL KKP  E     DG  A  + ++  SGS WK  FNKSLN K+
Sbjct  77   ALSPWERIGSHGVRNFVLFKKP--EGVADVDGSTAL-SRSSTGSGS-WKAWFNKSLNLKI  132

Query  280  MSH  272
             +H
Sbjct  133  STH  135



>gb|ACJ84118.1| unknown [Medicago truncatula]
Length=141

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 50/90 (56%), Gaps = 13/90 (14%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKP--AEEKATSGDGK  362
            G+  +  FLY   C  + +      ALSPWD IGS G RNFVL KKP  A  +A + DG 
Sbjct  63   GNDHSAFFLY---CPHLGSDA----ALSPWDKIGSHGARNFVLYKKPQAATNEAAAEDG-  114

Query  361  QAAEAVAARKSGSIWKTLFNKSLNAKVMSH  272
                ++  R SGS WK+ FN  LN KV SH
Sbjct  115  SGTSSLPRRGSGS-WKSWFN--LNLKVSSH  141



>ref|XP_010264360.1| PREDICTED: uncharacterized protein At4g22758-like [Nelumbo nucifera]
Length=137

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 8/64 (13%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEE-KATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAK  284
            ALS W+TIGS G RNFVL KKP  + +AT G+       + ARK  S WK   ++SLN K
Sbjct  81   ALSHWETIGSRGGRNFVLFKKPQRQLEATKGN-------IIARKGSSRWKAWLHRSLNLK  133

Query  283  VMSH  272
            + SH
Sbjct  134  ISSH  137



>ref|XP_008356300.1| PREDICTED: uncharacterized protein LOC103420001 [Malus domestica]
Length=138

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALS WD IG+ G RNF+LCKKP   K    +    A A+  + SGS WK   NKSLN KV
Sbjct  79   ALSLWDXIGAQGARNFMLCKKPQPVKMEKDE--IPAAAITRKGSGS-WKAWINKSLNLKV  135

Query  280  MSH  272
             SH
Sbjct  136  SSH  138



>gb|ABK96329.1| unknown [Populus trichocarpa x Populus deltoides]
Length=133

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNK  299
            A+SPW+TIGSLG R F+LCKKP   K    DG+  A A++ + SGS WK   NK
Sbjct  78   AISPWETIGSLGARKFMLCKKPQHLKVAEKDGRSNA-AISQKGSGS-WKAWINK  129



>ref|XP_007033029.1| Uncharacterized protein TCM_019175 [Theobroma cacao]
 gb|EOY03955.1| Uncharacterized protein TCM_019175 [Theobroma cacao]
Length=148

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 6/63 (10%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+ IGS G RNFVLCKK  + + T     +A   + A+K GS WK   NKS + K+
Sbjct  92   ALSPWEKIGSQGRRNFVLCKKQVQPQMT-----EARSEIIAQK-GSGWKAWLNKSFSFKI  145

Query  280  MSH  272
            +SH
Sbjct  146  LSH  148



>ref|XP_007153591.1| hypothetical protein PHAVU_003G048500g [Phaseolus vulgaris]
 gb|ESW25585.1| hypothetical protein PHAVU_003G048500g [Phaseolus vulgaris]
Length=147

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 46/91 (51%), Gaps = 14/91 (15%)
 Frame = -1

Query  523  TTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAE-------EKATSGDG  365
            TT F  +   ++ D       ALSPW+ IGS GVRNF+LCKK AE       E+  S  G
Sbjct  64   TTGFALYCPHLASD-------ALSPWERIGSHGVRNFMLCKKEAESDSRGVAEEDGSESG  116

Query  364  KQAAEAVAARKSGSIWKTLFNKSLNAKVMSH  272
                +  ++ +    WK  FN SLN K+ S 
Sbjct  117  NSNGKHSSSSRGNGSWKGWFNISLNLKISSQ  147



>ref|XP_002534031.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28351.1| conserved hypothetical protein [Ricinus communis]
Length=152

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 6/63 (10%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            AL+PW+ IGS G RNFVLCKK  E + T G     +E  A + SG  WK   +KS + KV
Sbjct  96   ALNPWEAIGSHGGRNFVLCKKQREAQMTEG----RSEMTAHKASG--WKAWLHKSFSFKV  149

Query  280  MSH  272
            +SH
Sbjct  150  LSH  152



>ref|XP_007045196.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOY01028.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
Length=145

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS      LY   C   D   ++  ALSPW+TIGS G RNF+LCKKP  EK    DG+  
Sbjct  56   GSDLNDFHLY-CPCAGSDGRFIQIHALSPWETIGSQGARNFMLCKKPKTEKMED-DGRST  113

Query  355  AEAVAARKSGSIWK  314
              A+  + SG+ WK
Sbjct  114  G-AITRKGSGN-WK  125



>ref|XP_010681883.1| PREDICTED: uncharacterized protein LOC104896789 [Beta vulgaris 
subsp. vulgaris]
Length=138

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSP  TIG  G RNF+LC+KP  ++A + + K  AEA   R+    WK+  NK+L  K+
Sbjct  78   ALSPLQTIGVHGARNFLLCRKPQPQEAANVEVK--AEAAITRRGNGSWKSWINKTLILKI  135

Query  280  MSH  272
             SH
Sbjct  136  ASH  138



>ref|XP_007163388.1| hypothetical protein PHAVU_001G230600g [Phaseolus vulgaris]
 gb|ESW35382.1| hypothetical protein PHAVU_001G230600g [Phaseolus vulgaris]
Length=147

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 40/65 (62%), Gaps = 5/65 (8%)
 Frame = -1

Query  466  FVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNA  287
            F ALSP + IGS GVRNFVLCKK    +  S +    +E V+ + SG  WK   NKSL  
Sbjct  88   FDALSPLEPIGSFGVRNFVLCKK----QVYSSNTAPQSELVSQKSSGG-WKAWLNKSLGL  142

Query  286  KVMSH  272
            K+++H
Sbjct  143  KILTH  147



>emb|CDY71620.1| BnaC05g50380D [Brassica napus]
Length=138

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGD-GKQAAEAVAARKSGSIWKTLFNKSLNAK  284
            ALSPW+ IGSLG RNF+LC+KP E+K    + G+ +     ARK    ++   NKS + K
Sbjct  77   ALSPWEAIGSLGARNFMLCEKPGEKKKVEEENGRSSFPINGARKRS--FRAWINKSFSLK  134

Query  283  VMSH  272
            V +H
Sbjct  135  VTTH  138



>emb|CDY23481.1| BnaC06g24500D [Brassica napus]
Length=140

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 37/64 (58%), Gaps = 3/64 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKAT-SGDGKQAAEAVAARKSGSIWKTLFNKSLNAK  284
            ALS W  IGSLG RNF LC+KP + K    GDGK  + ++   K G   K   NKS + K
Sbjct  79   ALSAWSAIGSLGARNFTLCRKPEDTKVVKEGDGK--SNSINGAKKGGSLKAWINKSFSLK  136

Query  283  VMSH  272
            V SH
Sbjct  137  VSSH  140



>gb|KHN46081.1| Hypothetical protein glysoja_030082 [Glycine soja]
Length=133

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 36/63 (57%), Gaps = 4/63 (6%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+ IGS GVRNFVL KKP  E     DG  A    +       WK  FNKSLN K+
Sbjct  75   ALSPWERIGSHGVRNFVLFKKP--EGVADVDGSTALSRSSRGS--GSWKAWFNKSLNLKI  130

Query  280  MSH  272
             +H
Sbjct  131  STH  133



>ref|XP_008782287.1| PREDICTED: uncharacterized protein LOC103701859 [Phoenix dactylifera]
Length=147

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 7/63 (11%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW++I S G RNFVLCKK        G   + A  V  RK    W+T  NKSL+ ++
Sbjct  92   ALSPWESIDSRGTRNFVLCKK-------EGVVDERASQVLGRKGSGSWRTWLNKSLSFRI  144

Query  280  MSH  272
             SH
Sbjct  145  SSH  147



>ref|XP_009334449.1| PREDICTED: uncharacterized protein At4g22758-like [Pyrus x bretschneideri]
Length=152

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+TIGS G RNFVL KK  +++  +   ++ +E  A + + S WK  FNKS   K+
Sbjct  92   ALSPWETIGSRGGRNFVLSKK--QKQVQNNIAERKSEITAPKGTVSSWKAWFNKSFTFKI  149

Query  280  MSH  272
             SH
Sbjct  150  SSH  152



>ref|XP_010667680.1| PREDICTED: uncharacterized protein LOC104884693 [Beta vulgaris 
subsp. vulgaris]
Length=169

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 4/60 (7%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPWD IGS G R+FVLCKKP +    +    +A   + ++K G  W+   NKSL+ K+
Sbjct  114  ALSPWDEIGSCGGRSFVLCKKPEQPTNMT----EARSQMISQKRGGSWRAWLNKSLSLKI  169



>ref|XP_010926482.1| PREDICTED: uncharacterized protein LOC105048744 [Elaeis guineensis]
Length=147

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 36/63 (57%), Gaps = 7/63 (11%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW++I S G RNFVLCKK        G   + A  +  RK    W+T  NKSL+ ++
Sbjct  92   ALSPWESIDSRGKRNFVLCKK-------EGVVDEPASQMLGRKGSGSWRTWLNKSLSFRI  144

Query  280  MSH  272
             SH
Sbjct  145  SSH  147



>ref|XP_003552877.1| PREDICTED: uncharacterized protein LOC100810542 [Glycine max]
 gb|KHN07549.1| hypothetical protein glysoja_019656 [Glycine soja]
Length=150

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 5/65 (8%)
 Frame = -1

Query  466  FVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNA  287
            F ALSP + IGSLG RNFVLCKK    +  S      +E V+ + +G  WK   NKS + 
Sbjct  91   FDALSPLEPIGSLGSRNFVLCKK----QVQSSKAAPQSELVSQKSNGG-WKAWLNKSFSL  145

Query  286  KVMSH  272
            K++SH
Sbjct  146  KILSH  150



>ref|XP_009774976.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
sylvestris]
Length=153

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 41/81 (51%), Gaps = 12/81 (15%)
 Frame = -1

Query  514  FLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAAR  335
            F  +  C  +D       AL P D+IGSLGVRNF+LCKK  +   T G   +A E     
Sbjct  85   FFLYPACAGLD-------ALGPLDSIGSLGVRNFILCKKQKQPLMTEG---RANEIAQNG  134

Query  334  KSGSIWKTLFNKSLNAKVMSH  272
            K G  WK    KS + K+ SH
Sbjct  135  KKG--WKAWLTKSFSFKIHSH  153



>ref|XP_009605387.1| PREDICTED: uncharacterized protein LOC104099956 [Nicotiana tomentosiformis]
Length=119

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 45/88 (51%), Gaps = 11/88 (13%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS   + FLY V     D        + P D IGS GVRNF+LCKK  + + T G    +
Sbjct  43   GSNVDSFFLYPVNAGPDD------TPMGPSDEIGSQGVRNFILCKKQKQPQMTEG----S  92

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMSH  272
            AE + + K  S WK+  NKS + ++  H
Sbjct  93   AEEI-SHKGRSSWKSWLNKSFSFRIHFH  119



>ref|XP_003537448.2| PREDICTED: uncharacterized protein LOC100775979 [Glycine max]
Length=155

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 37/65 (57%), Gaps = 2/65 (3%)
 Frame = -1

Query  466  FVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNA  287
            F ALSP + IGS GVRNFVLCKK  +  ++S    Q+  A      G  WK   NKS   
Sbjct  93   FDALSPLEPIGSFGVRNFVLCKK--QVYSSSKAAPQSELASHKSSGGHGWKAWLNKSFGL  150

Query  286  KVMSH  272
            K++SH
Sbjct  151  KIVSH  155



>ref|XP_007216024.1| hypothetical protein PRUPE_ppa014882mg, partial [Prunus persica]
 gb|EMJ17223.1| hypothetical protein PRUPE_ppa014882mg, partial [Prunus persica]
Length=121

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW++IGS G RNFVL KK   ++A     ++  E  A + S S WK   NKS   K+
Sbjct  62   ALSPWESIGSHGGRNFVLSKK---QRAVQNVTERKPEMTAPKGSVSSWKAWLNKSFPFKI  118

Query  280  MSH  272
             SH
Sbjct  119  SSH  121



>gb|EYU33134.1| hypothetical protein MIMGU_mgv1a016072mg [Erythranthe guttata]
Length=135

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 5/63 (8%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            AL P + IGS G+R+F+LCKKP  E A + D  +A    + + SGS+ +  FNKSL+ K+
Sbjct  78   ALLPCEKIGSAGIRDFILCKKPQIEMAITDDNNKA----SPKGSGSL-RAFFNKSLHVKI  132

Query  280  MSH  272
              H
Sbjct  133  SFH  135



>gb|EYU25602.1| hypothetical protein MIMGU_mgv1a024525mg [Erythranthe guttata]
Length=135

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 5/63 (8%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            AL P + IGS G+R+F+LCKKP  E A + D  +A    + + SGS+ +  FNKSL+ K+
Sbjct  78   ALLPCEKIGSAGIRDFILCKKPQIEMAITDDNNKA----SPKGSGSL-RAFFNKSLHVKI  132

Query  280  MSH  272
              H
Sbjct  133  SFH  135



>ref|XP_008229193.1| PREDICTED: uncharacterized protein LOC103328575 isoform X1 [Prunus 
mume]
Length=153

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW++IGS G RNFVL KK   ++A     ++  E  A + S S WK   NKS   K+
Sbjct  94   ALSPWESIGSHGGRNFVLSKK---QRAVQNVAERKPEMTAPKGSVSSWKAWLNKSFPFKI  150

Query  280  MSH  272
             SH
Sbjct  151  SSH  153



>gb|KHN17944.1| hypothetical protein glysoja_017995 [Glycine soja]
Length=155

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 37/65 (57%), Gaps = 2/65 (3%)
 Frame = -1

Query  466  FVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNA  287
            F ALSP + IGS GVRNFVLCKK  +  ++S    Q+  A      G  WK   NKS   
Sbjct  93   FDALSPLEPIGSFGVRNFVLCKK--QVYSSSKVAPQSELASHKSSGGHGWKAWLNKSFGL  150

Query  286  KVMSH  272
            K++SH
Sbjct  151  KIVSH  155



>gb|EPS67816.1| hypothetical protein M569_06958, partial [Genlisea aurea]
Length=134

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 5/62 (8%)
 Frame = -1

Query  466  FVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNA  287
            + AL P +TIGS GVRNF+L KKP   + +S +G++++      K G  WK+ FNKS + 
Sbjct  76   YEALRPLETIGSTGVRNFILFKKPQAAEKSSINGEKSSH-----KGGRSWKSWFNKSFSL  130

Query  286  KV  281
             +
Sbjct  131  NI  132



>gb|KFK41506.1| hypothetical protein AALP_AA2G138600 [Arabis alpina]
Length=143

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 41/90 (46%), Gaps = 10/90 (11%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGK--  362
            GS F    LY  +        V   ALS W  IG LG RNF LC+KP E+K   G+G+  
Sbjct  62   GSDFNDFLLYCPM--------VGPEALSSWSAIGLLGARNFTLCRKPEEKKVEEGNGRSN  113

Query  361  QAAEAVAARKSGSIWKTLFNKSLNAKVMSH  272
                     + G   K   NKS + KV SH
Sbjct  114  SNVNGGGGGRKGGSLKAWINKSFSLKVQSH  143



>emb|CDP02694.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            AL+  ++IG  GVRNFVLCKK    + T       +E ++ ++SGS  K  FNKSL++K+
Sbjct  85   ALNLSESIGLQGVRNFVLCKKQRRPQMTEAR----SEMISRKRSGSWVKAWFNKSLSSKM  140

Query  280  MSH  272
            +SH
Sbjct  141  LSH  143



>ref|XP_008343057.1| PREDICTED: uncharacterized protein LOC103405829 [Malus domestica]
 ref|XP_008362512.1| PREDICTED: uncharacterized protein LOC103426195 [Malus domestica]
Length=153

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSPW+TIGS G RNFVL KK  ++   +   ++ +E  A + + S WK   NKS   K+
Sbjct  92   ALSPWETIGSRGGRNFVLSKK-QKQVQNNNIAERKSEITAPKGTVSSWKAWLNKSFTFKI  150

Query  280  MSH  272
             SH
Sbjct  151  SSH  153



>gb|ACJ83930.1| unknown [Medicago truncatula]
Length=139

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 6/60 (10%)
 Frame = -1

Query  460  ALSPWDTIGSLG-VRNFVLCKKP-AEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNA  287
            ALSP DTIGS G  RNF+LCKKP    +  + DG   A A+A R++GS+ K  FNKSL++
Sbjct  78   ALSPLDTIGSHGGARNFMLCKKPETTNRMANADG---AVALARRRNGSL-KNWFNKSLSS  133



>gb|AGU36354.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36362.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36363.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36364.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36368.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36369.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36370.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36371.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36372.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36373.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36374.1| hypothetical protein, partial [Helianthus annuus]
Length=109

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGS  323
            ALSP + IGS GVRNF+LCKKP       GDGK     +  + SGS
Sbjct  63   ALSPVEAIGSFGVRNFMLCKKPQAVVEEVGDGKPVTVGITRKNSGS  108



>emb|CAN65811.1| hypothetical protein VITISV_031711 [Vitis vinifera]
Length=137

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 2/55 (4%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKS  296
            ALSPW+TIGS G RNF+LCKKP  +  T   G +    +  + SGS WK   N S
Sbjct  79   ALSPWETIGSNGXRNFMLCKKPQPQNTTE-VGVEGRAGMPRKGSGS-WKAWINNS  131



>ref|XP_007045195.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY01027.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=163

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWK  314
            ALSPW+TIGS G RNF+LCKKP  EK    DG+    A+  + SG+ WK
Sbjct  94   ALSPWETIGSQGARNFMLCKKPKTEKMED-DGRSTG-AITRKGSGN-WK  139



>ref|XP_006416119.1| hypothetical protein EUTSA_v10009597mg [Eutrema salsugineum]
 gb|ESQ34472.1| hypothetical protein EUTSA_v10009597mg [Eutrema salsugineum]
Length=142

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARK-SGSIWKTLFNKSLNAK  284
            ALSPW+ IG LG RNF+LCKKP E+K   G+G+       +RK +G  +K   NKS + K
Sbjct  79   ALSPWEAIGLLGARNFMLCKKPEEKKVEEGNGRSNFPINGSRKRAGGSFKAWINKSFSLK  138

Query  283  VMSH  272
            V +H
Sbjct  139  VTTH  142



>ref|XP_006357767.1| PREDICTED: uncharacterized protein LOC102592157 [Solanum tuberosum]
Length=127

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 35/68 (51%), Gaps = 17/68 (25%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKP-----AEEKATSGDGKQAAEAVAARKSGSIWKTLFNKS  296
            AL   D+IGSLGVRNF+LCKK       E +A  G+GK+             WK    KS
Sbjct  72   ALGASDSIGSLGVRNFILCKKQKQAVMTEGRAQHGNGKRG------------WKAWLTKS  119

Query  295  LNAKVMSH  272
             N K+ SH
Sbjct  120  FNFKIHSH  127



>gb|AGU36351.1| hypothetical protein, partial [Helianthus argophyllus]
 gb|AGU36352.1| hypothetical protein, partial [Helianthus argophyllus]
Length=109

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGS  323
            ALSP + IGS GVRNF+LCKKP       GDGK     +  + SG+
Sbjct  63   ALSPVEAIGSFGVRNFMLCKKPQAVVEEVGDGKPVTVGITRKNSGN  108



>ref|XP_006430618.1| hypothetical protein CICLE_v10012986mg [Citrus clementina]
 gb|ESR43858.1| hypothetical protein CICLE_v10012986mg [Citrus clementina]
 gb|KDO50842.1| hypothetical protein CISIN_1g031575mg [Citrus sinensis]
Length=157

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 34/62 (55%), Gaps = 6/62 (10%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSP + IGS G RNF+LCKK  + + T G  K  AE       GS WK   NKS   K+
Sbjct  99   ALSPSEQIGSCGGRNFLLCKKHLQSQMTEGRAKTVAE------KGSGWKAWLNKSFTFKI  152

Query  280  MS  275
             +
Sbjct  153  TT  154



>ref|XP_006482133.1| PREDICTED: uncharacterized protein LOC102630256 [Citrus sinensis]
Length=157

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 34/62 (55%), Gaps = 6/62 (10%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSP + IGS G RNF+LCKK  + + T G  K  AE       GS WK   NKS   K+
Sbjct  99   ALSPSEQIGSCGGRNFLLCKKHLQSQMTEGRAKTVAE------KGSGWKAWLNKSFTFKI  152

Query  280  MS  275
             +
Sbjct  153  TT  154



>ref|XP_011073847.1| PREDICTED: uncharacterized protein LOC105158703 [Sesamum indicum]
Length=175

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 43/88 (49%), Gaps = 14/88 (16%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS  ++ FLY V           F AL   + IGS G RNFVLCK  ++   T       
Sbjct  102  GSDISSFFLYPV--------NAGFEALKLSEVIGSRGARNFVLCKNQSKPHMTE------  147

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMSH  272
            A +   ++ GS W+  F KSL  K++SH
Sbjct  148  ARSQLIKRKGSQWRAWFQKSLTFKILSH  175



>ref|XP_010032694.1| PREDICTED: uncharacterized protein At4g22758-like [Eucalyptus 
grandis]
 gb|KCW52147.1| hypothetical protein EUGRSUZ_J01592 [Eucalyptus grandis]
Length=155

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 9/81 (11%)
 Frame = -1

Query  502  VLCISIDNIVVKFVA----LSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAAR  335
            VL   ++N V+   A    L+P + IGS G RNFVLCKK  + + T       +E ++ +
Sbjct  80   VLGTDVNNFVLHAAANSDALNPSEAIGSQGGRNFVLCKKQIQPQMTEA----RSEMISHK  135

Query  334  KSGSIWKTLFNKSLNAKVMSH  272
            +SGS WK   NKS + K+ S+
Sbjct  136  RSGS-WKAWLNKSFSFKIPSY  155



>ref|XP_006305759.1| hypothetical protein CARUB_v10010592mg [Capsella rubella]
 gb|EOA38657.1| hypothetical protein CARUB_v10010592mg [Capsella rubella]
Length=142

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 3/66 (5%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSG-DGKQAAEAVAARK--SGSIWKTLFNKSLN  290
            ALSPW+ IGS+GVRNF+LCKK  EEK   G +G+ +     ARK   G  +K   NKS +
Sbjct  77   ALSPWEAIGSVGVRNFMLCKKKPEEKKVEGNNGRSSFTINGARKGAGGRSFKAWINKSFS  136

Query  289  AKVMSH  272
             KV +H
Sbjct  137  LKVTTH  142



>ref|XP_009586822.1| PREDICTED: uncharacterized protein LOC104084618 [Nicotiana tomentosiformis]
Length=133

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 36/63 (57%), Gaps = 5/63 (8%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
             L P D+IGS GVRNF+LCKK  ++K    +G+  A A   ++    WK    KS N K+
Sbjct  76   GLGPLDSIGSAGVRNFILCKK--QKKLLMTEGRANAIAQNGKRG---WKAWLTKSFNFKI  130

Query  280  MSH  272
             SH
Sbjct  131  HSH  133



>emb|CDY09482.1| BnaC02g20240D [Brassica napus]
Length=135

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 43/87 (49%), Gaps = 15/87 (17%)
 Frame = -1

Query  535  GSIFTTLFLYFVLCISIDNIVVKFVALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQA  356
            GS F    LY  +        V   ++S W  IGSLG RNF LC+KP E+       K  
Sbjct  60   GSDFNDFILYCPM--------VGPESMSAWKGIGSLGARNFTLCRKPEEKN------KVV  105

Query  355  AEAVAARKSGSIWKTLFNKSLNAKVMS  275
             E   ARK GS +K   NKS + +V++
Sbjct  106  KEGDGARKGGS-FKAWINKSFSLRVLA  131



>gb|AGU36357.1| hypothetical protein, partial [Helianthus annuus]
Length=108

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGS  323
            ALSP + IGS GVRNF+LCKKP   +   GDGK     +  + SGS
Sbjct  63   ALSPVEAIGSFGVRNFMLCKKPQAVEEV-GDGKPVTAGITRKNSGS  107



>ref|XP_010095717.1| hypothetical protein L484_002689 [Morus notabilis]
 gb|EXB62017.1| hypothetical protein L484_002689 [Morus notabilis]
Length=130

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 36/63 (57%), Gaps = 10/63 (16%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGSIWKTLFNKSLNAKV  281
            ALSP DTIGS G RNF+LCKKP   K    D K+     + RK+   WK+     LN K+
Sbjct  78   ALSPLDTIGSQGTRNFMLCKKPQPLK-IEDDVKE-----STRKASGNWKSW----LNLKI  127

Query  280  MSH  272
             SH
Sbjct  128  TSH  130



>gb|AGU36353.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36355.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36356.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36358.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36360.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36361.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36365.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36366.1| hypothetical protein, partial [Helianthus annuus]
Length=108

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGS  323
            ALSP + IGS GVRNF+LCKKP   +   GDGK     +  + SGS
Sbjct  63   ALSPVEAIGSFGVRNFMLCKKPQAVEEV-GDGKPVTVGITRKNSGS  107



>gb|AGU36367.1| hypothetical protein, partial [Helianthus annuus]
Length=108

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -1

Query  460  ALSPWDTIGSLGVRNFVLCKKPAEEKATSGDGKQAAEAVAARKSGS  323
            ALSP + IGS GVRNF+LCKKP   +   GDGK     +  + SGS
Sbjct  63   ALSPVEAIGSFGVRNFMLCKKPQAVEEV-GDGKLVTVGITRKNSGS  107



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000