BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF043P03

Length=605
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP05978.1|  unnamed protein product                                241   2e-73   Coffea canephora [robusta coffee]
gb|EYU44997.1|  hypothetical protein MIMGU_mgv1a003664mg                232   5e-69   Erythranthe guttata [common monkey flower]
ref|XP_011082732.1|  PREDICTED: uncharacterized protein LOC105165426    232   5e-69   Sesamum indicum [beniseed]
gb|EPS64918.1|  sodium/calcium exchanger family protein                 229   1e-68   Genlisea aurea
ref|XP_010098421.1|  hypothetical protein L484_012136                   230   2e-68   Morus notabilis
ref|XP_004244257.1|  PREDICTED: uncharacterized protein LOC101263533    228   2e-67   Solanum lycopersicum
gb|KJB45756.1|  hypothetical protein B456_007G325800                    227   4e-67   Gossypium raimondii
gb|KHG29939.1|  Vacuolar calcium ion transporter                        227   5e-67   Gossypium arboreum [tree cotton]
ref|XP_002522155.1|  calcium ion binding protein, putative              226   6e-67   
gb|KCW67441.1|  hypothetical protein EUGRSUZ_F011931                    217   7e-67   Eucalyptus grandis [rose gum]
ref|XP_008386231.1|  PREDICTED: uncharacterized protein LOC103448741    226   2e-66   Malus domestica [apple tree]
ref|XP_006348283.1|  PREDICTED: uncharacterized protein LOC102600810    226   2e-66   Solanum tuberosum [potatoes]
ref|XP_007021648.1|  Sodium/calcium exchanger family protein / ca...    225   2e-66   Theobroma cacao [chocolate]
ref|XP_009340381.1|  PREDICTED: uncharacterized protein LOC103932481    225   2e-66   Pyrus x bretschneideri [bai li]
ref|XP_010675392.1|  PREDICTED: uncharacterized protein LOC104891403    224   2e-66   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW67438.1|  hypothetical protein EUGRSUZ_F01191                     218   3e-66   Eucalyptus grandis [rose gum]
ref|XP_006451747.1|  hypothetical protein CICLE_v10007809mg             223   1e-65   Citrus clementina [clementine]
gb|EPS57671.1|  hypothetical protein M569_17145                         219   2e-65   Genlisea aurea
gb|KCW67437.1|  hypothetical protein EUGRSUZ_F01191                     218   4e-65   Eucalyptus grandis [rose gum]
ref|XP_009604315.1|  PREDICTED: uncharacterized protein LOC104099119    221   5e-65   Nicotiana tomentosiformis
dbj|BAD43479.1|  unknown protein                                        208   8e-65   Arabidopsis thaliana [mouse-ear cress]
dbj|BAI94501.1|  sodium/calcium exchanger protein                       219   4e-64   Dianthus caryophyllus [carnation]
gb|EMS45634.1|  hypothetical protein TRIUR3_11261                       214   9e-64   Triticum urartu
gb|KFK35737.1|  hypothetical protein AALP_AA4G030000                    216   2e-63   Arabis alpina [alpine rockcress]
ref|XP_010060650.1|  PREDICTED: uncharacterized protein LOC104448506    218   2e-63   Eucalyptus grandis [rose gum]
ref|XP_004489056.1|  PREDICTED: uncharacterized protein LOC101505490    217   2e-63   Cicer arietinum [garbanzo]
ref|XP_011000241.1|  PREDICTED: uncharacterized protein LOC105107868    217   2e-63   Populus euphratica
gb|KEH38643.1|  calcium-binding EF-hand protein                         214   3e-63   Medicago truncatula
ref|XP_010279178.1|  PREDICTED: uncharacterized protein LOC104613162    216   3e-63   Nelumbo nucifera [Indian lotus]
ref|XP_007149412.1|  hypothetical protein PHAVU_005G068100g             216   7e-63   Phaseolus vulgaris [French bean]
gb|EMT05376.1|  hypothetical protein F775_06447                         214   8e-63   
ref|XP_006307087.1|  hypothetical protein CARUB_v10008672mg             213   1e-62   
gb|AAK32813.1|AF361800_1  At1g53210/F12M16_12                           213   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519243.1|  PREDICTED: uncharacterized protein LOC104798750    214   3e-62   Tarenaya hassleriana [spider flower]
emb|CDY25869.1|  BnaA05g14600D                                          214   5e-62   Brassica napus [oilseed rape]
ref|XP_009144785.1|  PREDICTED: uncharacterized protein LOC103868446    214   5e-62   Brassica rapa
ref|XP_010042553.1|  PREDICTED: uncharacterized protein LOC104431654    206   5e-62   Eucalyptus grandis [rose gum]
emb|CDY55841.1|  BnaCnng29300D                                          213   5e-62   Brassica napus [oilseed rape]
ref|XP_002298903.2|  sodium/calcium exchanger family protein            213   6e-62   
ref|XP_007213956.1|  hypothetical protein PRUPE_ppa004823mg             211   7e-62   
gb|AAF69532.1|AC008007_7  F12M16.12                                     213   8e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011098256.1|  PREDICTED: uncharacterized protein LOC105176...    213   8e-62   Sesamum indicum [beniseed]
ref|NP_564623.2|  Na+/Ca 2+ exchanger-like protein                      213   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147618.1|  PREDICTED: uncharacterized protein LOC103871140    213   1e-61   Brassica rapa
ref|XP_006392816.1|  hypothetical protein EUTSA_v10011341mg             213   1e-61   Eutrema salsugineum [saltwater cress]
ref|XP_010479874.1|  PREDICTED: uncharacterized protein LOC104758667    213   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010462200.1|  PREDICTED: uncharacterized protein LOC104742841    212   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006307086.1|  hypothetical protein CARUB_v10008672mg             212   2e-61   Capsella rubella
ref|XP_009106991.1|  PREDICTED: uncharacterized protein LOC103832685    212   2e-61   Brassica rapa
ref|XP_010500958.1|  PREDICTED: uncharacterized protein LOC104778258    212   2e-61   Camelina sativa [gold-of-pleasure]
emb|CDY24108.1|  BnaA06g01060D                                          213   3e-61   Brassica napus [oilseed rape]
gb|ACN35869.1|  unknown                                                 208   3e-61   Zea mays [maize]
emb|CDY25725.1|  BnaC03g69500D                                          211   3e-61   Brassica napus [oilseed rape]
gb|ACN36915.1|  unknown                                                 208   4e-61   Zea mays [maize]
ref|XP_009348414.1|  PREDICTED: uncharacterized protein LOC103940068    211   4e-61   Pyrus x bretschneideri [bai li]
gb|KDP36271.1|  hypothetical protein JCGZ_09836                         211   4e-61   Jatropha curcas
ref|XP_003571165.2|  PREDICTED: uncharacterized protein LOC100833...    212   4e-61   
ref|XP_002891737.1|  sodium/calcium exchanger family protein            211   4e-61   
ref|XP_010234099.1|  PREDICTED: uncharacterized protein LOC100833...    212   5e-61   
ref|XP_009593456.1|  PREDICTED: uncharacterized protein LOC104090114    210   7e-61   Nicotiana tomentosiformis
ref|XP_008226455.1|  PREDICTED: uncharacterized protein LOC103326029    211   7e-61   Prunus mume [ume]
emb|CAN76642.1|  hypothetical protein VITISV_042742                     198   9e-61   Vitis vinifera
ref|XP_003565462.1|  PREDICTED: uncharacterized protein LOC100838274    210   9e-61   Brachypodium distachyon [annual false brome]
ref|NP_001042378.1|  Os01g0212400                                       210   9e-61   
gb|EEE56655.1|  hypothetical protein OsJ_06069                          210   9e-61   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD19956.1|  putative drought-induced protein RDI                   210   1e-60   Oryza sativa Japonica Group [Japonica rice]
gb|ACN27225.1|  unknown                                                 208   1e-60   Zea mays [maize]
ref|XP_010915578.1|  PREDICTED: uncharacterized protein LOC105040648    210   1e-60   Elaeis guineensis
emb|CDY26003.1|  BnaC06g06210D                                          209   1e-60   Brassica napus [oilseed rape]
gb|EMT26919.1|  hypothetical protein F775_25869                         207   2e-60   
ref|XP_006643900.1|  PREDICTED: uncharacterized protein LOC102712578    208   4e-60   Oryza brachyantha
ref|XP_008367769.1|  PREDICTED: uncharacterized protein LOC103431392    209   4e-60   
ref|XP_002451861.1|  hypothetical protein SORBIDRAFT_04g008850          208   4e-60   
gb|EMS61578.1|  hypothetical protein TRIUR3_22187                       206   5e-60   Triticum urartu
ref|XP_009348415.1|  PREDICTED: uncharacterized protein LOC103940069    208   6e-60   Pyrus x bretschneideri [bai li]
ref|XP_008673552.1|  PREDICTED: uncharacterized protein LOC103649588    207   9e-60   
ref|NP_001151543.1|  LOC100285177 precursor                             207   1e-59   Zea mays [maize]
gb|ACY66868.1|  P20Sh148J07                                             207   1e-59   Saccharum hybrid cultivar R570
gb|ACY66874.1|  P20Sh095F0                                              207   2e-59   Saccharum hybrid cultivar R570
ref|XP_008367781.1|  PREDICTED: uncharacterized protein LOC103431400    207   2e-59   
ref|XP_009767335.1|  PREDICTED: uncharacterized protein LOC104218515    206   2e-59   Nicotiana sylvestris
ref|XP_008655084.1|  PREDICTED: LOC100285177 isoform X1                 207   2e-59   Zea mays [maize]
ref|XP_007212014.1|  hypothetical protein PRUPE_ppa004833mg             204   2e-59   
ref|XP_010535054.1|  PREDICTED: uncharacterized protein LOC104810447    206   4e-59   Tarenaya hassleriana [spider flower]
emb|CDM82192.1|  unnamed protein product                                206   4e-59   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ93500.1|  predicted protein                                      204   1e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004951320.1|  PREDICTED: uncharacterized protein LOC101782315    204   2e-58   Setaria italica
gb|KJB13246.1|  hypothetical protein B456_002G064800                    204   2e-58   Gossypium raimondii
ref|XP_010062838.1|  PREDICTED: uncharacterized protein LOC104450104    204   2e-58   Eucalyptus grandis [rose gum]
ref|XP_008645573.1|  PREDICTED: uncharacterized protein LOC103626994    203   3e-58   
ref|XP_008226453.1|  PREDICTED: uncharacterized protein LOC103326027    203   3e-58   Prunus mume [ume]
ref|XP_009766997.1|  PREDICTED: uncharacterized protein LOC104218248    203   4e-58   Nicotiana sylvestris
ref|XP_004294082.1|  PREDICTED: uncharacterized protein LOC101313777    203   4e-58   Fragaria vesca subsp. vesca
ref|XP_004251882.1|  PREDICTED: uncharacterized protein LOC101257045    203   4e-58   Solanum lycopersicum
ref|XP_006358955.1|  PREDICTED: uncharacterized protein LOC102579474    203   5e-58   Solanum tuberosum [potatoes]
ref|XP_004294083.1|  PREDICTED: uncharacterized protein LOC101314065    202   1e-57   Fragaria vesca subsp. vesca
gb|KCW44589.1|  hypothetical protein EUGRSUZ_L01893                     198   2e-57   Eucalyptus grandis [rose gum]
ref|XP_003634635.1|  PREDICTED: uncharacterized protein LOC100264164    201   2e-57   Vitis vinifera
gb|KHG25681.1|  Vacuolar calcium ion transporter                        201   2e-57   Gossypium arboreum [tree cotton]
emb|CBI20223.3|  unnamed protein product                                198   8e-57   Vitis vinifera
ref|XP_004146032.1|  PREDICTED: uncharacterized protein LOC101209...    199   1e-56   Cucumis sativus [cucumbers]
ref|XP_004146033.1|  PREDICTED: uncharacterized protein LOC101209...    199   1e-56   
ref|XP_002282948.1|  PREDICTED: uncharacterized protein LOC100252144    198   4e-56   Vitis vinifera
ref|XP_009405607.1|  PREDICTED: uncharacterized protein LOC103988717    198   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380498.1|  PREDICTED: uncharacterized protein LOC103968880    197   1e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010041151.1|  PREDICTED: uncharacterized protein LOC104430086    197   1e-55   Eucalyptus grandis [rose gum]
ref|XP_009409407.1|  PREDICTED: uncharacterized protein LOC103991626    194   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADM77106.1|  sodium/calcium exchanger family-like protein            185   1e-54   Picea sitchensis
gb|ADE75754.1|  unknown                                                 185   1e-54   Picea sitchensis
ref|XP_002279120.1|  PREDICTED: uncharacterized protein LOC100253888    193   2e-54   Vitis vinifera
emb|CAN78652.1|  hypothetical protein VITISV_033128                     193   2e-54   Vitis vinifera
gb|ADM77115.1|  sodium/calcium exchanger family-like protein            184   4e-54   Picea sitchensis
ref|XP_003543222.1|  PREDICTED: uncharacterized protein LOC100809896    191   1e-53   Glycine max [soybeans]
gb|ADM77131.1|  sodium/calcium exchanger family-like protein            182   2e-53   Picea sitchensis
ref|XP_004968611.1|  PREDICTED: uncharacterized protein LOC101771765    189   4e-53   Setaria italica
ref|XP_008783929.1|  PREDICTED: uncharacterized protein LOC103703017    191   4e-53   
ref|XP_002992821.1|  hypothetical protein SELMODRAFT_42349              187   3e-52   
ref|XP_002987555.1|  hypothetical protein SELMODRAFT_42348              186   3e-52   
ref|XP_010276580.1|  PREDICTED: uncharacterized protein LOC104611295    187   4e-52   Nelumbo nucifera [Indian lotus]
gb|ADN33808.1|  sodium/calcium exchanger family protein                 185   2e-51   Cucumis melo subsp. melo
ref|XP_008463718.1|  PREDICTED: uncharacterized protein LOC103501799    185   3e-51   Cucumis melo [Oriental melon]
ref|XP_011460411.1|  PREDICTED: uncharacterized protein LOC105350345    171   5e-50   Fragaria vesca subsp. vesca
ref|XP_007050029.1|  Sodium/calcium exchanger family protein / ca...    181   8e-50   
gb|KDP31770.1|  hypothetical protein JCGZ_12231                         180   1e-49   Jatropha curcas
ref|XP_007021639.1|  Sodium/calcium exchanger family protein / ca...    181   2e-49   
ref|XP_002522156.1|  calcium ion binding protein, putative              176   5e-48   
ref|XP_002525142.1|  calcium ion binding protein, putative              175   8e-48   
ref|XP_011098255.1|  PREDICTED: uncharacterized protein LOC105176...    175   1e-47   
ref|XP_004305436.1|  PREDICTED: uncharacterized protein LOC101295737    172   1e-46   Fragaria vesca subsp. vesca
ref|XP_010277716.1|  PREDICTED: uncharacterized protein LOC104612096    171   4e-46   Nelumbo nucifera [Indian lotus]
ref|XP_006852513.1|  hypothetical protein AMTR_s00021p00164610          170   4e-46   Amborella trichopoda
gb|KDO45773.1|  hypothetical protein CISIN_1g0423001mg                  155   4e-44   Citrus sinensis [apfelsine]
ref|XP_002979757.1|  hypothetical protein SELMODRAFT_111442             155   5e-44   
ref|XP_001762095.1|  predicted protein                                  164   7e-44   
ref|XP_001751608.1|  predicted protein                                  164   1e-43   
ref|XP_002985423.1|  hypothetical protein SELMODRAFT_122258             154   1e-43   
ref|XP_009340418.1|  PREDICTED: uncharacterized protein LOC103932516    163   3e-43   Pyrus x bretschneideri [bai li]
ref|XP_002985644.1|  hypothetical protein SELMODRAFT_181929             162   4e-43   
ref|XP_002974272.1|  hypothetical protein SELMODRAFT_52345              162   4e-43   
ref|XP_008362437.1|  PREDICTED: uncharacterized protein LOC103426126    162   5e-43   
ref|XP_008368645.1|  PREDICTED: uncharacterized protein LOC103432241    162   5e-43   
ref|XP_001755925.1|  predicted protein                                  161   8e-43   
ref|XP_001752917.1|  predicted protein                                  161   1e-42   
ref|XP_008386229.1|  PREDICTED: uncharacterized protein LOC103448738    161   2e-42   
ref|XP_009354324.1|  PREDICTED: uncharacterized protein LOC103945475    159   4e-42   Pyrus x bretschneideri [bai li]
gb|EMS60383.1|  hypothetical protein TRIUR3_19685                       154   6e-42   Triticum urartu
ref|XP_010052488.1|  PREDICTED: uncharacterized protein LOC104441...    157   2e-41   
ref|XP_010052481.1|  PREDICTED: uncharacterized protein LOC104441...    157   4e-41   Eucalyptus grandis [rose gum]
gb|KCW89606.1|  hypothetical protein EUGRSUZ_A01890                     156   4e-41   Eucalyptus grandis [rose gum]
ref|XP_011000237.1|  PREDICTED: uncharacterized protein LOC105107...    155   3e-40   Populus euphratica
ref|XP_011000236.1|  PREDICTED: uncharacterized protein LOC105107...    155   3e-40   Populus euphratica
ref|XP_011000235.1|  PREDICTED: uncharacterized protein LOC105107...    155   3e-40   Populus euphratica
gb|EMT26602.1|  hypothetical protein F775_16567                         147   1e-39   
ref|XP_008226451.1|  PREDICTED: uncharacterized protein LOC103326025    154   1e-39   Prunus mume [ume]
emb|CDP05977.1|  unnamed protein product                                153   2e-39   Coffea canephora [robusta coffee]
ref|XP_006370034.1|  hypothetical protein POPTR_0001s38430g             149   1e-38   
ref|XP_007213499.1|  hypothetical protein PRUPE_ppa022096mg             149   3e-38   
ref|XP_002298902.2|  hypothetical protein POPTR_0001s38430g             149   4e-38   
ref|XP_006370033.1|  hypothetical protein POPTR_0001s38420g             148   4e-38   
ref|XP_008229131.1|  PREDICTED: uncharacterized protein LOC103328510    147   7e-38   Prunus mume [ume]
ref|XP_007213018.1|  hypothetical protein PRUPE_ppa023026mg             147   1e-37   Prunus persica
ref|XP_006446746.1|  hypothetical protein CICLE_v10018123mg             147   1e-37   
ref|XP_010279180.1|  PREDICTED: uncharacterized protein LOC104613163    146   2e-37   Nelumbo nucifera [Indian lotus]
ref|XP_006469050.1|  PREDICTED: uncharacterized protein LOC102616350    146   2e-37   Citrus sinensis [apfelsine]
ref|XP_002962226.1|  hypothetical protein SELMODRAFT_76965              145   4e-37   
ref|XP_002965139.1|  hypothetical protein SELMODRAFT_82683              145   6e-37   
ref|NP_001046432.2|  Os02g0247800                                       134   1e-36   
ref|XP_011096403.1|  PREDICTED: uncharacterized protein LOC105175606    144   4e-36   
ref|XP_009605371.1|  PREDICTED: uncharacterized protein LOC104099939    142   1e-35   Nicotiana tomentosiformis
ref|XP_009803286.1|  PREDICTED: uncharacterized protein LOC104248681    140   5e-35   Nicotiana sylvestris
ref|XP_011082730.1|  PREDICTED: uncharacterized protein LOC105165425    140   6e-35   Sesamum indicum [beniseed]
gb|EYU28050.1|  hypothetical protein MIMGU_mgv1a023246mg                139   2e-34   Erythranthe guttata [common monkey flower]
ref|XP_011083284.1|  PREDICTED: uncharacterized protein LOC105165819    137   9e-34   Sesamum indicum [beniseed]
emb|CAN78275.1|  hypothetical protein VITISV_037788                     135   1e-33   Vitis vinifera
ref|XP_004233846.1|  PREDICTED: uncharacterized protein LOC101251749    137   1e-33   Solanum lycopersicum
gb|EYU44996.1|  hypothetical protein MIMGU_mgv1a025835mg                135   2e-33   Erythranthe guttata [common monkey flower]
ref|XP_002272134.1|  PREDICTED: uncharacterized protein LOC100243523    134   3e-33   
ref|XP_002522529.1|  calmodulin, putative                               135   3e-33   
ref|XP_008358657.1|  PREDICTED: uncharacterized protein LOC103422380    131   1e-32   
ref|XP_007214217.1|  hypothetical protein PRUPE_ppa023212mg             131   3e-32   
ref|XP_002522528.1|  conserved hypothetical protein                     131   4e-32   
gb|KCW67432.1|  hypothetical protein EUGRSUZ_F01188                     130   5e-32   Eucalyptus grandis [rose gum]
gb|ABK93869.1|  unknown                                                 121   7e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006594742.1|  PREDICTED: uncharacterized protein LOC100798...    132   8e-32   Glycine max [soybeans]
ref|XP_006594743.1|  PREDICTED: uncharacterized protein LOC100798...    132   8e-32   
ref|XP_006594741.1|  PREDICTED: uncharacterized protein LOC100798...    132   8e-32   Glycine max [soybeans]
ref|XP_005839482.1|  hypothetical protein GUITHDRAFT_159252             130   8e-32   Guillardia theta CCMP2712
ref|XP_004361492.1|  hypothetical protein DFA_05775                     130   1e-31   Cavenderia fasciculata
ref|XP_004293919.1|  PREDICTED: uncharacterized protein LOC101312324    129   2e-31   Fragaria vesca subsp. vesca
gb|EYU26347.1|  hypothetical protein MIMGU_mgv1a002045mg                130   2e-31   Erythranthe guttata [common monkey flower]
ref|XP_008383659.1|  PREDICTED: uncharacterized protein LOC103446347    129   3e-31   Malus domestica [apple tree]
ref|XP_006594744.1|  PREDICTED: uncharacterized protein LOC100799062    128   3e-31   
gb|KHN36865.1|  hypothetical protein glysoja_001596                     129   4e-31   Glycine soja [wild soybean]
gb|EYU44995.1|  hypothetical protein MIMGU_mgv1a002795mg                129   5e-31   Erythranthe guttata [common monkey flower]
gb|KDP21053.1|  hypothetical protein JCGZ_21524                         129   6e-31   Jatropha curcas
ref|XP_008225191.1|  PREDICTED: uncharacterized protein LOC103324855    128   6e-31   Prunus mume [ume]
ref|XP_009352820.1|  PREDICTED: uncharacterized protein LOC103944133    127   9e-31   
gb|KCW67433.1|  hypothetical protein EUGRSUZ_F01189                     127   9e-31   Eucalyptus grandis [rose gum]
ref|XP_011460597.1|  PREDICTED: uncharacterized protein LOC101307679    126   1e-30   Fragaria vesca subsp. vesca
ref|XP_011096404.1|  PREDICTED: uncharacterized protein LOC105175608    128   2e-30   Sesamum indicum [beniseed]
ref|XP_004963827.1|  PREDICTED: uncharacterized protein LOC101777425    120   4e-30   
ref|XP_009352959.1|  PREDICTED: uncharacterized protein LOC103944258    125   5e-30   
gb|KDP21052.1|  hypothetical protein JCGZ_21523                         125   5e-30   Jatropha curcas
ref|XP_007025465.1|  Sodium/calcium exchanger family protein / ca...    125   7e-30   
dbj|GAM24148.1|  hypothetical protein SAMD00019534_073230               124   7e-30   Acytostelium subglobosum LB1
ref|XP_010060649.1|  PREDICTED: uncharacterized protein LOC104448505    126   8e-30   Eucalyptus grandis [rose gum]
gb|KCW67434.1|  hypothetical protein EUGRSUZ_F01190                     122   5e-29   Eucalyptus grandis [rose gum]
gb|KDP36272.1|  hypothetical protein JCGZ_09837                         122   7e-29   Jatropha curcas
ref|XP_007149414.1|  hypothetical protein PHAVU_005G068300g             123   7e-29   Phaseolus vulgaris [French bean]
ref|XP_009352958.1|  PREDICTED: uncharacterized protein LOC103944256    122   9e-29   
ref|XP_011096402.1|  PREDICTED: uncharacterized protein LOC105175...    122   1e-28   Sesamum indicum [beniseed]
ref|XP_011096401.1|  PREDICTED: uncharacterized protein LOC105175...    121   1e-28   Sesamum indicum [beniseed]
ref|XP_010101519.1|  hypothetical protein L484_008850                   120   2e-28   
ref|XP_004489086.1|  PREDICTED: uncharacterized protein LOC101490438    115   3e-28   
ref|XP_008383883.1|  PREDICTED: uncharacterized protein LOC103446524    120   5e-28   
ref|XP_002275961.1|  PREDICTED: uncharacterized protein LOC100260847    119   5e-28   Vitis vinifera
ref|XP_002500016.1|  Ca2+:Cation antiporter family                      119   7e-28   Micromonas commoda
ref|XP_003540477.1|  PREDICTED: uncharacterized protein LOC100800452    120   7e-28   Glycine max [soybeans]
gb|KHN28092.1|  hypothetical protein glysoja_007824                     120   1e-27   Glycine soja [wild soybean]
gb|KCW74041.1|  hypothetical protein EUGRSUZ_E02665                     118   1e-27   Eucalyptus grandis [rose gum]
ref|XP_010058975.1|  PREDICTED: uncharacterized protein LOC104446873    118   1e-27   
emb|CBI21945.3|  unnamed protein product                                120   2e-27   Vitis vinifera
ref|XP_010657148.1|  PREDICTED: uncharacterized protein LOC100245468    115   2e-27   
gb|KCW67430.1|  hypothetical protein EUGRSUZ_F01186                     118   4e-27   Eucalyptus grandis [rose gum]
gb|EYU43358.1|  hypothetical protein MIMGU_mgv1a003865mg                117   4e-27   Erythranthe guttata [common monkey flower]
ref|XP_004234097.2|  PREDICTED: uncharacterized protein LOC101254...    118   7e-27   Solanum lycopersicum
ref|XP_004357876.1|  hypothetical protein DFA_00160                     118   7e-27   Cavenderia fasciculata
ref|XP_006340117.1|  PREDICTED: uncharacterized protein LOC102587762    117   8e-27   
ref|XP_010058973.1|  PREDICTED: uncharacterized protein LOC104446871    116   9e-27   
ref|XP_002275985.2|  PREDICTED: uncharacterized protein LOC100255777    116   1e-26   Vitis vinifera
emb|CAN78650.1|  hypothetical protein VITISV_033126                     116   1e-26   Vitis vinifera
dbj|GAM24777.1|  hypothetical protein SAMD00019534_079520               115   1e-26   Acytostelium subglobosum LB1
gb|KCW74040.1|  hypothetical protein EUGRSUZ_E02663                     116   1e-26   Eucalyptus grandis [rose gum]
ref|XP_006343216.1|  PREDICTED: uncharacterized protein LOC102593213    117   1e-26   Solanum tuberosum [potatoes]
ref|XP_007149413.1|  hypothetical protein PHAVU_005G068200g             116   1e-26   Phaseolus vulgaris [French bean]
ref|XP_005650712.1|  hypothetical protein COCSUDRAFT_61158              115   3e-26   Coccomyxa subellipsoidea C-169
emb|CBI21946.3|  unnamed protein product                                115   7e-26   Vitis vinifera
ref|XP_001627159.1|  predicted protein                                  115   1e-25   Nematostella vectensis
ref|XP_011460767.1|  PREDICTED: uncharacterized protein LOC105350439    112   8e-25   Fragaria vesca subsp. vesca
ref|XP_010478257.1|  PREDICTED: uncharacterized protein LOC104757229    111   1e-24   Camelina sativa [gold-of-pleasure]
emb|CAN78651.1|  hypothetical protein VITISV_033127                     110   1e-24   Vitis vinifera
ref|NP_174197.2|  EF-hand, calcium binding motif-containing protein     110   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAF24539.2|AC007508_2  F1K23.2                                       110   7e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011027726.1|  PREDICTED: uncharacterized protein LOC105127...    107   8e-24   Populus euphratica
ref|XP_011027724.1|  PREDICTED: uncharacterized protein LOC105127...    107   1e-23   Populus euphratica
emb|CBI20222.3|  unnamed protein product                                108   1e-23   Vitis vinifera
ref|XP_002276006.2|  PREDICTED: uncharacterized protein LOC100250594    107   2e-23   
ref|XP_010644148.1|  PREDICTED: uncharacterized protein LOC100241883    108   2e-23   Vitis vinifera
ref|XP_003386706.1|  PREDICTED: uncharacterized protein LOC100632705    107   2e-23   Amphimedon queenslandica
ref|XP_002113975.1|  hypothetical protein TRIADDRAFT_57950              106   3e-23   Trichoplax adhaerens
ref|XP_006304623.1|  hypothetical protein CARUB_v10011719mg             107   3e-23   
ref|XP_007021646.1|  Sodium/calcium exchanger family protein / ca...    107   4e-23   
ref|XP_008371442.1|  PREDICTED: uncharacterized protein LOC103434855    106   4e-23   
ref|XP_006410547.1|  hypothetical protein EUTSA_v10016396mg             106   5e-23   Eutrema salsugineum [saltwater cress]
ref|NP_180950.2|  Calcium-binding EF-hand family protein                105   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EFA85983.1|  hypothetical protein PPL_01216                          105   1e-22   Heterostelium album PN500
ref|XP_009794964.1|  PREDICTED: uncharacterized protein LOC104241728    103   2e-22   Nicotiana sylvestris
gb|EYU28049.1|  hypothetical protein MIMGU_mgv1a003825mg                103   3e-22   Erythranthe guttata [common monkey flower]
ref|XP_006295951.1|  hypothetical protein CARUB_v10025093mg             103   5e-22   Capsella rubella
emb|CDY34082.1|  BnaA09g27080D                                          103   6e-22   Brassica napus [oilseed rape]
ref|XP_010509800.1|  PREDICTED: uncharacterized protein LOC104786159    103   6e-22   Camelina sativa [gold-of-pleasure]
gb|KFK23894.1|  hypothetical protein AALP_AAs69390U000200               103   6e-22   Arabis alpina [alpine rockcress]
ref|NP_180949.2|  calcium-binding EF-hand-containing protein            103   6e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113633.1|  PREDICTED: uncharacterized protein LOC103838933    103   6e-22   Brassica rapa
ref|XP_009141357.1|  PREDICTED: uncharacterized protein LOC103865312    102   7e-22   Brassica rapa
gb|KIZ00034.1|  hypothetical protein MNEG_7930                          100   7e-22   Monoraphidium neglectum
emb|CDX79552.1|  BnaC03g18880D                                          103   8e-22   
emb|CDY37675.1|  BnaA04g19930D                                          103   8e-22   Brassica napus [oilseed rape]
ref|XP_002881319.1|  calcium ion binding protein                        102   1e-21   
emb|CDY64851.1|  BnaCnng45370D                                          102   2e-21   Brassica napus [oilseed rape]
ref|XP_009132970.1|  PREDICTED: uncharacterized protein LOC103857518    101   2e-21   Brassica rapa
emb|CDX84660.1|  BnaA03g15700D                                          101   3e-21   
emb|CCI40171.1|  unnamed protein product                                103   3e-21   Albugo candida
ref|XP_006415620.1|  hypothetical protein EUTSA_v10007172mg             101   3e-21   Eutrema salsugineum [saltwater cress]
emb|CBN73858.1|  Putative sodium calcium exchanger                    99.8    3e-21   Ectocarpus siliculosus
ref|XP_009629500.1|  PREDICTED: uncharacterized protein LOC104119642    101   3e-21   Nicotiana tomentosiformis
gb|EJK62281.1|  hypothetical protein THAOC_17107                        100   5e-21   Thalassiosira oceanica
ref|XP_009353170.1|  PREDICTED: uncharacterized protein LOC103944425    100   6e-21   
ref|XP_002305761.1|  hypothetical protein POPTR_0004s05210g             100   8e-21   
ref|XP_010549555.1|  PREDICTED: uncharacterized protein LOC104820693  99.8    1e-20   
ref|XP_001742689.1|  hypothetical protein                             92.8    4e-20   
ref|XP_002893543.1|  predicted protein                                99.0    4e-20   
gb|KFK44728.1|  hypothetical protein AALP_AA1G295100                  97.8    4e-20   
ref|XP_002296137.1|  EF containing protein                            96.7    4e-20   
ref|XP_003288984.1|  hypothetical protein DICPUDRAFT_153287           97.8    5e-20   
emb|CCA15196.1|  Ca2 :Cation Antiporter (CaCA) Family putative        97.8    6e-20   
ref|XP_002907451.1|  Ca2 :Cation Antiporter (CaCA) Family             97.1    1e-19   
ref|XP_010058976.1|  PREDICTED: uncharacterized protein LOC104446874  96.7    1e-19   
ref|XP_010460672.1|  PREDICTED: uncharacterized protein LOC104741492  95.9    2e-19   
ref|XP_009032139.1|  hypothetical protein AURANDRAFT_8067             90.5    3e-19   
ref|NP_001185109.1|  Calcium-binding EF-hand family protein           95.5    3e-19   
dbj|BAF00582.1|  hypothetical protein                                 95.5    3e-19   
ref|XP_008897040.1|  hypothetical protein PPTG_05278                  93.2    2e-18   
gb|ETK74657.1|  hypothetical protein L915_18596                       93.2    2e-18   
ref|XP_009033565.1|  hypothetical protein AURANDRAFT_8128             87.8    3e-18   
gb|KFK23895.1|  hypothetical protein AALP_AAs69390U000300             92.4    3e-18   
ref|XP_010499420.1|  PREDICTED: uncharacterized protein LOC104776935  92.0    5e-18   
emb|CBK20420.2|  unnamed protein product                              89.0    1e-17   
ref|XP_009517896.1|  hypothetical protein PHYSODRAFT_349569           90.1    2e-17   
ref|XP_006306439.1|  hypothetical protein CARUB_v10012381mg           88.2    1e-16   
ref|XP_003057911.1|  predicted protein                                87.4    2e-16   
gb|EWM24964.1|  ca2 :cation antiporter family                         86.7    4e-16   
ref|XP_642144.1|  hypothetical protein DDB_G0278609                   86.3    5e-16   
ref|XP_009032349.1|  hypothetical protein AURANDRAFT_19015            81.6    6e-16   
gb|EPS70685.1|  hypothetical protein M569_04074                       83.2    6e-16   
ref|XP_002185522.1|  predicted protein                                85.5    8e-16   
gb|KJB45757.1|  hypothetical protein B456_007G325800                  84.7    1e-15   
gb|KJB13247.1|  hypothetical protein B456_002G064800                  84.3    2e-15   
gb|KJB13245.1|  hypothetical protein B456_002G064800                  84.3    2e-15   
gb|KCW69971.1|  hypothetical protein EUGRSUZ_F03285                   82.0    9e-15   
ref|XP_009762341.1|  PREDICTED: uncharacterized protein LOC104214380  75.9    1e-13   
gb|EAZ04370.1|  hypothetical protein OsI_26513                        77.8    3e-13   
ref|XP_005719417.1|  unnamed protein product                          77.8    4e-13   
ref|XP_002781327.1|  conserved hypothetical protein                   72.0    9e-13   
emb|CAN66793.1|  hypothetical protein VITISV_034151                   73.9    3e-12   
dbj|BAD44247.1|  unknown protein                                      68.2    6e-12   
gb|EFA82832.1|  hypothetical protein PPL_04527                        72.8    2e-11   
ref|XP_002893544.1|  predicted protein                                65.5    3e-09   
ref|XP_002769715.1|  conserved hypothetical protein                   59.3    3e-08   
gb|KFK44727.1|  hypothetical protein AALP_AA1G295000                  58.9    4e-07   
ref|XP_011087014.1|  PREDICTED: uncharacterized protein LOC105168577  54.7    1e-05   
gb|KEH38649.1|  calcium-binding EF-hand protein                       51.6    1e-04   
ref|XP_011000239.1|  PREDICTED: uncharacterized protein LOC105107...  51.2    2e-04   
ref|XP_011460766.1|  PREDICTED: uncharacterized protein LOC105350...  49.3    3e-04   



>emb|CDP05978.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/129 (93%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIP+FFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL
Sbjct  359  FSSATSIPSFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  418

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVYARGLTWDFSSEVLVILIVCIVMG+FGS+R+TFPLWTS IAF LYP S+ALVY
Sbjct  419  SVFLALVYARGLTWDFSSEVLVILIVCIVMGIFGSLRTTFPLWTSLIAFLLYPFSLALVY  478

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  479  VLDYVFGWS  487



>gb|EYU44997.1| hypothetical protein MIMGU_mgv1a003664mg [Erythranthe guttata]
Length=571

 Score =   232 bits (591),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+RSASLTFSELYGAVTMNN LCL
Sbjct  443  FSAATSIPTFFISFIALPLATNSSEAVSAIIFASRKKIRSASLTFSELYGAVTMNNALCL  502

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFL LVY RGLTWDFSSEVLVILIVCIVMGVF S+R+TFPLWT+ +AF LYP S+ALVY
Sbjct  503  SVFLGLVYVRGLTWDFSSEVLVILIVCIVMGVFASVRTTFPLWTAILAFLLYPFSLALVY  562

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  563  VLDYVFGWS  571



>ref|XP_011082732.1| PREDICTED: uncharacterized protein LOC105165426 [Sesamum indicum]
Length=567

 Score =   232 bits (591),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IPTFFISFIALPLATNSSEAVSAIIFA+RKKLRSASLTFSELYGAVTMNN LCL
Sbjct  439  FSDATKIPTFFISFIALPLATNSSEAVSAIIFATRKKLRSASLTFSELYGAVTMNNALCL  498

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGL WDFSSEVLVILIVCIVMGVF S+R+TFPLWT+F+AF LYP S+ALVY
Sbjct  499  SVFLALVYVRGLVWDFSSEVLVILIVCIVMGVFASIRTTFPLWTAFLAFLLYPFSLALVY  558

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  559  VLDYVFGWS  567



>gb|EPS64918.1| sodium/calcium exchanger family protein, partial [Genlisea aurea]
Length=519

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISF+ALPLATNSSEAVSA+IFA+RKKLRSASLTFSELYGAVTMNNVLCL
Sbjct  391  FSAATSIPTFFISFVALPLATNSSEAVSAVIFATRKKLRSASLTFSELYGAVTMNNVLCL  450

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGL WDFSSEVLVIL+VC+VMGVF S+R+TFPLWTS +AF+LYP+S+ALVY
Sbjct  451  SVFLAIVYVRGLVWDFSSEVLVILMVCVVMGVFASVRTTFPLWTSLLAFALYPVSLALVY  510

Query  230  VLDYVFGWS  204
            VLDY FGWS
Sbjct  511  VLDYQFGWS  519



>ref|XP_010098421.1| hypothetical protein L484_012136 [Morus notabilis]
 gb|EXB75012.1| hypothetical protein L484_012136 [Morus notabilis]
Length=578

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIPTFFISFIALPLATNSSEAVSAIIFA+RKK R++SLTFSE+YGAVTMNNVLCL
Sbjct  450  FSSATSIPTFFISFIALPLATNSSEAVSAIIFATRKKKRTSSLTFSEIYGAVTMNNVLCL  509

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVYARGLTWDFSSEVLVILIVCIVMG+FGS R+TFPLWTS +AF LYP S+ALVY
Sbjct  510  SVFLALVYARGLTWDFSSEVLVILIVCIVMGLFGSFRTTFPLWTSSVAFLLYPFSLALVY  569

Query  230  VLDYVFGWS  204
            VLDY FGWS
Sbjct  570  VLDYFFGWS  578



>ref|XP_004244257.1| PREDICTED: uncharacterized protein LOC101263533 [Solanum lycopersicum]
Length=589

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIP+FFISFIALPLATNSSEAVSAIIFA+RKK RSASLTFSELYGAVTMNN+LCL
Sbjct  461  FSSATSIPSFFISFIALPLATNSSEAVSAIIFATRKKQRSASLTFSELYGAVTMNNLLCL  520

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VYARGLTW+FSSEVLVILIVCIV+GV GS+R+TFPLWTS IAF+ YP S+ LVY
Sbjct  521  SVFLAIVYARGLTWNFSSEVLVILIVCIVIGVLGSIRTTFPLWTSLIAFAFYPFSLVLVY  580

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  581  VLDYVFGWS  589



>gb|KJB45756.1| hypothetical protein B456_007G325800 [Gossypium raimondii]
Length=578

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FFISFIALPLATNSSEAVSAIIFA+RKK R+ASLTFSELYGAVTMNNVLCL
Sbjct  450  FSTATSIPSFFISFIALPLATNSSEAVSAIIFATRKKQRTASLTFSELYGAVTMNNVLCL  509

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFSSEVLVILIVCIVMG F S R+TFPLWT  IA+ LYP S+ALVY
Sbjct  510  SVFLALVYVRGLTWDFSSEVLVILIVCIVMGAFASFRTTFPLWTCSIAYILYPFSLALVY  569

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  570  VLDYVFGWS  578



>gb|KHG29939.1| Vacuolar calcium ion transporter [Gossypium arboreum]
Length=578

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FFISFIALPLATNSSEAVSAIIFA+RKK R+ASLTFSELYGAVTMNNVLCL
Sbjct  450  FSTATSIPSFFISFIALPLATNSSEAVSAIIFATRKKQRTASLTFSELYGAVTMNNVLCL  509

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFSSEVLVILIVCIVMG F S R+TFPLWT  IA+ LYP S+ALVY
Sbjct  510  SVFLALVYVRGLTWDFSSEVLVILIVCIVMGAFASFRTTFPLWTCSIAYILYPFSLALVY  569

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  570  VLDYVFGWS  578



>ref|XP_002522155.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF40234.1| calcium ion binding protein, putative [Ricinus communis]
Length=543

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRK LR+ASLTFSELYGAVTMNN+LCL
Sbjct  415  FSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKTLRTASLTFSELYGAVTMNNLLCL  474

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFSSEVLVI IVCIVMG F S R+TFPLWTS IA+ LYP S+ALVY
Sbjct  475  SVFLALVYCRGLTWDFSSEVLVIFIVCIVMGAFASFRTTFPLWTSSIAYFLYPFSLALVY  534

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  535  VLDYVFGWS  543



>gb|KCW67441.1| hypothetical protein EUGRSUZ_F011931, partial [Eucalyptus grandis]
Length=242

 Score =   217 bits (552),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IPTFFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNN+LCL
Sbjct  114  FSDATGIPTFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNLLCL  173

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY +GLTWDFSSEVLVILIVC VMG F S R+TFPLWT  +A  LYP S+ALVY
Sbjct  174  SVFLAIVYIKGLTWDFSSEVLVILIVCFVMGTFASFRTTFPLWTFSLALLLYPFSLALVY  233

Query  230  VLDYVFGWS  204
            +LDY+FGWS
Sbjct  234  ILDYIFGWS  242



>ref|XP_008386231.1| PREDICTED: uncharacterized protein LOC103448741 [Malus domestica]
Length=584

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSELYGAVTMNN+LCL
Sbjct  456  FSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNLLCL  515

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY RGLTWDFS+EVLVILIVCIVMG+ GS R+ FPLWTS IAF LYP S+ALVY
Sbjct  516  AVFLALVYVRGLTWDFSAEVLVILIVCIVMGLLGSFRTVFPLWTSSIAFLLYPFSLALVY  575

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  576  VLDYVLGWS  584



>ref|XP_006348283.1| PREDICTED: uncharacterized protein LOC102600810 [Solanum tuberosum]
Length=589

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIP+FFISFIALPLATNSSEAVSAIIFA+RKK RSASLTFSELYGAVTMNN+LCL
Sbjct  461  FSSATSIPSFFISFIALPLATNSSEAVSAIIFATRKKKRSASLTFSELYGAVTMNNLLCL  520

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY+RGL W+FSSEVLVILIVCIVMG+ GS+R+TFPLWT  IAF+LYP S+ LVY
Sbjct  521  SVFLAIVYSRGLVWNFSSEVLVILIVCIVMGILGSIRTTFPLWTCLIAFALYPFSLVLVY  580

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  581  VLDYVFGWS  589



>ref|XP_007021648.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
 gb|EOY13173.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
Length=578

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNNVLCL
Sbjct  450  FSDATSIPSFFISFIALPLATNSSEAVSAIIFASRKKKRTASLTFSELYGAVTMNNVLCL  509

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFSSEVLVILIVCIVMG F S R+TFPLWT  +A+ LYP S+ALVY
Sbjct  510  SVFLALVYVRGLTWDFSSEVLVILIVCIVMGAFASFRTTFPLWTCSVAYLLYPFSLALVY  569

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  570  VLDYVFGWS  578



>ref|XP_009340381.1| PREDICTED: uncharacterized protein LOC103932481 [Pyrus x bretschneideri]
Length=585

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSELYGAVTMNN+LCL
Sbjct  457  FSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKMRTASLTFSELYGAVTMNNLLCL  516

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY RGLTWDFS+EVLVILIVCIVMG+ GS R+ FPLWTS IAF LYP S+ALVY
Sbjct  517  AVFLALVYIRGLTWDFSAEVLVILIVCIVMGLLGSFRTVFPLWTSSIAFLLYPFSLALVY  576

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  577  VLDYVVGWS  585



>ref|XP_010675392.1| PREDICTED: uncharacterized protein LOC104891403 [Beta vulgaris 
subsp. vulgaris]
Length=572

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISFIALPLATNSSEAVSAIIFA+RKK +SASLTFSELYGAVTMNNVLCL
Sbjct  444  FSDATSIPSFFISFIALPLATNSSEAVSAIIFATRKKTKSASLTFSELYGAVTMNNVLCL  503

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVYARGL+WDFSSEVLVI +VC++MG  GS R+TFPLWT+ +AF LYPLS+ LVY
Sbjct  504  SVFLALVYARGLSWDFSSEVLVIFLVCVIMGALGSFRTTFPLWTTIVAFLLYPLSLVLVY  563

Query  230  VLDYVFGWS  204
            VLDY+FGWS
Sbjct  564  VLDYIFGWS  572



>gb|KCW67438.1| hypothetical protein EUGRSUZ_F01191 [Eucalyptus grandis]
Length=345

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IPTFFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNN+LCL
Sbjct  217  FSDATGIPTFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNLLCL  276

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTWDFSSEVLVILIVC VMG F S R+TFPLWT  +A  LYP S+ALVY
Sbjct  277  SVFLAIVYIRGLTWDFSSEVLVILIVCFVMGTFASFRTTFPLWTFSLALLLYPFSLALVY  336

Query  230  VLDYVFGWS  204
            VLDY+FGWS
Sbjct  337  VLDYIFGWS  345



>ref|XP_006451747.1| hypothetical protein CICLE_v10007809mg [Citrus clementina]
 ref|XP_006494847.1| PREDICTED: uncharacterized protein LOC102612450 [Citrus sinensis]
 gb|ESR64987.1| hypothetical protein CICLE_v10007809mg [Citrus clementina]
 gb|KDO58493.1| hypothetical protein CISIN_1g048038mg [Citrus sinensis]
Length=591

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISFIALP ATNSSEAVSAIIFASRKK+R+ASLTFSELYGAVTMNN+LCL
Sbjct  463  FSAATSIPSFFISFIALPFATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILCL  522

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVYARGLTWDFSSEVLVILIVC+VMG F S R+ FPLWT  IA++LYP S+ALVY
Sbjct  523  SVFLALVYARGLTWDFSSEVLVILIVCLVMGAFASFRTNFPLWTCSIAYALYPFSLALVY  582

Query  230  VLDYVFGWS  204
            VLDY FGWS
Sbjct  583  VLDYFFGWS  591



>gb|EPS57671.1| hypothetical protein M569_17145, partial [Genlisea aurea]
Length=448

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+AT IPTFFISF+ALPLATNSSEAVSAIIFASRKK+RSASLTFSELYGA TMNNVLCL
Sbjct  320  FSSATKIPTFFISFVALPLATNSSEAVSAIIFASRKKMRSASLTFSELYGAATMNNVLCL  379

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGL W+FSSEVLVILIVCI +GVFGS R+TFPLW+  +AF LYP S+ LVY
Sbjct  380  SVFLALVYVRGLNWNFSSEVLVILIVCIAIGVFGSFRTTFPLWSCSVAFFLYPFSLGLVY  439

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  440  LLDYHFGWS  448



>gb|KCW67437.1| hypothetical protein EUGRSUZ_F01191 [Eucalyptus grandis]
Length=429

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IPTFFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNN+LCL
Sbjct  301  FSDATGIPTFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNLLCL  360

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTWDFSSEVLVILIVC VMG F S R+TFPLWT  +A  LYP S+ALVY
Sbjct  361  SVFLAIVYIRGLTWDFSSEVLVILIVCFVMGTFASFRTTFPLWTFSLALLLYPFSLALVY  420

Query  230  VLDYVFGWS  204
            VLDY+FGWS
Sbjct  421  VLDYIFGWS  429



>ref|XP_009604315.1| PREDICTED: uncharacterized protein LOC104099119 [Nicotiana tomentosiformis]
Length=574

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIPTFFISFIALPLATNSSEAVSAIIFASRK  +SASLTFSELYGAVTMNN+LCL
Sbjct  446  FSSATSIPTFFISFIALPLATNSSEAVSAIIFASRKNKKSASLTFSELYGAVTMNNLLCL  505

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC++MGV GS+ +TFPLWT  IAF LYP+S+ LVY
Sbjct  506  SVFLAIVYIRGLTWNFSSEVLVILIVCVIMGVLGSIHTTFPLWTCSIAFLLYPMSLVLVY  565

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  566  VLDYVFGWS  574



>dbj|BAD43479.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43742.1| unknown protein, partial [Arabidopsis thaliana]
 dbj|BAD43909.1| unknown protein, partial [Arabidopsis thaliana]
Length=148

 Score =   208 bits (530),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  20   FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  79

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  80   SVFLAIVYVRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVY  139

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  140  ILDYWFGWS  148



>dbj|BAI94501.1| sodium/calcium exchanger protein [Dianthus caryophyllus]
Length=581

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FFISFIALPLATNSSEAVSAIIFASRKK RSASLTFSELYGA TMNNVLCL
Sbjct  453  FSTATSIPSFFISFIALPLATNSSEAVSAIIFASRKKRRSASLTFSELYGAATMNNVLCL  512

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGL+WDFSSEVLVI +VC +MG  GS +++FPLWT+ IAF LYP S+ LVY
Sbjct  513  SVFLALVYVRGLSWDFSSEVLVIFLVCTIMGALGSFKTSFPLWTASIAFFLYPFSLVLVY  572

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  573  VLDYVFGWS  581



>gb|EMS45634.1| hypothetical protein TRIUR3_11261 [Triticum urartu]
Length=427

 Score =   214 bits (546),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  299  FSSATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCL  358

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY RGLTWDFSSEVLVI +VCI+MG+F S R+ FPLWT F+AF LYPLS+ LVY
Sbjct  359  AVFLALVYVRGLTWDFSSEVLVIFLVCIIMGLFTSFRTKFPLWTCFVAFLLYPLSLVLVY  418

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  419  ILDYKFGWS  427



>gb|KFK35737.1| hypothetical protein AALP_AA4G030000 [Arabis alpina]
Length=533

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  405  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  464

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVCIVMG F S R+T+PLWT FIA++LYP S+ LVY
Sbjct  465  SVFLAIVYVRGLTWNFSSEVLVILIVCIVMGTFASFRTTYPLWTCFIAYALYPFSLGLVY  524

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  525  ILDYWFGWS  533



>ref|XP_010060650.1| PREDICTED: uncharacterized protein LOC104448506 [Eucalyptus grandis]
 gb|KCW67435.1| hypothetical protein EUGRSUZ_F01191 [Eucalyptus grandis]
Length=589

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IPTFFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNN+LCL
Sbjct  461  FSDATGIPTFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNLLCL  520

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTWDFSSEVLVILIVC VMG F S R+TFPLWT  +A  LYP S+ALVY
Sbjct  521  SVFLAIVYIRGLTWDFSSEVLVILIVCFVMGTFASFRTTFPLWTFSLALLLYPFSLALVY  580

Query  230  VLDYVFGWS  204
            VLDY+FGWS
Sbjct  581  VLDYIFGWS  589



>ref|XP_004489056.1| PREDICTED: uncharacterized protein LOC101505490 [Cicer arietinum]
Length=583

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP FFISFI LPLATNSSEAVSAIIFASR K ++ASLTFSE+YGAVTMNNVLCL
Sbjct  455  FSEATSIPAFFISFIFLPLATNSSEAVSAIIFASRDKRQTASLTFSEIYGAVTMNNVLCL  514

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVYARGLTWDFSSEVLVILIVCIVMGVF S R+ FPLWTS +A  LYP S+ LVY
Sbjct  515  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFASFRTVFPLWTSILAILLYPFSLVLVY  574

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  575  VLDYVFGWS  583



>ref|XP_011000241.1| PREDICTED: uncharacterized protein LOC105107868 [Populus euphratica]
Length=589

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+ +ASLTFSELYGAVTMNNVLCL
Sbjct  461  FSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKVTTASLTFSELYGAVTMNNVLCL  520

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY R LTWDFS+EVLVI IVCIVMG F S R+TFPLWTSF+A+ LYP S+ LVY
Sbjct  521  SVFLALVYFRELTWDFSAEVLVICIVCIVMGAFASFRTTFPLWTSFLAYFLYPFSLVLVY  580

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  581  VLDYVLGWS  589



>gb|KEH38643.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=443

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP FFISFI LPLATNSSEAVSAIIFASR K ++ASLTFSE+YGAVTMNNVLCL
Sbjct  315  FSDATSIPAFFISFIFLPLATNSSEAVSAIIFASRDKRQTASLTFSEIYGAVTMNNVLCL  374

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFSSEVLVILIVCIVMG F S R+ FPLWTS  A  LYP S+ALVY
Sbjct  375  SVFLALVYVRGLTWDFSSEVLVILIVCIVMGAFASFRTVFPLWTSITAILLYPFSLALVY  434

Query  230  VLDYVFGWS  204
            VLDY FGWS
Sbjct  435  VLDYQFGWS  443



>ref|XP_010279178.1| PREDICTED: uncharacterized protein LOC104613162 [Nelumbo nucifera]
Length=577

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIP+FFISFIALPLATNSSEAVSA+IFASRKK ++ASLTFSE+YGA TMNN+LCL
Sbjct  449  FSSATSIPSFFISFIALPLATNSSEAVSALIFASRKKKKTASLTFSEIYGAATMNNILCL  508

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY R LTWDFS+EVLVILIVCIVMG+F S R+TFPLWT  +AF LYP S+ LVY
Sbjct  509  SVFLALVYVRHLTWDFSAEVLVILIVCIVMGLFASFRTTFPLWTCSVAFVLYPFSLVLVY  568

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  569  VLDYVFGWS  577



>ref|XP_007149412.1| hypothetical protein PHAVU_005G068100g [Phaseolus vulgaris]
 gb|ESW21406.1| hypothetical protein PHAVU_005G068100g [Phaseolus vulgaris]
Length=576

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP FFISFI LPLATNSSEAVSAIIFASR K ++ASLTFSE+YGAVTMNNVLCL
Sbjct  448  FSEATSIPAFFISFIFLPLATNSSEAVSAIIFASRDKRQTASLTFSEIYGAVTMNNVLCL  507

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVYARGLTWDFSSEVLVIL+VCI++GVF S R+ FPLWTS +A  LYP S+ALVY
Sbjct  508  SVFLALVYARGLTWDFSSEVLVILVVCILLGVFASFRTVFPLWTSILAILLYPFSLALVY  567

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  568  VLDYVFGWS  576



>gb|EMT05376.1| hypothetical protein F775_06447 [Aegilops tauschii]
Length=503

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  375  FSSATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCL  434

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY RGLTWDFSSEVLVI +VCI+MG+F S R+ FPLWT F+AF LYPLS+ LVY
Sbjct  435  AVFLALVYIRGLTWDFSSEVLVIFLVCIIMGLFTSFRTKFPLWTCFVAFLLYPLSLVLVY  494

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  495  ILDYKFGWS  503



>ref|XP_006307087.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
 gb|EOA39985.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
Length=461

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  333  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  392

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  393  SVFLAIVYLRGLTWNFSSEVLVILIVCLVMGSFASFRTTYPLWTCFIAYLLYPFSLGLVY  452

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  453  ILDYWFGWS  461



>gb|AAK32813.1|AF361800_1 At1g53210/F12M16_12 [Arabidopsis thaliana]
 gb|AAM91449.1| At1g53210/F12M16_12 [Arabidopsis thaliana]
Length=493

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  365  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  424

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  425  SVFLAIVYVRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVY  484

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  485  ILDYWFGWS  493



>ref|XP_010519243.1| PREDICTED: uncharacterized protein LOC104798750 [Tarenaya hassleriana]
Length=587

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  459  FSAATSIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  518

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVYARGLTW+FSSEVLVILIVC+VM  F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  519  SVFLALVYARGLTWNFSSEVLVILIVCLVMSGFASFRTTYPLWTCFIAYLLYPFSLGLVY  578

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  579  ILDYWFGWS  587



>emb|CDY25869.1| BnaA05g14600D [Brassica napus]
Length=585

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  457  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  516

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  517  SVFLAIVYVRGLTWNFSSEVLVILIVCLVMGCFASFRTTYPLWTCFIAYLLYPFSLGLVY  576

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  577  ILDYWFGWS  585



>ref|XP_009144785.1| PREDICTED: uncharacterized protein LOC103868446 [Brassica rapa]
Length=585

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  457  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  516

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  517  SVFLAIVYVRGLTWNFSSEVLVILIVCLVMGCFASFRTTYPLWTCFIAYLLYPFSLGLVY  576

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  577  ILDYWFGWS  585



>ref|XP_010042553.1| PREDICTED: uncharacterized protein LOC104431654, partial [Eucalyptus 
grandis]
Length=290

 Score =   206 bits (524),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 116/142 (82%), Gaps = 13/142 (9%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFS-------------E  450
            FS +T IPTFFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFS             +
Sbjct  149  FSDSTGIPTFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSGGGVAPFYRFFLMQ  208

Query  449  LYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFI  270
            LYGAVTMNN+LCLSVFLA+VY RGLTWDFSSEVLVILIVC VMG F S R+TFPLWT  +
Sbjct  209  LYGAVTMNNLLCLSVFLAIVYIRGLTWDFSSEVLVILIVCFVMGTFASFRTTFPLWTFSL  268

Query  269  AFSLYPLSIALVYVLDYVFGWS  204
            A  LYP S+ALVYVLDY+FGWS
Sbjct  269  ALLLYPFSLALVYVLDYIFGWS  290



>emb|CDY55841.1| BnaCnng29300D [Brassica napus]
Length=585

 Score =   213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  457  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  516

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  517  SVFLAIVYVRGLTWNFSSEVLVILIVCLVMGCFASFRTTYPLWTCFIAYLLYPFSLGLVY  576

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  577  ILDYWFGWS  585



>ref|XP_002298903.2| sodium/calcium exchanger family protein [Populus trichocarpa]
 gb|EEE83708.2| sodium/calcium exchanger family protein [Populus trichocarpa]
Length=582

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+ +ASLTFSELYGAVTMNNVLCL
Sbjct  454  FSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKVTTASLTFSELYGAVTMNNVLCL  513

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY R LTWDFS+EVLVI IVCI MG F S R+TFPLWT F+A+ LYP S+ LVY
Sbjct  514  SVFLALVYFRELTWDFSAEVLVICIVCIAMGAFASFRTTFPLWTCFLAYFLYPFSLVLVY  573

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  574  VLDYVLGWS  582



>ref|XP_007213956.1| hypothetical protein PRUPE_ppa004823mg [Prunus persica]
 gb|EMJ15155.1| hypothetical protein PRUPE_ppa004823mg [Prunus persica]
Length=490

 Score =   211 bits (537),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIPTFFISF+ALPLAT S EAVSAI+FASRKK+R+ASLTFS+LYG+ TMNNVLCL
Sbjct  363  FSSATSIPTFFISFVALPLAT-SCEAVSAIMFASRKKIRTASLTFSQLYGSATMNNVLCL  421

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGL WDFS+EVLVILIVCIVMGVF S R+ FPLWTS IAF LYP S+AL+Y
Sbjct  422  SVFLALVYFRGLEWDFSAEVLVILIVCIVMGVFSSFRTVFPLWTSSIAFLLYPFSVALIY  481

Query  230  VLDYVFGWS  204
            VLDYV+GWS
Sbjct  482  VLDYVYGWS  490



>gb|AAF69532.1|AC008007_7 F12M16.12 [Arabidopsis thaliana]
Length=574

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  446  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  505

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  506  SVFLAIVYVRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVY  565

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  566  ILDYWFGWS  574



>ref|XP_011098256.1| PREDICTED: uncharacterized protein LOC105176958 isoform X2 [Sesamum 
indicum]
Length=569

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FFISFI LPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL
Sbjct  441  FSTATSIPSFFISFIVLPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  500

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGL WDFSSEVLVILIVC+VMGVF S+R+TFPLWTS +AF LYP S+ALVY
Sbjct  501  SVFLALVYVRGLVWDFSSEVLVILIVCVVMGVFASIRTTFPLWTSLLAFLLYPFSLALVY  560

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  561  VLDYVFGWS  569



>ref|NP_564623.2| Na+/Ca 2+ exchanger-like protein [Arabidopsis thaliana]
 gb|AAM20402.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32908.1| sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Arabidopsis thaliana]
Length=585

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  457  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  516

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  517  SVFLAIVYVRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVY  576

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  577  ILDYWFGWS  585



>ref|XP_009147618.1| PREDICTED: uncharacterized protein LOC103871140 [Brassica rapa]
Length=576

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  448  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  507

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  508  SVFLAIVYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVY  567

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  568  ILDYWFGWS  576



>ref|XP_006392816.1| hypothetical protein EUTSA_v10011341mg [Eutrema salsugineum]
 gb|ESQ30102.1| hypothetical protein EUTSA_v10011341mg [Eutrema salsugineum]
Length=585

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  457  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  516

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  517  SVFLAIVYVRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVY  576

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  577  ILDYWFGWS  585



>ref|XP_010479874.1| PREDICTED: uncharacterized protein LOC104758667 [Camelina sativa]
Length=585

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  457  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  516

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  517  SVFLAIVYLRGLTWNFSSEVLVILIVCLVMGSFASFRTTYPLWTCFIAYLLYPFSLGLVY  576

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  577  ILDYWFGWS  585



>ref|XP_010462200.1| PREDICTED: uncharacterized protein LOC104742841 [Camelina sativa]
Length=581

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  453  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  512

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  513  SVFLAIVYLRGLTWNFSSEVLVILIVCLVMGSFASFRTTYPLWTCFIAYLLYPFSLGLVY  572

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  573  ILDYWFGWS  581



>ref|XP_006307086.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
 gb|EOA39984.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
Length=585

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  457  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  516

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  517  SVFLAIVYLRGLTWNFSSEVLVILIVCLVMGSFASFRTTYPLWTCFIAYLLYPFSLGLVY  576

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  577  ILDYWFGWS  585



>ref|XP_009106991.1| PREDICTED: uncharacterized protein LOC103832685 [Brassica rapa]
 emb|CDY02520.1| BnaA08g01270D [Brassica napus]
Length=583

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  455  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  514

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  515  SVFLAIVYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVY  574

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  575  ILDYWFGWS  583



>ref|XP_010500958.1| PREDICTED: uncharacterized protein LOC104778258 [Camelina sativa]
Length=585

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  457  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  516

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  517  SVFLAIVYLRGLTWNFSSEVLVILIVCLVMGSFASFRTTYPLWTCFIAYLLYPFSLGLVY  576

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  577  ILDYWFGWS  585



>emb|CDY24108.1| BnaA06g01060D [Brassica napus]
Length=648

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  520  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  579

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  580  SVFLAIVYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVY  639

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  640  ILDYWFGWS  648



>gb|ACN35869.1| unknown [Zea mays]
Length=432

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  304  FSNATRIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  363

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYPLS+ +VY
Sbjct  364  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPLSLIIVY  423

Query  230  VLDYVFGWS  204
            +LDYVFGWS
Sbjct  424  ILDYVFGWS  432



>emb|CDY25725.1| BnaC03g69500D [Brassica napus]
Length=581

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  453  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNILCL  512

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  513  SVFLAIVYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVY  572

Query  230  VLDYVFGWS  204
            +LDY FGW+
Sbjct  573  ILDYWFGWA  581



>gb|ACN36915.1| unknown [Zea mays]
Length=455

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  327  FSNATRIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  386

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A++LYPLS+ +VY
Sbjct  387  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYTLYPLSLIIVY  446

Query  230  VLDYVFGWS  204
            +LDYVFGWS
Sbjct  447  ILDYVFGWS  455



>ref|XP_009348414.1| PREDICTED: uncharacterized protein LOC103940068 [Pyrus x bretschneideri]
 ref|XP_009348417.1| PREDICTED: uncharacterized protein LOC103940071 [Pyrus x bretschneideri]
Length=549

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSELYGAVTMNN+LCL
Sbjct  421  FSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNLLCL  480

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVYARGLTWDFSSEVLVILIVC+VMG+ GS+R+ FPLWTS IA+ LYP S+ALVY
Sbjct  481  AVFLALVYARGLTWDFSSEVLVILIVCVVMGLLGSLRTVFPLWTSSIAYLLYPFSLALVY  540

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  541  VLDYVFGWS  549



>gb|KDP36271.1| hypothetical protein JCGZ_09836 [Jatropha curcas]
Length=585

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALP ATNSSEAVSAIIFASRK  R+ASLTFSELYGAVTMNN+LCL
Sbjct  457  FSDATSIPTFFISFIALPFATNSSEAVSAIIFASRKSKRTASLTFSELYGAVTMNNLLCL  516

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFS+EVLVILIVCIVMG F S  +TF LWT  +AF LYP S+ALVY
Sbjct  517  SVFLALVYLRGLTWDFSAEVLVILIVCIVMGAFASFSTTFRLWTCSVAFLLYPFSLALVY  576

Query  230  VLDYVFGWS  204
            VLDY+ GWS
Sbjct  577  VLDYILGWS  585



>ref|XP_003571165.2| PREDICTED: uncharacterized protein LOC100833492 isoform X1 [Brachypodium 
distachyon]
Length=639

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  511  FSSATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCL  570

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY RGLTWDFSSEVLVI +VCI+MG+F S R+ FPLWT F+AF LYPLS+ +VY
Sbjct  571  AVFLALVYLRGLTWDFSSEVLVIFLVCIIMGLFTSFRTKFPLWTCFVAFLLYPLSLLMVY  630

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  631  ILDYKFGWS  639



>ref|XP_002891737.1| sodium/calcium exchanger family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67996.1| sodium/calcium exchanger family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSE+ G VTMNN+LCL
Sbjct  460  FSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSEICGGVTMNNILCL  519

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  520  SVFLAIVYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVY  579

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  580  ILDYWFGWS  588



>ref|XP_010234099.1| PREDICTED: uncharacterized protein LOC100833492 isoform X2 [Brachypodium 
distachyon]
Length=666

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  538  FSSATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCL  597

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY RGLTWDFSSEVLVI +VCI+MG+F S R+ FPLWT F+AF LYPLS+ +VY
Sbjct  598  AVFLALVYLRGLTWDFSSEVLVIFLVCIIMGLFTSFRTKFPLWTCFVAFLLYPLSLLMVY  657

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  658  ILDYKFGWS  666



>ref|XP_009593456.1| PREDICTED: uncharacterized protein LOC104090114 [Nicotiana tomentosiformis]
Length=564

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+AT IP+FFISFI LP ATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN+LCL
Sbjct  436  FSSATGIPSFFISFIVLPFATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNLLCL  495

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVYARGLTWDFSSEVLVILIVC+VMGVF S+RSTFPLWTS +AF LYPLS+ LVY
Sbjct  496  SVFLALVYARGLTWDFSSEVLVILIVCVVMGVFASVRSTFPLWTSLVAFLLYPLSLVLVY  555

Query  230  VLDYVFGWS  204
            VLDY FGWS
Sbjct  556  VLDYKFGWS  564



>ref|XP_008226455.1| PREDICTED: uncharacterized protein LOC103326029 [Prunus mume]
Length=592

 Score =   211 bits (536),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISF+ALPLAT S EAVSAI+FASRKK+R+ASLTFS+LYG+ TMNNVLCL
Sbjct  465  FSNATSIPTFFISFVALPLAT-SCEAVSAIMFASRKKIRTASLTFSQLYGSATMNNVLCL  523

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGL WDFS+EVLVILIVCIVMGVF S R+ FPLWTS IAF LYP S+AL+Y
Sbjct  524  SVFLALVYFRGLEWDFSAEVLVILIVCIVMGVFSSFRTVFPLWTSSIAFLLYPFSVALIY  583

Query  230  VLDYVFGWS  204
            VLDYV+GWS
Sbjct  584  VLDYVYGWS  592



>emb|CAN76642.1| hypothetical protein VITISV_042742 [Vitis vinifera]
Length=152

 Score =   198 bits (504),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSELYGAVTMNNVLCL
Sbjct  24   FSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKNRTTSLTFSELYGAVTMNNVLCL  83

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFSSEVLVI+IVC+VMGVF S R+TFPLWTSF+A  LYP S+ALVY
Sbjct  84   SVFLALVYVRGLTWDFSSEVLVIVIVCVVMGVFASFRTTFPLWTSFVALLLYPFSLALVY  143

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  144  VLDYVLGWS  152



>ref|XP_003565462.1| PREDICTED: uncharacterized protein LOC100838274 [Brachypodium 
distachyon]
Length=582

 Score =   210 bits (535),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  454  FSNATHIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  513

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVL+IL+VC++MG+F S R+ FPLWT  +A+ LYPLS+A+VY
Sbjct  514  GVFLALIYFRNLTWDFSSEVLIILLVCVIMGLFTSFRTNFPLWTCLVAYLLYPLSLAVVY  573

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  574  VLDYVFGWS  582



>ref|NP_001042378.1| Os01g0212400 [Oryza sativa Japonica Group]
 dbj|BAD73036.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04292.1| Os01g0212400 [Oryza sativa Japonica Group]
 dbj|BAG89983.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70160.1| hypothetical protein OsI_00872 [Oryza sativa Indica Group]
 gb|EEE54102.1| hypothetical protein OsJ_00857 [Oryza sativa Japonica Group]
Length=584

 Score =   210 bits (535),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A+ IP+FFISFIALPLATNSSEAVSAIIFASRKKLR++SLTFSE+YG VTMNN LCL
Sbjct  456  FSNASHIPSFFISFIALPLATNSSEAVSAIIFASRKKLRTSSLTFSEVYGGVTMNNTLCL  515

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVL+IL+VC++MG+F S R+TFPLWT  +A+ LYPLS+ +VY
Sbjct  516  GVFLALIYIRNLTWDFSSEVLIILLVCVIMGLFTSFRTTFPLWTCLVAYMLYPLSLVVVY  575

Query  230  VLDYVFGWS  204
            +LD+VFGWS
Sbjct  576  ILDFVFGWS  584



>gb|EEE56655.1| hypothetical protein OsJ_06069 [Oryza sativa Japonica Group]
Length=575

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFI +PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  447  FSNATHIPSFFISFIVMPLATNSSEAVSAIIFASRKKKRTLSLTFSEVYGGVTMNNTLCL  506

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY RGLTWDFSSEVL+IL+VCI+MG+F S R+ FPLWT F+AF LYPLS+ +VY
Sbjct  507  AVFLALVYVRGLTWDFSSEVLIILLVCIIMGLFTSFRTDFPLWTCFVAFLLYPLSLIMVY  566

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  567  ILDYKFGWS  575



>dbj|BAD19956.1| putative drought-induced protein RDI [Oryza sativa Japonica Group]
 dbj|BAD19782.1| putative drought-induced protein RDI [Oryza sativa Japonica Group]
Length=571

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFI +PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  443  FSNATHIPSFFISFIVMPLATNSSEAVSAIIFASRKKKRTLSLTFSEVYGGVTMNNTLCL  502

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY RGLTWDFSSEVL+IL+VCI+MG+F S R+ FPLWT F+AF LYPLS+ +VY
Sbjct  503  AVFLALVYVRGLTWDFSSEVLIILLVCIIMGLFTSFRTDFPLWTCFVAFLLYPLSLIMVY  562

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  563  ILDYKFGWS  571



>gb|ACN27225.1| unknown [Zea mays]
Length=487

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  359  FSNATRIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  418

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYPLS+ +VY
Sbjct  419  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPLSLIIVY  478

Query  230  VLDYVFGWS  204
            +LDYVFGWS
Sbjct  479  ILDYVFGWS  487



>ref|XP_010915578.1| PREDICTED: uncharacterized protein LOC105040648 [Elaeis guineensis]
Length=590

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT+IP+FFISFIA+PLATNSSEAVSAIIFASRKK R++SLTFSE+YG VTMNN LCL
Sbjct  462  FSLATNIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTSSLTFSEIYGGVTMNNTLCL  521

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY R LTWDFS+EVL+IL+VCIVMG+F S R+TFPLWT  IA+ LYPLS+ LVY
Sbjct  522  AVFLALVYLRHLTWDFSAEVLIILVVCIVMGLFTSFRTTFPLWTCSIAYLLYPLSLVLVY  581

Query  230  VLDYVFGWS  204
            VLD+VFGWS
Sbjct  582  VLDFVFGWS  590



>emb|CDY26003.1| BnaC06g06210D [Brassica napus]
Length=571

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSE+VSAIIFASRKK+R+ASLTFSEL G  TMNN+LCL
Sbjct  443  FSAATGIPSFFISFIALPLATNSSESVSAIIFASRKKIRTASLTFSELCGGATMNNILCL  502

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  503  SVFLAIVYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVY  562

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  563  ILDYWFGWS  571



>gb|EMT26919.1| hypothetical protein F775_25869 [Aegilops tauschii]
Length=469

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FF+SFI LPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  341  FSNATHIPSFFVSFIGLPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  400

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVLVIL+VC++MG+F S R++FPLWT  +A+ LYPL++A+VY
Sbjct  401  GVFLALIYFRELTWDFSSEVLVILLVCVIMGLFTSFRTSFPLWTCLVAYLLYPLTLAVVY  460

Query  230  VLDYVFGWS  204
            VLD+VFGWS
Sbjct  461  VLDFVFGWS  469



>ref|XP_006643900.1| PREDICTED: uncharacterized protein LOC102712578 [Oryza brachyantha]
Length=577

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A+ IP+FFISFIALPLATNSSEAVSAIIFASRKKLR++SLTFSE+YG VTMNN LCL
Sbjct  449  FSNASHIPSFFISFIALPLATNSSEAVSAIIFASRKKLRTSSLTFSEVYGGVTMNNTLCL  508

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVL+IL+VC++MG+F S ++TFPLWT  +A+ LYPLS+ +VY
Sbjct  509  GVFLALIYIRNLTWDFSSEVLIILLVCVIMGLFTSFKTTFPLWTCLVAYMLYPLSLVVVY  568

Query  230  VLDYVFGWS  204
            +LD+VFGWS
Sbjct  569  ILDFVFGWS  577



>ref|XP_008367769.1| PREDICTED: uncharacterized protein LOC103431392 [Malus domestica]
Length=586

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSELYGAVTMNN+LCL
Sbjct  458  FSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNLLCL  517

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVYARGLTWDFSSEVLVILIVC+VMG+ GS+R+ FPLWT  IA+ LYP S+ALVY
Sbjct  518  AVFLALVYARGLTWDFSSEVLVILIVCVVMGLLGSLRTVFPLWTCSIAYLLYPFSLALVY  577

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  578  VLDYVFGWS  586



>ref|XP_002451861.1| hypothetical protein SORBIDRAFT_04g008850 [Sorghum bicolor]
 gb|EES04837.1| hypothetical protein SORBIDRAFT_04g008850 [Sorghum bicolor]
Length=562

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  434  FSNATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCL  493

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFL LVY RGLTWDFSSEVL+I +VC +MG+F S R+ FPLWT F+A+ LYPLS+ +VY
Sbjct  494  AVFLGLVYVRGLTWDFSSEVLIIFLVCTIMGLFTSFRTNFPLWTCFVAYLLYPLSLVIVY  553

Query  230  VLDYVFGWS  204
            VLDY FGWS
Sbjct  554  VLDYKFGWS  562



>gb|EMS61578.1| hypothetical protein TRIUR3_22187 [Triticum urartu]
Length=497

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FF+SFI LPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  369  FSNATHIPSFFVSFIGLPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  428

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVLVIL+VC++MG+F S R++FPLWT  +A+ LYPL++A+VY
Sbjct  429  GVFLALIYFRELTWDFSSEVLVILLVCVIMGLFTSFRTSFPLWTCLVAYLLYPLTLAVVY  488

Query  230  VLDYVFGWS  204
            VLD+VFGWS
Sbjct  489  VLDFVFGWS  497



>ref|XP_009348415.1| PREDICTED: uncharacterized protein LOC103940069 [Pyrus x bretschneideri]
 ref|XP_009348416.1| PREDICTED: uncharacterized protein LOC103940070 [Pyrus x bretschneideri]
Length=580

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTAT IPTFFISFIALPLAT S EAVSAI+FASRKK+R+ SLTFS+LYG+ TMNNVLCL
Sbjct  453  FSTATGIPTFFISFIALPLAT-SCEAVSAIMFASRKKIRTTSLTFSQLYGSATMNNVLCL  511

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY R LTWDFS+EVL+ILIVCIVMGVF S R+ FPLWTS IAF LYP S+AL+Y
Sbjct  512  SVFLALVYFRELTWDFSAEVLIILIVCIVMGVFCSFRTVFPLWTSSIAFLLYPFSVALIY  571

Query  230  VLDYVFGWS  204
            VLDY+FGWS
Sbjct  572  VLDYIFGWS  580



>ref|XP_008673552.1| PREDICTED: uncharacterized protein LOC103649588 [Zea mays]
Length=575

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  447  FSNATHIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  506

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYP S+ LVY
Sbjct  507  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPFSLVLVY  566

Query  230  VLDYVFGWS  204
            +LDYVFGWS
Sbjct  567  ILDYVFGWS  575



>ref|NP_001151543.1| LOC100285177 precursor [Zea mays]
 gb|ACG43258.1| calcium ion binding protein [Zea mays]
Length=568

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  440  FSNATRIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  499

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYPLS+ +VY
Sbjct  500  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPLSLIIVY  559

Query  230  VLDYVFGWS  204
            +LDYVFGWS
Sbjct  560  ILDYVFGWS  568



>gb|ACY66868.1| P20Sh148J07 [Saccharum hybrid cultivar R570]
Length=563

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R++SLTFSE+YG VTMNN LCL
Sbjct  435  FSNATHIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTSSLTFSEVYGGVTMNNTLCL  494

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYP S+ +VY
Sbjct  495  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPFSLVIVY  554

Query  230  VLDYVFGWS  204
            +LDYVFGWS
Sbjct  555  ILDYVFGWS  563



>gb|ACY66874.1| P20Sh095F0 [Saccharum hybrid cultivar R570]
Length=573

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  445  FSNATHIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  504

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYP S+ +VY
Sbjct  505  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPFSLVIVY  564

Query  230  VLDYVFGWS  204
            +LDYVFGWS
Sbjct  565  ILDYVFGWS  573



>ref|XP_008367781.1| PREDICTED: uncharacterized protein LOC103431400 [Malus domestica]
Length=609

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTAT IPTFFISFIALPLAT S EAVSAI+FASRKK+R+ASLTFS+LYG+ TMNNV+CL
Sbjct  482  FSTATGIPTFFISFIALPLAT-SCEAVSAIMFASRKKIRTASLTFSQLYGSATMNNVMCL  540

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY R LTWDFS+EVL+ILIVCIVMGVF S R+ FPLWTS IAF LYP SIAL+Y
Sbjct  541  SVFLALVYFRELTWDFSAEVLIILIVCIVMGVFCSFRTVFPLWTSSIAFLLYPFSIALIY  600

Query  230  VLDYVFGWS  204
            VLDY+ GWS
Sbjct  601  VLDYIXGWS  609



>ref|XP_009767335.1| PREDICTED: uncharacterized protein LOC104218515 [Nicotiana sylvestris]
Length=568

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIP+FFISFI LP ATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN+LCL
Sbjct  440  FSSATSIPSFFISFIVLPFATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNLLCL  499

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVYARGLTWDFSSEVLVILIVC+VMG+F S+RSTFPLWTS +AF LYP S+ LVY
Sbjct  500  SVFLALVYARGLTWDFSSEVLVILIVCVVMGIFASVRSTFPLWTSLLAFLLYPFSLVLVY  559

Query  230  VLDYVFGWS  204
            VLDY  GWS
Sbjct  560  VLDYKIGWS  568



>ref|XP_008655084.1| PREDICTED: LOC100285177 isoform X1 [Zea mays]
Length=596

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  468  FSNATRIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  527

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYPLS+ +VY
Sbjct  528  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPLSLIIVY  587

Query  230  VLDYVFGWS  204
            +LDYVFGWS
Sbjct  588  ILDYVFGWS  596



>ref|XP_007212014.1| hypothetical protein PRUPE_ppa004833mg [Prunus persica]
 gb|EMJ13213.1| hypothetical protein PRUPE_ppa004833mg [Prunus persica]
Length=489

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSELYGAVTMNN+LCL
Sbjct  361  FSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILCL  420

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGL+WDFS+EVLVILIVC+VMG+ GS+R+ +PLWT  IAF LYP S+ALVY
Sbjct  421  SVFLALVYIRGLSWDFSAEVLVILIVCVVMGILGSLRTNYPLWTCSIAFLLYPFSLALVY  480

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  481  VLDYVLGWS  489



>ref|XP_010535054.1| PREDICTED: uncharacterized protein LOC104810447 [Tarenaya hassleriana]
Length=573

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIF+SRKK+R+ASLTFSEL G VTMNN+LCL
Sbjct  445  FSVATKIPSFFISFIALPLATNSSEAVSAIIFSSRKKIRTASLTFSELCGGVTMNNILCL  504

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVYAR LTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ LVY
Sbjct  505  SVFLALVYARELTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLGLVY  564

Query  230  VLDYVFGWS  204
            +LD+ F WS
Sbjct  565  ILDFWFSWS  573



>emb|CDM82192.1| unnamed protein product [Triticum aestivum]
Length=579

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FF+SFI LPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  451  FSNATHIPSFFVSFIGLPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  510

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVLVIL+VC++MG+F S R++FPLWT  +A+ LYPL++A+VY
Sbjct  511  GVFLALIYFRELTWDFSSEVLVILLVCVIMGLFTSFRTSFPLWTCLVAYLLYPLTLAVVY  570

Query  230  VLDYVFGWS  204
            VLD+VFGWS
Sbjct  571  VLDFVFGWS  579



>dbj|BAJ93500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=579

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FF+SFI LPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  451  FSNATHIPSFFVSFIGLPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  510

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVLVIL+ C++MG+F S R++FPLWT  +A+ LYPL++A+VY
Sbjct  511  GVFLALIYFRELTWDFSSEVLVILLACVIMGLFTSFRTSFPLWTCLVAYLLYPLTLAIVY  570

Query  230  VLDYVFGWS  204
            VLD+VFGWS
Sbjct  571  VLDFVFGWS  579



>ref|XP_004951320.1| PREDICTED: uncharacterized protein LOC101782315 [Setaria italica]
Length=572

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FF+SFIA+P ATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  444  FSNATSIPSFFVSFIAMPFATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCL  503

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY RGLTWDFS+EVLVI +VC +MG+F S R+ FPLWT F+A+ LYPLS+ +VY
Sbjct  504  AVFLALVYVRGLTWDFSAEVLVIFLVCTIMGLFTSFRTNFPLWTCFVAYLLYPLSLIIVY  563

Query  230  VLDYVFGWS  204
            VLD+ FGWS
Sbjct  564  VLDFKFGWS  572



>gb|KJB13246.1| hypothetical protein B456_002G064800 [Gossypium raimondii]
Length=578

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNNVLCL
Sbjct  450  FSEATSIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNVLCL  509

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFSSEVLVILIVC+VMG F S R+TFPLWT  +A+ LYP S+ LVY
Sbjct  510  SVFLALVYVRGLTWDFSSEVLVILIVCVVMGAFASFRTTFPLWTCSVAYILYPFSLGLVY  569

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  570  VLDYVFGWS  578



>ref|XP_010062838.1| PREDICTED: uncharacterized protein LOC104450104 [Eucalyptus grandis]
 gb|KCW69970.1| hypothetical protein EUGRSUZ_F03285 [Eucalyptus grandis]
Length=577

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IPTFFISFIALPLATNSSEAVSAIIFASRKK  +ASLTFSELYGAVTMNN+LCL
Sbjct  449  FSDATGIPTFFISFIALPLATNSSEAVSAIIFASRKKQETASLTFSELYGAVTMNNLLCL  508

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY RGLTWDF+SEV+VI+IVCIVMGVFGS R+TFPLWT+ +AF LYP S+ALVY
Sbjct  509  AVFLALVYIRGLTWDFTSEVIVIVIVCIVMGVFGSFRNTFPLWTASVAFVLYPFSLALVY  568

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  569  VLDYVLGWS  577



>ref|XP_008645573.1| PREDICTED: uncharacterized protein LOC103626994 [Zea mays]
Length=579

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ SLTFSE+YGAVTMNN LCL
Sbjct  451  FSNATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGAVTMNNTLCL  510

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFL LVY RGLTWDFSSEVL+I  VC +MG+F S R+ FPLWT  +A+ LYPLS+ +VY
Sbjct  511  AVFLGLVYVRGLTWDFSSEVLIIFSVCTIMGLFTSFRTDFPLWTCVVAYLLYPLSLVVVY  570

Query  230  VLDYVFGWS  204
            VLD+ FGWS
Sbjct  571  VLDFKFGWS  579



>ref|XP_008226453.1| PREDICTED: uncharacterized protein LOC103326027 [Prunus mume]
 ref|XP_008226454.1| PREDICTED: uncharacterized protein LOC103326027 [Prunus mume]
Length=579

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLATNSSE+VSAIIFASRKK+R+ASLTFSELYGAVTMNN+LCL
Sbjct  451  FSDATSIPTFFISFIALPLATNSSESVSAIIFASRKKIRTASLTFSELYGAVTMNNILCL  510

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGL+WDFS+EVLVILIVC+VMG+ GS+R+ +PLWT  IAF LYP S+ALVY
Sbjct  511  SVFLALVYIRGLSWDFSAEVLVILIVCVVMGILGSLRTNYPLWTCSIAFLLYPFSLALVY  570

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  571  VLDYVLGWS  579



>ref|XP_009766997.1| PREDICTED: uncharacterized protein LOC104218248 [Nicotiana sylvestris]
Length=574

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIPTFFISFIALPLATNSSEAVSAIIFASRK  +S SLTFSELYGAVTMNN+LCL
Sbjct  446  FSSATSIPTFFISFIALPLATNSSEAVSAIIFASRKNKKSTSLTFSELYGAVTMNNLLCL  505

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLA+VY RGLTW+FSSEVLVILIVC+VMGV GS+R+TFPLWT  IAF LYPLS+ LVY
Sbjct  506  SVFLAIVYIRGLTWNFSSEVLVILIVCVVMGVLGSIRTTFPLWTCSIAFLLYPLSLVLVY  565

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  566  VLDYVFGWS  574



>ref|XP_004294082.1| PREDICTED: uncharacterized protein LOC101313777 [Fragaria vesca 
subsp. vesca]
Length=580

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNNVLCL
Sbjct  452  FSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKRRTASLTFSELYGAVTMNNVLCL  511

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFS+EVLVI+IVC+VMGVFGS+R+TFPLWT+ IA+ LYP S+ LVY
Sbjct  512  SVFLALVYVRGLTWDFSAEVLVIVIVCVVMGVFGSLRTTFPLWTTSIAYLLYPFSLVLVY  571

Query  230  VLDYVFGWS  204
            VLDY+FGWS
Sbjct  572  VLDYIFGWS  580



>ref|XP_004251882.1| PREDICTED: uncharacterized protein LOC101257045 [Solanum lycopersicum]
Length=578

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIP+FFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN+LCL
Sbjct  450  FSSATSIPSFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNLLCL  509

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFSSEVLVILIVC+V+GVF S+RSTFPLWTS +AF LYP S+ LVY
Sbjct  510  SVFLALVYIRGLTWDFSSEVLVILIVCVVVGVFASVRSTFPLWTSLLAFLLYPFSLVLVY  569

Query  230  VLDYVFGWS  204
            VLDY FGWS
Sbjct  570  VLDYKFGWS  578



>ref|XP_006358955.1| PREDICTED: uncharacterized protein LOC102579474 [Solanum tuberosum]
Length=577

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+ATSIP+FFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN+LCL
Sbjct  449  FSSATSIPSFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNLLCL  508

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFSSEVLVILIVC+V+GVF S+RSTFPLWTS +AF LYP S+ LVY
Sbjct  509  SVFLALVYIRGLTWDFSSEVLVILIVCVVVGVFASVRSTFPLWTSLLAFLLYPFSLVLVY  568

Query  230  VLDYVFGWS  204
            VLDY FGWS
Sbjct  569  VLDYKFGWS  577



>ref|XP_004294083.1| PREDICTED: uncharacterized protein LOC101314065 [Fragaria vesca 
subsp. vesca]
Length=578

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP FF+SFI LPL T +SE VSAI FASRKK+R+ASLTFS+LYG+VTM NVLCL
Sbjct  451  FSEATSIPNFFVSFIVLPLFT-ASEGVSAITFASRKKIRTASLTFSQLYGSVTMKNVLCL  509

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY R LTWDFS+EVLVILIVC VMGVF S+R+TFPLWTS IAF LYP S+AL+Y
Sbjct  510  SVFLALVYFRELTWDFSAEVLVILIVCTVMGVFASLRTTFPLWTSSIAFILYPFSVALIY  569

Query  230  VLDYVFGWS  204
            VLD+VFGWS
Sbjct  570  VLDFVFGWS  578



>gb|KCW44589.1| hypothetical protein EUGRSUZ_L01893 [Eucalyptus grandis]
Length=422

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IPTFFISFI LPLATNSSEAVSAIIFASRKK ++ASLTFSELYGAVT+NN+LCL
Sbjct  294  FSDATGIPTFFISFIVLPLATNSSEAVSAIIFASRKKQKTASLTFSELYGAVTVNNLLCL  353

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY RGLTWDF+SEV+VILIVCIVMG+F S R+TFPLWT  +AF LYP S+ALVY
Sbjct  354  AVFLALVYIRGLTWDFTSEVIVILIVCIVMGIFASFRTTFPLWTVSVAFILYPFSLALVY  413

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  414  VLDYVLGWS  422



>ref|XP_003634635.1| PREDICTED: uncharacterized protein LOC100264164 [Vitis vinifera]
 emb|CBI20221.3| unnamed protein product [Vitis vinifera]
Length=580

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSELYGAVTMNNVLCL
Sbjct  452  FSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKNRTTSLTFSELYGAVTMNNVLCL  511

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFSSEVLVI+IVC+VMGVF S R+TFPLWTSF+A  LYP S+ALVY
Sbjct  512  SVFLALVYVRGLTWDFSSEVLVIVIVCVVMGVFASFRTTFPLWTSFVALLLYPFSLALVY  571

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  572  VLDYVLGWS  580



>gb|KHG25681.1| Vacuolar calcium ion transporter [Gossypium arboreum]
Length=578

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNNVLCL
Sbjct  450  FSEATSIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNVLCL  509

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFSSEVLVILIVC+VMG F S R+TFPLWT  +A+ LYP S+ LVY
Sbjct  510  SVFLALVYVRGLTWDFSSEVLVILIVCVVMGAFASFRTTFPLWTCSVAYILYPFSLGLVY  569

Query  230  VLDYVFGWS  204
            VLDYVF WS
Sbjct  570  VLDYVFSWS  578



>emb|CBI20223.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLAT SSEAVSAIIFASRKK R+ SLTFS LYGAVTMNNVLCL
Sbjct  362  FSDATSIPTFFISFIALPLAT-SSEAVSAIIFASRKKRRTTSLTFSVLYGAVTMNNVLCL  420

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFSSEVLVILIVC+VMGVF S R+TFPLWTSF+A  LYP S+ALVY
Sbjct  421  SVFLALVYVRGLTWDFSSEVLVILIVCVVMGVFASFRTTFPLWTSFVALLLYPFSLALVY  480

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  481  VLDYVLGWS  489



>ref|XP_004146032.1| PREDICTED: uncharacterized protein LOC101209298 isoform 1 [Cucumis 
sativus]
 ref|XP_004162934.1| PREDICTED: uncharacterized protein LOC101229160 isoform 1 [Cucumis 
sativus]
 gb|KGN55087.1| hypothetical protein Csa_4G628350 [Cucumis sativus]
Length=589

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP FFISFIALPLATNSSEAVSAIIFASR K ++ASLTFSELYGAVTMNNVLCL
Sbjct  461  FSNATKIPAFFISFIALPLATNSSEAVSAIIFASRDKRKTASLTFSELYGAVTMNNVLCL  520

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGL W+FSSEVLVILIV ++MGV GS R+ FPLWTS +A  LYPLS+ LVY
Sbjct  521  SVFLALVYMRGLVWNFSSEVLVILIVTMIMGVMGSFRTAFPLWTSLVALLLYPLSLVLVY  580

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  581  VLDYVFGWS  589



>ref|XP_004146033.1| PREDICTED: uncharacterized protein LOC101209298 isoform 2 [Cucumis 
sativus]
 ref|XP_004162935.1| PREDICTED: uncharacterized protein LOC101229160 isoform 2 [Cucumis 
sativus]
Length=584

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP FFISFIALPLATNSSEAVSAIIFASR K ++ASLTFSELYGAVTMNNVLCL
Sbjct  456  FSNATKIPAFFISFIALPLATNSSEAVSAIIFASRDKRKTASLTFSELYGAVTMNNVLCL  515

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGL W+FSSEVLVILIV ++MGV GS R+ FPLWTS +A  LYPLS+ LVY
Sbjct  516  SVFLALVYMRGLVWNFSSEVLVILIVTMIMGVMGSFRTAFPLWTSLVALLLYPLSLVLVY  575

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  576  VLDYVFGWS  584



>ref|XP_002282948.1| PREDICTED: uncharacterized protein LOC100252144 [Vitis vinifera]
Length=579

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIPTFFISFIALPLAT SSEAVSAIIFASRKK R+ SLTFS LYGAVTMNNVLCL
Sbjct  452  FSDATSIPTFFISFIALPLAT-SSEAVSAIIFASRKKRRTTSLTFSVLYGAVTMNNVLCL  510

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGLTWDFSSEVLVILIVC+VMGVF S R+TFPLWTSF+A  LYP S+ALVY
Sbjct  511  SVFLALVYVRGLTWDFSSEVLVILIVCVVMGVFASFRTTFPLWTSFVALLLYPFSLALVY  570

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  571  VLDYVLGWS  579



>ref|XP_009405607.1| PREDICTED: uncharacterized protein LOC103988717 [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISFIA+PLATNSSEAVS+IIFA+RKK R++SLTFSE+YG VTMNN+LCL
Sbjct  465  FSVATSIPSFFISFIAMPLATNSSEAVSSIIFATRKKQRTSSLTFSEIYGGVTMNNLLCL  524

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY R LTWDFS+EVLVILIVC+VMG+F S R+TFPLWT F+AFSLYPLS+ALVY
Sbjct  525  AVFLALVYMRHLTWDFSAEVLVILIVCVVMGLFTSFRTTFPLWTCFVAFSLYPLSLALVY  584

Query  230  VLDYVFGWS  204
            VLD+VFGWS
Sbjct  585  VLDFVFGWS  593



>ref|XP_009380498.1| PREDICTED: uncharacterized protein LOC103968880 [Musa acuminata 
subsp. malaccensis]
Length=589

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+AT IP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ASLTFSE+YG  TMNNVLCL
Sbjct  461  FSSATKIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTASLTFSEIYGGATMNNVLCL  520

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFL+LVY R LTWDFS+EVLVIL+VCIVMG+F S+R+TFPLWT F+AF LYPLS+ LVY
Sbjct  521  AVFLSLVYVRHLTWDFSAEVLVILVVCIVMGIFTSLRTTFPLWTCFVAFLLYPLSLVLVY  580

Query  230  VLDYVFGWS  204
            VLD+VFGWS
Sbjct  581  VLDFVFGWS  589



>ref|XP_010041151.1| PREDICTED: uncharacterized protein LOC104430086 [Eucalyptus grandis]
Length=579

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IPTFFISFI LPLATNSSEAVSAIIFASRKK ++ASLTFSELYGAVT+NN+LCL
Sbjct  451  FSDATGIPTFFISFIVLPLATNSSEAVSAIIFASRKKQKTASLTFSELYGAVTVNNLLCL  510

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY RGLTWDF+SEV+VILIVCIVMG+F S R+TFPLWT  +AF LYP S+ALVY
Sbjct  511  AVFLALVYIRGLTWDFTSEVIVILIVCIVMGIFASFRTTFPLWTVSVAFILYPFSLALVY  570

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  571  VLDYVLGWS  579



>ref|XP_009409407.1| PREDICTED: uncharacterized protein LOC103991626 [Musa acuminata 
subsp. malaccensis]
Length=588

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIA+PLATNSSEAVSAIIFASRK  R+ASLTFSE+YG VTMNN LCL
Sbjct  460  FSIATKIPSFFISFIAMPLATNSSEAVSAIIFASRKTQRTASLTFSEIYGGVTMNNTLCL  519

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY R LTWDFS+EVLVILIVC+VMG+F S+R+TFPLWT F+AF LYPL++ LVY
Sbjct  520  AVFLALVYVRHLTWDFSAEVLVILIVCVVMGIFTSLRTTFPLWTCFVAFLLYPLALVLVY  579

Query  230  VLDYVFGWS  204
            VLD+VFGWS
Sbjct  580  VLDFVFGWS  588



>gb|ADM77106.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77107.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77108.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77109.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77110.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77111.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77112.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77113.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77114.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77116.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77117.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77118.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77119.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77120.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77121.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77122.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77123.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77124.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77125.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77126.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77127.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77128.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77129.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77130.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77132.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77133.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77134.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77135.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77136.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77137.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77138.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77139.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77140.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77141.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77142.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77143.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77144.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77145.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77146.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77147.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77148.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77149.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77150.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77151.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77152.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77153.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
Length=227

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISFI +PLATNSSE VSA+IFASRKK R+ASLTFSE+YGAVTMNN LCL
Sbjct  99   FSDATSIPSFFISFIIMPLATNSSEGVSALIFASRKKKRTASLTFSEIYGAVTMNNTLCL  158

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLA++Y RGL WDFS+EVLVI++V +VMG+ GS R+TFPLW SFIAF  YPL++A+VY
Sbjct  159  GVFLAIIYIRGLDWDFSAEVLVIVLVVLVMGLLGSFRTTFPLWMSFIAFLFYPLTLAIVY  218

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  219  VLDYVLGWS  227



>gb|ADE75754.1| unknown [Picea sitchensis]
Length=233

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISFI +PLATNSSE VSA+IFASRKK R+ASLTFSE+YGAVTMNN LCL
Sbjct  105  FSDATSIPSFFISFIIMPLATNSSEGVSALIFASRKKKRTASLTFSEIYGAVTMNNTLCL  164

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLA++Y RGL WDFS+EVLVI++V +VMG+ GS R+TFPLW SFIAF  YPL++A+VY
Sbjct  165  GVFLAIIYIRGLDWDFSAEVLVIVLVVLVMGLLGSFRTTFPLWMSFIAFLFYPLTLAIVY  224

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  225  VLDYVLGWS  233



>ref|XP_002279120.1| PREDICTED: uncharacterized protein LOC100253888 [Vitis vinifera]
 emb|CBI21944.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FF+SF+ LP A+ SSEAVSA+IFASRKKLR+ASLTFSE+YG+VTM N+L L
Sbjct  450  FSTATSIPSFFVSFVVLPFAS-SSEAVSAMIFASRKKLRTASLTFSEIYGSVTMGNILSL  508

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFL L+Y R LTWDF+SEVL+ILIVCI+MGVF   R+TFPLWTS +AF LYPLS+ LVY
Sbjct  509  SVFLGLIYFRQLTWDFASEVLIILIVCILMGVFAGTRTTFPLWTSLMAFLLYPLSLVLVY  568

Query  230  VLDYVFGWS  204
            VLD   GWS
Sbjct  569  VLDNYLGWS  577



>emb|CAN78652.1| hypothetical protein VITISV_033128 [Vitis vinifera]
Length=598

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FF+SF+ LP A+ SSEAVSA+IFASRKKLR+ASLTFSE+YG+VTM N+L L
Sbjct  471  FSTATSIPSFFVSFVVLPFAS-SSEAVSAMIFASRKKLRTASLTFSEIYGSVTMGNILSL  529

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFL L+Y R LTWDF+SEVL+ILIVCI+MGVF   R+TFPLWTS +AF LYPLS+ LVY
Sbjct  530  SVFLGLIYFRQLTWDFASEVLIILIVCILMGVFAGTRTTFPLWTSLMAFLLYPLSLVLVY  589

Query  230  VLDYVFGWS  204
            VLD   GWS
Sbjct  590  VLDNYLGWS  598



>gb|ADM77115.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
Length=227

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISFI +PLATNSSE VSA+IFASRKK R+ASLT+SE+YGAVTMNN LCL
Sbjct  99   FSDATSIPSFFISFIIMPLATNSSEGVSALIFASRKKKRTASLTYSEIYGAVTMNNTLCL  158

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLA++Y RGL WDFS+EVLVI++V +VMG+ GS R+TFPLW SFIAF  YPL++A+VY
Sbjct  159  GVFLAIIYIRGLDWDFSAEVLVIVLVVLVMGLLGSFRTTFPLWMSFIAFLFYPLTLAIVY  218

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  219  VLDYVLGWS  227



>ref|XP_003543222.1| PREDICTED: uncharacterized protein LOC100809896 [Glycine max]
 gb|KHN36868.1| hypothetical protein glysoja_001599 [Glycine soja]
Length=579

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP FFISFI LPLATNSSEAVSAIIFASR K ++ASLTFSELYGAVTMNNVLCL
Sbjct  451  FSEATSIPAFFISFIFLPLATNSSEAVSAIIFASRDKRQTASLTFSELYGAVTMNNVLCL  510

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVYARGLTWDFSSEVLVIL+VCIV+GVF S R+ FPLWT+ +A  LYP S+ALVY
Sbjct  511  SVFLALVYARGLTWDFSSEVLVILVVCIVVGVFASFRTVFPLWTAILAILLYPFSLALVY  570

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  571  VLDYVFGWS  579



>gb|ADM77131.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
Length=227

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISFI +PLATNSSE VSA+IFASRKK R+ASLTFSE+YGAVTMNN LCL
Sbjct  99   FSDATSIPSFFISFIIMPLATNSSEGVSALIFASRKKKRTASLTFSEIYGAVTMNNTLCL  158

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLA++Y R L WDFS+EVLVI++V +VMG+ GS R+TFPLW SFIAF  YPL++A+VY
Sbjct  159  GVFLAIIYIRSLDWDFSAEVLVIVLVVLVMGLLGSFRTTFPLWMSFIAFLFYPLTLAIVY  218

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  219  VLDYVLGWS  227



>ref|XP_004968611.1| PREDICTED: uncharacterized protein LOC101771765 [Setaria italica]
Length=575

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  447  FSNATHIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  506

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYPLS+ +VY
Sbjct  507  GVFLALIYFRNLTWDFSSEVLIILVVCVVMALFTSFRTTFPLWTCLVAYVLYPLSLVIVY  566

Query  230  VLDYVFGWS  204
            +LDYVFGWS
Sbjct  567  ILDYVFGWS  575



>ref|XP_008783929.1| PREDICTED: uncharacterized protein LOC103703017 [Phoenix dactylifera]
Length=641

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT+IP+FFISFIA+PLATNSSEAVSAIIFASRKK R++SLTFSE+YG VTMNN LCL
Sbjct  513  FSLATNIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTSSLTFSEIYGGVTMNNTLCL  572

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY R LTWDFS+EVLVIL+VCIVMG+F S R+ FPLWT FIA+ LYPLS+ +VY
Sbjct  573  AVFLALVYLRHLTWDFSAEVLVILVVCIVMGLFTSFRTKFPLWTCFIAYLLYPLSLVIVY  632

Query  230  VLDYVFGWS  204
            +LD+VFGWS
Sbjct  633  ILDFVFGWS  641



>ref|XP_002992821.1| hypothetical protein SELMODRAFT_42349, partial [Selaginella moellendorffii]
 gb|EFJ06111.1| hypothetical protein SELMODRAFT_42349, partial [Selaginella moellendorffii]
Length=531

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+AT IP+FFI+F+A PLATNSSEA+S+++FA++KK ++ SLT+S++YG VTMNN LCL
Sbjct  404  FSSATGIPSFFIAFVATPLATNSSEAISSVLFAAKKKKQNISLTYSQIYGGVTMNNTLCL  463

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLA+V  RGLTWDFSSEVLVI +V ++MG+FG  R+TFPLWTSFI  +LYPLSI +V 
Sbjct  464  GIFLAVVAYRGLTWDFSSEVLVITLVALIMGIFGGTRTTFPLWTSFIPLALYPLSILVVA  523

Query  230  VLDYVFGW  207
            +LDYV GW
Sbjct  524  LLDYVLGW  531



>ref|XP_002987555.1| hypothetical protein SELMODRAFT_42348, partial [Selaginella moellendorffii]
 gb|EFJ11391.1| hypothetical protein SELMODRAFT_42348, partial [Selaginella moellendorffii]
Length=531

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+AT IP+FFI+F+A PLATNSSEA+S+++FA++KK ++ SLT+S++YG VTMNN LCL
Sbjct  404  FSSATGIPSFFIAFVATPLATNSSEAISSVLFAAKKKKQNISLTYSQIYGGVTMNNTLCL  463

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLA+V  RGLTWDFSSEVLVI +V ++MG+FG  R+TFPLWTSFI  +LYPLSI +V 
Sbjct  464  GIFLAVVAYRGLTWDFSSEVLVITLVALIMGIFGGTRTTFPLWTSFIPLALYPLSILVVA  523

Query  230  VLDYVFGW  207
            +LDYV GW
Sbjct  524  LLDYVLGW  531



>ref|XP_010276580.1| PREDICTED: uncharacterized protein LOC104611295 [Nelumbo nucifera]
Length=577

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP FF+SFI LPLAT SSEAVSA+IFASRKK ++ASLTFS +YG+VTM+N+L L
Sbjct  450  FSNATSIPAFFVSFIVLPLAT-SSEAVSALIFASRKKQKTASLTFSMIYGSVTMSNILSL  508

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLA+VY R LTWDFSSEV +I I+C +MG+F S R+TFPLWT  +A+ LYPLS+ LVY
Sbjct  509  AVFLAVVYIRNLTWDFSSEVFIIFIICTIMGLFASFRTTFPLWTCLVAYLLYPLSLVLVY  568

Query  230  VLDYVFGWS  204
            VLDYV GWS
Sbjct  569  VLDYVLGWS  577



>gb|ADN33808.1| sodium/calcium exchanger family protein [Cucumis melo subsp. 
melo]
Length=585

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP FFISFIALPLATNSSEAVSAIIFASR K ++ASLTFSELYGAVTMNNVLCL
Sbjct  457  FSNATKIPAFFISFIALPLATNSSEAVSAIIFASRDKRKTASLTFSELYGAVTMNNVLCL  516

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGL W+FSSEVLVIL+V +VMGV GS R+ FPLWTS +A  LYP S+ LVY
Sbjct  517  SVFLALVYLRGLVWNFSSEVLVILVVTVVMGVMGSFRTAFPLWTSLVALLLYPFSLVLVY  576

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  577  VLDYVFGWS  585



>ref|XP_008463718.1| PREDICTED: uncharacterized protein LOC103501799 [Cucumis melo]
Length=590

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT IP FFISFIALPLATNSSEAVSAIIFASR K ++ASLTFSELYGAVTMNNVLCL
Sbjct  462  FSNATKIPAFFISFIALPLATNSSEAVSAIIFASRDKRKTASLTFSELYGAVTMNNVLCL  521

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFLALVY RGL W+FSSEVLVIL+V +VMGV GS R+ FPLWTS +A  LYP S+ LVY
Sbjct  522  SVFLALVYLRGLVWNFSSEVLVILVVTVVMGVMGSFRTAFPLWTSLVALLLYPFSLVLVY  581

Query  230  VLDYVFGWS  204
            VLDYVFGWS
Sbjct  582  VLDYVFGWS  590



>ref|XP_011460411.1| PREDICTED: uncharacterized protein LOC105350345 [Fragaria vesca 
subsp. vesca]
Length=162

 Score =   171 bits (433),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIPTFF+SF+ LP  + SSE VS +IF SRKK RSASL +SE+YG+VTM+++L L
Sbjct  35   FSTATSIPTFFVSFVILPFVS-SSEIVSTLIFVSRKKQRSASLAYSEIYGSVTMSDILSL  93

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFL LVY R LTW FS+EVLVI+IVCI+MGV  S R+TFP+W  F A  LYPLS+ LVY
Sbjct  94   AVFLGLVYIRNLTWSFSAEVLVIIIVCILMGVVASCRTTFPVWMCFGAVMLYPLSLLLVY  153

Query  230  VLDYVFGWS  204
            +L+YVFGWS
Sbjct  154  ILEYVFGWS  162



>ref|XP_007050029.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
 gb|EOX94186.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
Length=586

 Score =   181 bits (458),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA+SIP+FF+SF+ LP+A+ +SEAVSA+ F  RK+L +ASLT+S++YG+VTM+N+L L
Sbjct  459  FSTASSIPSFFVSFVILPIAS-TSEAVSALNFTGRKQLTTASLTYSQIYGSVTMSNILSL  517

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFL LVY R LTWDF++EVLVILIVCIVMG   S R+TFPLW S +AF+LYP S+ LVY
Sbjct  518  SVFLGLVYFRDLTWDFAAEVLVILIVCIVMGAIASFRTTFPLWMSLVAFALYPFSLLLVY  577

Query  230  VLDYVFGWS  204
            VLDY+FGWS
Sbjct  578  VLDYIFGWS  586



>gb|KDP31770.1| hypothetical protein JCGZ_12231 [Jatropha curcas]
Length=577

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIPTFF++F+ LP A+ SSE VS +IFASRK  RSASL +SE+YG+VTM+NVL L
Sbjct  450  FSTATSIPTFFVAFVILPFAS-SSEVVSDLIFASRKNSRSASLAYSEIYGSVTMSNVLSL  508

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFL LVY RGLTW+FSSEVL+ILIVC+VMG+  S R+TFP+W S +A++LYP S+ L Y
Sbjct  509  SVFLGLVYFRGLTWNFSSEVLLILIVCVVMGLIASFRTTFPVWMSLVAYALYPFSLLLAY  568

Query  230  VLDYVFGWS  204
            VL+YV GWS
Sbjct  569  VLNYVLGWS  577



>ref|XP_007021639.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
 gb|EOY13164.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
Length=707

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS ATSIP+FFISF+ALPLA+NSS+AV AIIFASRKK R+ASLTFSELY  VTMNNVLCL
Sbjct  451  FSIATSIPSFFISFVALPLASNSSKAVPAIIFASRKKKRTASLTFSELYATVTMNNVLCL  510

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWT  279
            SVFLALVYARGLTWDFSSEVLVILIVCIVMG F S R+TFPLWT
Sbjct  511  SVFLALVYARGLTWDFSSEVLVILIVCIVMGAFASFRTTFPLWT  554



>ref|XP_002522156.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF40235.1| calcium ion binding protein, putative [Ricinus communis]
Length=588

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS AT++P+FFISF+ LP  TNS EA SAI F S KK+R+ASLT SELYG +T+  +LCL
Sbjct  460  FSKATTVPSFFISFVTLPFITNSGEAFSAITFISHKKMRTASLTLSELYGKITVKILLCL  519

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFL L+Y RGL WDF S+ +V+LIVC VMG F S ++TFPLWTS +A  LYP S+ALVY
Sbjct  520  SVFLGLIYFRGLKWDFMSKAMVLLIVCTVMGAFASFQTTFPLWTSSLACLLYPFSLALVY  579

Query  230  VLDYVFGWS  204
            VLD+V+GWS
Sbjct  580  VLDHVYGWS  588



>ref|XP_002525142.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF37269.1| calcium ion binding protein, putative [Ricinus communis]
Length=543

 Score =   175 bits (443),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA++IPTFF+SF+ LP A+ SSE VS +IFASRKK R ASL +SE+YG+VTM+NVL L
Sbjct  416  FSTASNIPTFFVSFVILPFAS-SSEVVSDMIFASRKKSRYASLAYSEIYGSVTMSNVLSL  474

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFL LVY RGLTW+FSSEVL+ILIVCI +G+  S+R+TFPLW S +A+++YP S+ L Y
Sbjct  475  SVFLGLVYFRGLTWNFSSEVLIILIVCIAIGLIASLRTTFPLWMSLVAYAMYPFSLLLAY  534

Query  230  VLDYVFGWS  204
            + +YV GWS
Sbjct  535  IFNYVLGWS  543



>ref|XP_011098255.1| PREDICTED: uncharacterized protein LOC105176958 isoform X1 [Sesamum 
indicum]
Length=576

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FFISFI LPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL
Sbjct  441  FSTATSIPSFFISFIVLPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  500

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSF  273
            SVFLALVY RGL WDFSSEVLVILIVC+VMGVF S+R+TFPLWTS 
Sbjct  501  SVFLALVYVRGLVWDFSSEVLVILIVCVVMGVFASIRTTFPLWTSL  546



>ref|XP_004305436.1| PREDICTED: uncharacterized protein LOC101295737 [Fragaria vesca 
subsp. vesca]
Length=580

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIPTFF+SF+ LP  + SSE VS +IF SRKK RSASL +SE+YG+VTM+N+L L
Sbjct  447  FSTATSIPTFFVSFVILPFVS-SSEIVSTLIFVSRKKQRSASLAYSEIYGSVTMSNILSL  505

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFL LVY R LTW FS+EVLVI+IVCI+MGV    R+TFP+W  F A  LYPLS+ LVY
Sbjct  506  AVFLGLVYIRNLTWSFSAEVLVIIIVCILMGVVACCRTTFPVWLCFGAVMLYPLSLLLVY  565

Query  230  VLDYVFGWS  204
            +L+YVFGWS
Sbjct  566  ILEYVFGWS  574



>ref|XP_010277716.1| PREDICTED: uncharacterized protein LOC104612096 [Nelumbo nucifera]
Length=688

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS++ +IP+FF+SF+ +PLATNS EA S II ASRKK  + S TFSE+YG V MNN+L L
Sbjct  560  FSSSANIPSFFVSFVMVPLATNSREAASRIISASRKKSTTTSWTFSEIYGGVFMNNILGL  619

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV L L++ RGLTWDFS+E LV+L+VC VMG+F S RSTFPLWT F+A+ +YP S+ LVY
Sbjct  620  SVLLCLIFFRGLTWDFSTEALVVLVVCTVMGLFASFRSTFPLWTCFMAYLMYPFSLVLVY  679

Query  230  VLDYVFGWS  204
            V +Y  GWS
Sbjct  680  VFNYALGWS  688



>ref|XP_006852513.1| hypothetical protein AMTR_s00021p00164610 [Amborella trichopoda]
 gb|ERN13980.1| hypothetical protein AMTR_s00021p00164610 [Amborella trichopoda]
Length=574

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FFISFIA+PLATNSSEAVSA+IFASRKK R+ASLTFSE+YGAVTMNN+LCL
Sbjct  446  FSTATSIPSFFISFIAMPLATNSSEAVSALIFASRKKQRTASLTFSEIYGAVTMNNILCL  505

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFLALVY R LTWDFS+EVLVIL+V ++MG+ GS R+TFPLW  FIA++LYPLS+ LVY
Sbjct  506  AVFLALVYVRHLTWDFSAEVLVILVVVLIMGLVGSFRTTFPLWACFIAYALYPLSLLLVY  565

Query  230  VLDYVFGWS  204
            +LDY FGWS
Sbjct  566  LLDYQFGWS  574



>gb|KDO45773.1| hypothetical protein CISIN_1g0423001mg, partial [Citrus sinensis]
Length=147

 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 103/123 (84%), Gaps = 1/123 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA++IP+ F++FI LP AT SSEAVSA+IFASRK+ R++SLT+S +YG+VTM+N+L L
Sbjct  25   FSTASNIPSLFVAFIILPFAT-SSEAVSALIFASRKRSRTSSLTYSAIYGSVTMSNILSL  83

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SVFL+LVY R LTW+FS+EV VIL+VCI+MG+  S R+TFPLW   +A  LYP S+ L+Y
Sbjct  84   SVFLSLVYFRHLTWNFSAEVSVILLVCILMGLIASFRTTFPLWMCLVACMLYPFSLLLLY  143

Query  230  VLD  222
            VLD
Sbjct  144  VLD  146



>ref|XP_002979757.1| hypothetical protein SELMODRAFT_111442, partial [Selaginella 
moellendorffii]
 gb|EFJ19159.1| hypothetical protein SELMODRAFT_111442, partial [Selaginella 
moellendorffii]
Length=147

 Score =   155 bits (392),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            F+ A+ IP FFI+F+  PLA+N+SE VS+I FA +K+ R+ SLTFS++YGAVTMNN LCL
Sbjct  19   FAQASQIPPFFIAFVFTPLASNASELVSSISFAQKKRKRNISLTFSQIYGAVTMNNTLCL  78

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FL LVY RGLTWDFSSEV  ILI    +G  G  R TFP W S    +LYPLSIA + 
Sbjct  79   GIFLGLVYTRGLTWDFSSEVTAILITTFFVGALGGSRMTFPSWLSLPVLALYPLSIASIA  138

Query  230  VLDYVFGW  207
             LD V GW
Sbjct  139  FLDNVLGW  146



>ref|XP_001762095.1| predicted protein [Physcomitrella patens]
 gb|EDQ73199.1| predicted protein [Physcomitrella patens]
Length=573

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A+ I  FFISFIA PLATNSSEA+S++IFA RK+ ++ S+T+S++YGAVTMNN +CL
Sbjct  445  FSEASGISPFFISFIATPLATNSSEAISSLIFAKRKRKKNISMTYSQIYGAVTMNNTMCL  504

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLA+VY R L WDFS+E+ VI    ++MG   ++R+TFPLW +FI  +LYP SI LV 
Sbjct  505  GIFLAIVYFRSLQWDFSAEIFVIFFATLLMGSVAALRTTFPLWMAFIGIALYPASIGLVA  564

Query  230  VLDYVFGWS  204
             LDYV GW 
Sbjct  565  FLDYVCGWH  573



>ref|XP_001751608.1| predicted protein [Physcomitrella patens]
 gb|EDQ83925.1| predicted protein [Physcomitrella patens]
Length=576

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A+ I  FFISFIA PLATNSSEA+S++IFA RK+ ++ S+T+S++YGAVTMNN LCL
Sbjct  448  FSKASGISPFFISFIATPLATNSSEAISSLIFAKRKRKKNISMTYSQIYGAVTMNNTLCL  507

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FL +VY RGL WDFS+E+ VI     +MG   + R+TFPLW +FI  +LYPLS+ LV 
Sbjct  508  GIFLTIVYFRGLLWDFSAEISVIFFATFIMGTVAAFRTTFPLWMAFIGLALYPLSVGLVV  567

Query  230  VLDYVFGWS  204
             LD+V GW 
Sbjct  568  FLDFVCGWH  576



>ref|XP_002985423.1| hypothetical protein SELMODRAFT_122258, partial [Selaginella 
moellendorffii]
 gb|EFJ13553.1| hypothetical protein SELMODRAFT_122258, partial [Selaginella 
moellendorffii]
Length=147

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            F+ A+ IP FFI+F+  PLA+N+SE VS+I FA +++ R+ SLTFS++YGAVTMNN LCL
Sbjct  19   FAQASQIPPFFIAFVFTPLASNASELVSSISFAQKRRKRNISLTFSQIYGAVTMNNTLCL  78

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FL LVY RGLTWDFSSEV  ILI    +GV G  R TFP W S     LYPLSIA + 
Sbjct  79   GIFLGLVYTRGLTWDFSSEVTAILITTFFVGVLGGSRMTFPSWLSLPVLVLYPLSIASIA  138

Query  230  VLDYVFGW  207
             LD V GW
Sbjct  139  FLDNVLGW  146



>ref|XP_009340418.1| PREDICTED: uncharacterized protein LOC103932516 [Pyrus x bretschneideri]
Length=725

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA SIP+FF+SF+ +PLATN+ +A SAI  ASRK  R+ SLTFSE+YG V MNNVL  
Sbjct  597  FSTAASIPSFFVSFVLVPLATNARQAASAIKAASRKTPRTTSLTFSEIYGGVFMNNVLGF  656

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV LA++YAR +TWDFS+EVLV+LIVC VMG+  S  STF LWTSF+A+ LYP+S+ LVY
Sbjct  657  SVLLAIIYAREMTWDFSAEVLVVLIVCTVMGLIASFVSTFSLWTSFLAYLLYPISLLLVY  716

Query  230  VLDYVFGWS  204
            +L+ V  ++
Sbjct  717  ILNDVLNYT  725



>ref|XP_002985644.1| hypothetical protein SELMODRAFT_181929 [Selaginella moellendorffii]
 gb|EFJ13222.1| hypothetical protein SELMODRAFT_181929 [Selaginella moellendorffii]
Length=528

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A+ IP+FF++F+A PLATNSSEAVS+++FA+RKK R+ S+T+S++YGAVT+NN LCL
Sbjct  400  FSKASKIPSFFVAFVATPLATNSSEAVSSLMFAARKKKRNISMTYSQIYGAVTLNNTLCL  459

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLA+V AR L WDFSSEV VI +V  ++G+ G  R+TF L+ +    SLYPLSIALV 
Sbjct  460  GVFLAIVCARRLVWDFSSEVTVIAVVTFLVGLLGGRRTTFRLYMALAVLSLYPLSIALVA  519

Query  230  VLDYVFGWS  204
             LDY  GW 
Sbjct  520  GLDYGLGWH  528



>ref|XP_002974272.1| hypothetical protein SELMODRAFT_52345, partial [Selaginella moellendorffii]
 gb|EFJ24494.1| hypothetical protein SELMODRAFT_52345, partial [Selaginella moellendorffii]
Length=525

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A+ IP+FF++F+A PLATNSSEAVS+++FA+RKK R+ S+T+S++YGAVT+NN LCL
Sbjct  398  FSKASKIPSFFVAFVATPLATNSSEAVSSLMFAARKKKRNISMTYSQIYGAVTLNNTLCL  457

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLA+V AR L WDFSSEV VI +V  ++G+ G  R+TF L+ +    SLYPLSIALV 
Sbjct  458  GVFLAIVCARRLVWDFSSEVTVIAVVTFLVGLLGGKRTTFRLYMALAVLSLYPLSIALVA  517

Query  230  VLDYVFGW  207
             LDY  GW
Sbjct  518  GLDYGLGW  525



>ref|XP_008362437.1| PREDICTED: uncharacterized protein LOC103426126 [Malus domestica]
Length=549

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FFISF+ LP A+ SSE V+ +IF SRKK R+ASL +SE+YG+VTM+N+L L
Sbjct  422  FSTATSIPSFFISFVVLPFAS-SSEIVTTLIFXSRKKQRTASLAYSEIYGSVTMSNILSL  480

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFL LVY R LTW FS+EVLVILIVCI+MG   S R+TFPLW S +A  LYPLS+ LVY
Sbjct  481  AVFLGLVYVRNLTWSFSAEVLVILIVCILMGAIASFRTTFPLWMSSVAILLYPLSLLLVY  540

Query  230  VLDYVFGWS  204
            +LDY+ GWS
Sbjct  541  ILDYICGWS  549



>ref|XP_008368645.1| PREDICTED: uncharacterized protein LOC103432241 [Malus domestica]
Length=585

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FFISF+ LP A+ SSE V+ +IF SRKK R+ASL +SE+YG+VTM+N+L L
Sbjct  458  FSTATSIPSFFISFVVLPFAS-SSEIVTTLIFXSRKKQRTASLAYSEIYGSVTMSNILSL  516

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFL LVY R LTW FS+EVLVILIVCI+MG   S R+TFPLW S +A  LYPLS+ LVY
Sbjct  517  AVFLGLVYVRNLTWSFSAEVLVILIVCILMGAIASFRTTFPLWMSSVAILLYPLSLLLVY  576

Query  230  VLDYVFGWS  204
            +LDY+ GWS
Sbjct  577  ILDYICGWS  585



>ref|XP_001755925.1| predicted protein [Physcomitrella patens]
 gb|EDQ79210.1| predicted protein [Physcomitrella patens]
Length=568

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A+ IP FF++F+  P A+N+SE VS+IIFA R++ R+ SLTFS++YGA+TMNN LC+
Sbjct  440  FSAASKIPPFFVAFVVTPFASNASELVSSIIFAKRRRKRNISLTFSQVYGAITMNNTLCM  499

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            ++FLALVY RGLTWDFSSEV VI++    +G+ G  RSTFP W +    +LYPL+IA V 
Sbjct  500  AIFLALVYIRGLTWDFSSEVTVIVLCTFAVGMMGGTRSTFPSWFALPVLALYPLAIAGVA  559

Query  230  VLDYVFGW  207
            VLD V GW
Sbjct  560  VLDNVLGW  567



>ref|XP_001752917.1| predicted protein [Physcomitrella patens]
 gb|EDQ82421.1| predicted protein [Physcomitrella patens]
Length=601

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A+ I  FFISFIA PLATNSSEA+S++IFA +K+ ++ S+T+S++YGAVTMNN +CL
Sbjct  473  FSRASGISPFFISFIATPLATNSSEAISSLIFAKKKRKKNISMTYSQIYGAVTMNNTMCL  532

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FL++VY R L WDFS+EV VI    ++MG   + R+T PLW +FI  +LYPLSIALV 
Sbjct  533  GIFLSIVYFRHLLWDFSAEVSVIFFATLIMGSVAAFRTTLPLWMAFIGLALYPLSIALVA  592

Query  230  VLDYVFGWS  204
             LDYV GW 
Sbjct  593  FLDYVCGWH  601



>ref|XP_008386229.1| PREDICTED: uncharacterized protein LOC103448738 [Malus domestica]
 ref|XP_008359329.1| PREDICTED: uncharacterized protein LOC103423037 [Malus domestica]
Length=725

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA SIP+FF+SF+ +PLATN+ +A SAI  ASRK  R+ SLTFSE+YG V MNNVL  
Sbjct  597  FSTAASIPSFFVSFVLVPLATNARQATSAIKAASRKTPRTTSLTFSEIYGGVFMNNVLGF  656

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV LA++YAR + WDFS+EVLV+LIVC VMG+  S  STF LWTSF+A+ LYP+S+ LVY
Sbjct  657  SVLLAIIYAREMAWDFSAEVLVVLIVCTVMGLIASFVSTFSLWTSFLAYLLYPISLLLVY  716

Query  230  VLDYVFGWS  204
            +L+ V  ++
Sbjct  717  ILNDVLNYT  725



>ref|XP_009354324.1| PREDICTED: uncharacterized protein LOC103945475 [Pyrus x bretschneideri]
Length=585

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FFISF+ LP A+ SSE V+ +IF SRKK R+ASL +SE+YG+VTM+N+L L
Sbjct  458  FSTATSIPSFFISFVVLPFAS-SSEIVTTLIFVSRKKQRTASLAYSEIYGSVTMSNILSL  516

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFL LVY R LTW FS+EVLVILIVCI+MG   S R+TFPLW S +A  LYPLS+ LVY
Sbjct  517  AVFLGLVYVRNLTWSFSAEVLVILIVCILMGAIASFRTTFPLWMSSVAILLYPLSLLLVY  576

Query  230  VLDYVFGWS  204
            +L+Y+ GWS
Sbjct  577  ILNYICGWS  585



>gb|EMS60383.1| hypothetical protein TRIUR3_19685 [Triticum urartu]
Length=292

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
             S AT + +FF+SF+ LPL  NSSE VSA+    +KK RSASL  SE+Y  VT+NN++CL
Sbjct  164  LSKATHVSSFFVSFVVLPLVNNSSEVVSAVRSMRKKKRRSASLALSEVYCVVTVNNLMCL  223

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLALVYAR +TWDFSSE+L+IL+VCIVMG+F S R+ FPLWT  +A+ LYPLS+ LV+
Sbjct  224  GMFLALVYARDITWDFSSELLIILLVCIVMGLFTSFRTNFPLWTCLVAYLLYPLSLVLVH  283

Query  230  VLDYVFGWS  204
            +LD VF WS
Sbjct  284  ILDSVFHWS  292



>ref|XP_010052488.1| PREDICTED: uncharacterized protein LOC104441166 isoform X2 [Eucalyptus 
grandis]
Length=491

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FF+SF+ LP A  SSE VS ++F+SRKK R+ SLT+SE+YG+VTM NVL L
Sbjct  364  FSTATSIPSFFVSFVILPFAC-SSEVVSCLMFSSRKKKRTTSLTYSEIYGSVTMGNVLSL  422

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFL LVY R LTWDF SEVLV +IVC+VMG   S R+TFPLW SF+A +LYPLS+ LVY
Sbjct  423  AVFLGLVYVRQLTWDFFSEVLVTVIVCLVMGAIASFRTTFPLWMSFLALALYPLSLLLVY  482

Query  230  VLDYVFGWS  204
            VLDYV G S
Sbjct  483  VLDYVLGLS  491



>ref|XP_010052481.1| PREDICTED: uncharacterized protein LOC104441166 isoform X1 [Eucalyptus 
grandis]
Length=576

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FF+SF+ LP A  SSE VS ++F+SRKK R+ SLT+SE+YG+VTM NVL L
Sbjct  449  FSTATSIPSFFVSFVILPFAC-SSEVVSCLMFSSRKKKRTTSLTYSEIYGSVTMGNVLSL  507

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFL LVY R LTWDF SEVLV +IVC+VMG   S R+TFPLW SF+A +LYPLS+ LVY
Sbjct  508  AVFLGLVYVRQLTWDFFSEVLVTVIVCLVMGAIASFRTTFPLWMSFLALALYPLSLLLVY  567

Query  230  VLDYVFGWS  204
            VLDYV G S
Sbjct  568  VLDYVLGLS  576



>gb|KCW89606.1| hypothetical protein EUGRSUZ_A01890 [Eucalyptus grandis]
Length=557

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FF+SF+ LP A  SSE VS ++F+SRKK R+ SLT+SE+YG+VTM NVL L
Sbjct  430  FSTATSIPSFFVSFVILPFAC-SSEVVSCLMFSSRKKKRTTSLTYSEIYGSVTMGNVLSL  488

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFL LVY R LTWDF SEVLV +IVC+VMG   S R+TFPLW SF+A +LYPLS+ LVY
Sbjct  489  AVFLGLVYVRQLTWDFFSEVLVTVIVCLVMGAIASFRTTFPLWMSFLALALYPLSLLLVY  548

Query  230  VLDYVFGWS  204
            VLDYV G S
Sbjct  549  VLDYVLGLS  557



>ref|XP_011000237.1| PREDICTED: uncharacterized protein LOC105107867 isoform X3 [Populus 
euphratica]
Length=702

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    IP+FF+SF+  PLATN+  A SAI  A RKK  + SLTFSE+YG V MNNVL  
Sbjct  574  FSEDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGC  633

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV L L+YARGLTW+FS+EVLV+LI C +M + GS RS FPLWTSF+AF LYP S+ LVY
Sbjct  634  SVLLFLIYARGLTWEFSAEVLVVLITCAIMSLAGSFRSDFPLWTSFMAFLLYPFSLLLVY  693

Query  230  VLDYVFGW  207
            VL+ V  +
Sbjct  694  VLNDVLDY  701



>ref|XP_011000236.1| PREDICTED: uncharacterized protein LOC105107867 isoform X2 [Populus 
euphratica]
Length=711

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    IP+FF+SF+  PLATN+  A SAI  A RKK  + SLTFSE+YG V MNNVL  
Sbjct  583  FSEDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGC  642

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV L L+YARGLTW+FS+EVLV+LI C +M + GS RS FPLWTSF+AF LYP S+ LVY
Sbjct  643  SVLLFLIYARGLTWEFSAEVLVVLITCAIMSLAGSFRSDFPLWTSFMAFLLYPFSLLLVY  702

Query  230  VLDYVFGW  207
            VL+ V  +
Sbjct  703  VLNDVLDY  710



>ref|XP_011000235.1| PREDICTED: uncharacterized protein LOC105107867 isoform X1 [Populus 
euphratica]
Length=719

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    IP+FF+SF+  PLATN+  A SAI  A RKK  + SLTFSE+YG V MNNVL  
Sbjct  591  FSEDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGC  650

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV L L+YARGLTW+FS+EVLV+LI C +M + GS RS FPLWTSF+AF LYP S+ LVY
Sbjct  651  SVLLFLIYARGLTWEFSAEVLVVLITCAIMSLAGSFRSDFPLWTSFMAFLLYPFSLLLVY  710

Query  230  VLDYVFGW  207
            VL+ V  +
Sbjct  711  VLNDVLDY  718



>gb|EMT26602.1| hypothetical protein F775_16567 [Aegilops tauschii]
Length=241

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
             S AT + +FF+SF+ LPL  NSSE VSA+    +K+ RSASL  SE+Y  VT+NN++CL
Sbjct  113  LSKATHVSSFFVSFVVLPLVNNSSEVVSAVRSMRKKRRRSASLALSEVYCVVTVNNLMCL  172

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLALVYAR +TWDFSSE+L+IL+VC+VMG+F S R+ FPLWT  +A+SLYPLS+ LV+
Sbjct  173  GMFLALVYARDITWDFSSELLIILLVCVVMGLFTSFRTNFPLWTCLVAYSLYPLSLVLVH  232

Query  230  VLDYVFGWS  204
            +LD VF WS
Sbjct  233  ILDSVFHWS  241



>ref|XP_008226451.1| PREDICTED: uncharacterized protein LOC103326025 [Prunus mume]
Length=725

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA SIP+F ++F+ +PLATN+ +A SAI  ASRK  R+ SLTFSE+YG V MNNVL +
Sbjct  597  FSTAVSIPSFCVAFVLVPLATNARQATSAIKAASRKTPRTTSLTFSEIYGGVFMNNVLGV  656

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV LA++YAR +TW+FS+E+LV+LIVC VMGV  S  STF LWT+F+A+ LYP+S+ LVY
Sbjct  657  SVLLAIIYAREMTWEFSAELLVVLIVCTVMGVTASSVSTFSLWTAFLAYLLYPVSLLLVY  716

Query  230  VLDYVFGW  207
            +L+ V  +
Sbjct  717  LLNDVLNY  724



>emb|CDP05977.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A ++P+FFISFI +PLATN+  A+SAI  A RKK R+ SLTFSE+YG V MNN+L  
Sbjct  587  FSEAANMPSFFISFILVPLATNARVAISAISEARRKKPRTTSLTFSEIYGGVFMNNMLGF  646

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV L+L+Y RGLTW FS+EVL++LIV  +MG+ GS RS  PLWTS +A+ LYPLS+ LVY
Sbjct  647  SVLLSLIYFRGLTWIFSAEVLIVLIVSAIMGLLGSFRSIIPLWTSLVAYFLYPLSLVLVY  706

Query  230  VL  225
            +L
Sbjct  707  LL  708



>ref|XP_006370034.1| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
 gb|ERP66603.1| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
Length=499

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 94/129 (73%), Gaps = 4/129 (3%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    IP+FF+SF+  PLATN+  A SAI  A RKK  + SLTFSE+YG V MNNVL  
Sbjct  371  FSEDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGC  430

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV L LVYARGLTW+FS+EVLV+LI C +M +  S RS FPLWTSF+AF LYP S+ LVY
Sbjct  431  SVLLFLVYARGLTWEFSAEVLVVLITCAIMSLAVSFRSDFPLWTSFMAFLLYPFSLFLVY  490

Query  230  ----VLDYV  216
                VLD+V
Sbjct  491  VFNDVLDHV  499



>ref|XP_007213499.1| hypothetical protein PRUPE_ppa022096mg, partial [Prunus persica]
 gb|EMJ14698.1| hypothetical protein PRUPE_ppa022096mg, partial [Prunus persica]
Length=645

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A  IP+F ++F+ +PLATN+ +A SAI  ASRK  R+ SLTFSE+YG V MNNVL +
Sbjct  517  FSEAAGIPSFCVAFVLVPLATNARQATSAIKAASRKTPRTTSLTFSEIYGGVFMNNVLGV  576

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV LA++YAR +TW+FS+E+LV+LIVC VMG+  S  STF LWT+F+ + LYP+S+ LVY
Sbjct  577  SVLLAIIYAREMTWEFSAELLVVLIVCTVMGIIASFVSTFSLWTAFLTYLLYPVSLLLVY  636

Query  230  VLDYVFGWS  204
            +L+ V  ++
Sbjct  637  LLNDVLKYT  645



>ref|XP_002298902.2| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
 gb|EEE83707.2| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
Length=690

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 94/129 (73%), Gaps = 4/129 (3%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    IP+FF+SF+  PLATN+  A SAI  A RKK  + SLTFSE+YG V MNNVL  
Sbjct  562  FSEDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGC  621

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV L LVYARGLTW+FS+EVLV+LI C +M +  S RS FPLWTSF+AF LYP S+ LVY
Sbjct  622  SVLLFLVYARGLTWEFSAEVLVVLITCAIMSLAVSFRSDFPLWTSFMAFLLYPFSLFLVY  681

Query  230  ----VLDYV  216
                VLD+V
Sbjct  682  VFNDVLDHV  690



>ref|XP_006370033.1| hypothetical protein POPTR_0001s38420g [Populus trichocarpa]
 gb|ERP66602.1| hypothetical protein POPTR_0001s38420g [Populus trichocarpa]
Length=632

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 93/129 (72%), Gaps = 4/129 (3%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    IP+FF+SF+ +PLATN+  A SAI  A RKK  + SLTFSE+YG V MNNVL  
Sbjct  504  FSEDAGIPSFFVSFVLVPLATNARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGC  563

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV L LVYARGLTW+FS+EVLV+LI C +M +  S  S FPLWTSF+AF LYP S+ L Y
Sbjct  564  SVLLFLVYARGLTWEFSAEVLVVLITCAIMSLVVSFHSDFPLWTSFMAFLLYPFSLLLAY  623

Query  230  ----VLDYV  216
                VLDYV
Sbjct  624  VFNDVLDYV  632



>ref|XP_008229131.1| PREDICTED: uncharacterized protein LOC103328510 [Prunus mume]
Length=575

 Score =   147 bits (372),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FFISF+ LP A+ SSE VS +IF SRKK R+ASL +SE+YG+VTM+N+L L
Sbjct  448  FSTATSIPSFFISFVILPFAS-SSEIVSTLIFVSRKKQRTASLAYSEIYGSVTMSNILSL  506

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFL LVY R LTW FS+EVLVI++VCI+MG   S R+TFPLW S +A  LYPLS+ LVY
Sbjct  507  AVFLGLVYIRNLTWSFSAEVLVIVVVCILMGAIASFRTTFPLWMSLVAMLLYPLSLLLVY  566

Query  230  VLDYVFGWS  204
            +LDYVFGWS
Sbjct  567  ILDYVFGWS  575



>ref|XP_007213018.1| hypothetical protein PRUPE_ppa023026mg [Prunus persica]
 gb|EMJ14217.1| hypothetical protein PRUPE_ppa023026mg [Prunus persica]
Length=575

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTATSIP+FF+SF+ LP A+ SSE VS +IF SRKK R+ASL +SE+YG+VTM+N+L L
Sbjct  448  FSTATSIPSFFVSFVILPFAS-SSEIVSTLIFVSRKKQRTASLAYSEIYGSVTMSNILSL  506

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +VFL LVY R LTW FS+EVLVI++VCI+MG   S R+TFPLW S +A  LYPLS+ LVY
Sbjct  507  AVFLGLVYIRNLTWSFSAEVLVIVVVCILMGAIASFRTTFPLWMSLVAMLLYPLSLLLVY  566

Query  230  VLDYVFGWS  204
            +LDYVFGWS
Sbjct  567  ILDYVFGWS  575



>ref|XP_006446746.1| hypothetical protein CICLE_v10018123mg, partial [Citrus clementina]
 gb|ESR59986.1| hypothetical protein CICLE_v10018123mg, partial [Citrus clementina]
Length=575

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA++IP+ F++FI LP AT SSEAVSA+IFASRK+ R++SLT+S +YG+VTM+N+L L
Sbjct  450  FSTASNIPSLFVAFIILPFAT-SSEAVSALIFASRKRSRTSSLTYSAIYGSVTMSNILSL  508

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  246
            SVFL+LVY R LTW+FS+EV VIL+VCI+MG+  S R+TFPLW   +A  LYP S
Sbjct  509  SVFLSLVYFRHLTWNFSAEVSVILLVCILMGLIASFRTTFPLWMCLVACMLYPFS  563



>ref|XP_010279180.1| PREDICTED: uncharacterized protein LOC104613163 [Nelumbo nucifera]
Length=565

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA +IP+FFISF+ LPLA N  EAVSAI  A +KK RSASLTFSE+Y AV MNN++ +
Sbjct  437  FSTAANIPSFFISFVFLPLAVNYREAVSAITAARQKKQRSASLTFSEIYSAVFMNNIVGI  496

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            S+FL LVY RGL WDFS+EVLV+LIVCIVMG+     + FPLWTS +A+ LYP S+ LV+
Sbjct  497  SIFLVLVYIRGLAWDFSAEVLVVLIVCIVMGLVSGFCNVFPLWTSIVAYLLYPFSLLLVF  556

Query  230  VLDYVFGW  207
            +L Y FGW
Sbjct  557  ILIYFFGW  564



>ref|XP_006469050.1| PREDICTED: uncharacterized protein LOC102616350 [Citrus sinensis]
Length=577

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA++IP+ F++FI LP AT SSEAVSA+IFASRK+ R++SLT+S +YG+VTM+N+L L
Sbjct  450  FSTASNIPSLFVAFIILPFAT-SSEAVSALIFASRKRSRTSSLTYSAIYGSVTMSNILSL  508

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  246
            SVFL+LVY R LTW+FS+EV VIL+VCI MG+  S R+TFPLW   +A  LYP+S
Sbjct  509  SVFLSLVYFRHLTWNFSAEVSVILLVCISMGLIASFRTTFPLWMCLVACMLYPIS  563



>ref|XP_002962226.1| hypothetical protein SELMODRAFT_76965 [Selaginella moellendorffii]
 gb|EFJ37486.1| hypothetical protein SELMODRAFT_76965 [Selaginella moellendorffii]
Length=546

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A+ IP FF+SF+  P+AT+SSE +S+I FAS+K+ R  S+T+S+LYG+V +NN LCL
Sbjct  418  FSRASHIPAFFVSFVVTPIATSSSEVISSITFASKKQKRGISVTYSQLYGSVVLNNTLCL  477

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLA+V ARGL WDFS+EVL++ +  + MG  G + +T PL+ +F AF LYPLS+ LV 
Sbjct  478  GLFLAIVAARGLVWDFSAEVLIMALATMAMGCVGGLFTTIPLFMAFGAFLLYPLSLGLVV  537

Query  230  VLDYVFGWS  204
            +L+   GW 
Sbjct  538  LLNQFLGWH  546



>ref|XP_002965139.1| hypothetical protein SELMODRAFT_82683 [Selaginella moellendorffii]
 gb|EFJ33977.1| hypothetical protein SELMODRAFT_82683 [Selaginella moellendorffii]
Length=546

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A+ IP FF+SF+  P+AT+SSE +S+I FAS+K+ R  S+T+S+LYG+V +NN LCL
Sbjct  418  FSRASHIPAFFVSFVVTPIATSSSEVISSITFASKKQKRGISVTYSQLYGSVVLNNTLCL  477

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLA+V ARGL WDFS+EVL++ +  + MG  G + +T PL+ +F AF LYPLS+ LV 
Sbjct  478  GLFLAIVAARGLVWDFSAEVLIMALATMAMGCVGGIFTTIPLFMAFGAFLLYPLSLGLVV  537

Query  230  VLDYVFGWS  204
            +L+   GW 
Sbjct  538  LLNQYLGWH  546



>ref|NP_001046432.2| Os02g0247800 [Oryza sativa Japonica Group]
 dbj|BAF08346.2| Os02g0247800, partial [Oryza sativa Japonica Group]
Length=84

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  452  ELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSF  273
            ++YG VTMNN LCL+VFLALVY RGLTWDFSSEVL+IL+VCI+MG+F S R+ FPLWT F
Sbjct  2    QVYGGVTMNNTLCLAVFLALVYVRGLTWDFSSEVLIILLVCIIMGLFTSFRTDFPLWTCF  61

Query  272  IAFSLYPLSIALVYVLDYVFGWS  204
            +AF LYPLS+ +VY+LDY FGWS
Sbjct  62   VAFLLYPLSLIMVYILDYKFGWS  84



>ref|XP_011096403.1| PREDICTED: uncharacterized protein LOC105175606 [Sesamum indicum]
Length=719

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A  +P+FFISF+ +P+A N+  A+ AI  AS+K  R++SLTFSE+YG V MNN++ L
Sbjct  591  FSDAIGVPSFFISFVIVPVAMNARSAILAIFPASQKSSRTSSLTFSEIYGGVVMNNMMGL  650

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            S  LA+VY + L WD+S+EVL IL+VC ++G+    ++T+PLWT  +AF LYP S+A+ Y
Sbjct  651  STLLAIVYIKELEWDYSAEVLTILVVCGIIGLLAYSQTTYPLWTCVLAFFLYPFSLAMYY  710

Query  230  VLDYVFGWS  204
             L Y+ GW 
Sbjct  711  ALQYILGWG  719



>ref|XP_009605371.1| PREDICTED: uncharacterized protein LOC104099939 [Nicotiana tomentosiformis]
Length=706

 Score =   142 bits (359),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 63/129 (49%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
             S A  +P+F I F+ +PLA N+  A++AI  AS+K  ++ASLTFSE+YG V MNN++ +
Sbjct  578  LSDAMGMPSFLIPFVMVPLALNARMAIAAIFPASQKSSKTASLTFSEIYGGVIMNNIMGM  637

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +  LA V+ + L WD+S+EVL++L+VC V+G+     +T+PLWT  +AFSLYP S+ L Y
Sbjct  638  TTLLAAVFIKDLRWDYSAEVLIVLVVCSVVGLLAFFTTTYPLWTCLLAFSLYPFSVLLFY  697

Query  230  VLDYVFGWS  204
            +L+ VFGW+
Sbjct  698  LLECVFGWA  706



>ref|XP_009803286.1| PREDICTED: uncharacterized protein LOC104248681 [Nicotiana sylvestris]
Length=706

 Score =   140 bits (354),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 63/129 (49%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
             S A  +P+F I F+ +PLA N+  A++AI  AS+K  ++ASLTFSE+YG V MNN++ +
Sbjct  578  LSDAMGMPSFLIPFVMVPLALNARMAIAAIFPASQKSSKTASLTFSEIYGGVIMNNIMGM  637

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +  LA+V  + L WD+S+EVL++L+VC V+G+     +T+PLWT  +AFSLYP S+ L Y
Sbjct  638  TTLLAVVCIKDLRWDYSAEVLIVLVVCSVVGLLAFFSTTYPLWTCLLAFSLYPFSVLLFY  697

Query  230  VLDYVFGWS  204
            +L+ VFGW+
Sbjct  698  LLECVFGWA  706



>ref|XP_011082730.1| PREDICTED: uncharacterized protein LOC105165425 [Sesamum indicum]
Length=724

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 94/129 (73%), Gaps = 1/129 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
             S A +IP+FFI+FI +PLATN+  A+SAI    RKKL   SLTFSE+YG V MNN+L  
Sbjct  596  LSEAANIPSFFIAFIFVPLATNARIAISAISEVRRKKLNINSLTFSEIYGTVLMNNLLGF  655

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV L+L+Y RGL+WDFS EVL++LIV  VMG   S  + FP+WTSF+A+ LYP+S+ LV 
Sbjct  656  SVLLSLIYFRGLSWDFSVEVLMVLIVSAVMGCLASFSTIFPVWTSFLAYLLYPMSLVLVN  715

Query  230  VLDYVFGWS  204
            VL   F WS
Sbjct  716  VLGD-FKWS  723



>gb|EYU28050.1| hypothetical protein MIMGU_mgv1a023246mg [Erythranthe guttata]
Length=682

 Score =   139 bits (349),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 66/129 (51%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
             S A  +P+F ISF+ +PLA N+  A++A + AS+K  RSASLTFSE+YG V MNN+  L
Sbjct  554  LSYAMGLPSFGISFVIVPLAMNARAALTAFLPASQKSERSASLTFSEIYGGVIMNNIAGL  613

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +  LA+VYA+ LTWDFS+EVL IL+VC ++G       T+PLWTS +AF LYP S+ L Y
Sbjct  614  TTLLAIVYAKDLTWDFSAEVLTILVVCAIIGYLSYSSPTYPLWTSIVAFFLYPFSMGLCY  673

Query  230  VLDYVFGWS  204
             +     W+
Sbjct  674  FVQVYLSWN  682



>ref|XP_011083284.1| PREDICTED: uncharacterized protein LOC105165819 [Sesamum indicum]
Length=714

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A  IP+F+++FI +PLAT +  AVSAI  A RKKL + SLT SE+YG V MNN+L L
Sbjct  586  FSKAARIPSFYVAFIFVPLATTARLAVSAINEARRKKLHTTSLTLSEIYGTVFMNNILGL  645

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +V L+L+Y RGL+W+FS+EVL++L+V  ++G   S  + FP+WTS +A+ LYPLS+ LVY
Sbjct  646  AVLLSLIYFRGLSWNFSAEVLMVLLVSAIIGFLASFNTVFPVWTSILAYMLYPLSLILVY  705

Query  230  VL  225
            +L
Sbjct  706  IL  707



>emb|CAN78275.1| hypothetical protein VITISV_037788 [Vitis vinifera]
Length=529

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+A +IP+F IS++ +P+A +  E + AI  A  K  ++ SLTFSE+Y AV MNN++ L
Sbjct  401  FSSAVNIPSFIISYVIIPVAMSYRETLGAIKSARXKTKQAISLTFSEIYNAVFMNNMMGL  460

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            ++FL LVY R L+WD S+E+LV+LI+C +MG+  S  + FP+WT+ IA+ +YP+S+ L+Y
Sbjct  461  AMFLLLVYIRDLSWDVSAEILVVLIICTLMGLLTSCSTKFPIWTAIIAYLMYPISLGLLY  520

Query  230  VLDYVFGWS  204
            VL  V GWS
Sbjct  521  VLTEVLGWS  529



>ref|XP_004233846.1| PREDICTED: uncharacterized protein LOC101251749 [Solanum lycopersicum]
Length=716

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
             S A  IP+F I F+ +PLA N+  A++AI  AS+K   +ASLTFSE+YG V MNN++ +
Sbjct  588  LSDAMGIPSFLIPFVMVPLALNARMAIAAIFPASQKSSITASLTFSEIYGGVIMNNIMGM  647

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +  LA+V  + L WD+S+EVL+IL+VC V+G+     +T+PLWT  +AFSLYP S+ L Y
Sbjct  648  ATLLAVVCIKDLRWDYSAEVLIILVVCSVIGLLAFFSTTYPLWTCLVAFSLYPFSVVLFY  707

Query  230  VLDYVFGWS  204
            +L+ VFGW+
Sbjct  708  LLECVFGWA  716



>gb|EYU44996.1| hypothetical protein MIMGU_mgv1a025835mg [Erythranthe guttata]
Length=651

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 89/127 (70%), Gaps = 1/127 (1%)
 Frame = -1

Query  587  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  408
            S A SIP+FFI+FI +PLATN+   +SAI    RKKL   SLTFSE+YG V MNN+L  S
Sbjct  525  SKAASIPSFFIAFIFVPLATNARITISAIGEVRRKKLNITSLTFSEIYGTVLMNNLLGFS  584

Query  407  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYV  228
            V L+L+Y RG +WDFS EVL++LIVC VMG   S  + FP+WT+  A  LYPLS+ LV V
Sbjct  585  VLLSLIYFRGFSWDFSVEVLMVLIVCAVMGCLASFSTVFPVWTAVFACMLYPLSLVLVTV  644

Query  227  LDYVFGW  207
            L   F W
Sbjct  645  LGD-FNW  650



>ref|XP_002272134.1| PREDICTED: uncharacterized protein LOC100243523 [Vitis vinifera]
 emb|CBI30651.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS+A +IP+F IS++ +P+A +  E + AI  A  K  ++ SLTFSE+Y AV MNN++ L
Sbjct  431  FSSAVNIPSFIISYVIIPVAMSYRETLGAIKSARLKTKQAISLTFSEIYNAVFMNNMMGL  490

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            ++FL LVY R L+WD S+E+LV+LI+C +MG+  S  + FP+WT+ IA+ +YP+S+ L+Y
Sbjct  491  AMFLLLVYIRDLSWDVSAEILVVLIICTLMGLLTSCSTKFPIWTAIIAYLMYPISLGLLY  550

Query  230  VLDYVFGWS  204
            VL  V GWS
Sbjct  551  VLTEVLGWS  559



>ref|XP_002522529.1| calmodulin, putative [Ricinus communis]
 gb|EEF39829.1| calmodulin, putative [Ricinus communis]
Length=703

 Score =   135 bits (341),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 63/128 (49%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
             S    I +F+ISF+ LP A N   A++ I  AS+KK  ++S+ FSE+YGAV MNNV  L
Sbjct  575  LSERIGISSFYISFVVLPFAVNFKTAMATIFPASQKKEEASSIMFSEIYGAVFMNNVSGL  634

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
               LAL++ARG TWD+S+EV+V+L+V  ++G    +R  +PLWT  +AFS YPLS+ L Y
Sbjct  635  LTLLALIWARGFTWDYSAEVIVLLVVSAIIGAIAFLRRIYPLWTCLLAFSFYPLSLVLFY  694

Query  230  VLDYVFGW  207
            V+ +V GW
Sbjct  695  VIRFVLGW  702



>ref|XP_008358657.1| PREDICTED: uncharacterized protein LOC103422380 [Malus domestica]
Length=410

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA SIP+F  S++ +PLATN   A+ +++ A  K   + SLT SE+Y A  MNN++ L
Sbjct  282  FSTAASIPSFMASYVVIPLATNYRLALMSVLSAKDKTENAISLTLSEIYNAAFMNNIVGL  341

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLALVY R L+WD ++EVLV+LI+ I +G+  S    FP WTS +A+ LYP+S+ LVY
Sbjct  342  IIFLALVYIRNLSWDVAAEVLVVLIISIAVGLSASFSRKFPFWTSILAYILYPISLLLVY  401

Query  230  VLDYVFGWS  204
            VL  V GWS
Sbjct  402  VLTIVIGWS  410



>ref|XP_007214217.1| hypothetical protein PRUPE_ppa023212mg [Prunus persica]
 gb|EMJ15416.1| hypothetical protein PRUPE_ppa023212mg [Prunus persica]
Length=535

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA SIP+F  S+I +P ATN   A+ ++  A  K   + SLT SE+Y  V MNN++ L
Sbjct  407  FSTAASIPSFLTSYILIPWATNYRLALRSVTSAREKTDNAISLTLSEIYNGVFMNNIMGL  466

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            ++FLALVY R L+W+ S+E LV+LI+C  MG+  S    FP WTS IA+ LYP+S+ LVY
Sbjct  467  TIFLALVYIRNLSWEVSAESLVVLIICTAMGLSTSFSRKFPFWTSIIAYILYPVSLLLVY  526

Query  230  VLDYVFGWS  204
            VL   FGWS
Sbjct  527  VLTTFFGWS  535



>ref|XP_002522528.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39828.1| conserved hypothetical protein [Ricinus communis]
Length=521

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            F+TA +IP+F +S+  +PLA +  +A  AI  A  K   +ASLT SELYG V MNNV+ L
Sbjct  393  FATAINIPSFLVSYFVVPLALSFKQAYRAITSAREKTENAASLTLSELYGGVFMNNVMGL  452

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            ++FL LV  + L+WD S+E+LV+LI+C  MG++ +  + FP WTS IA++LYP+S+A +Y
Sbjct  453  AIFLLLVCIKDLSWDVSAEILVVLIICSGMGIYATFSTKFPFWTSIIAYALYPISLAFIY  512

Query  230  VLDYVFGW  207
            VL    GW
Sbjct  513  VLTTYCGW  520



>gb|KCW67432.1| hypothetical protein EUGRSUZ_F01188 [Eucalyptus grandis]
Length=502

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS +  IP+FFISFI +PLATN+  A +AI  A  KK R+ SLT SE+YG V M+N+L  
Sbjct  374  FSKSAGIPSFFISFILVPLATNARGASAAIKAARHKKERTTSLTLSEIYGEVFMSNMLGF  433

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             V L+L+YAR LTW+FS+EVLV+LIVC V+G+  S RSTFP+WTS +A+ LYPLS+ LVY
Sbjct  434  CVLLSLIYARDLTWEFSAEVLVVLIVCGVVGLIASFRSTFPVWTSILAYLLYPLSLLLVY  493

Query  230  VLDYVFGWS  204
            VLD V  +S
Sbjct  494  VLDDVLNYS  502



>gb|ABK93869.1| unknown [Populus trichocarpa]
Length=76

 Score =   121 bits (304),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -1

Query  431  MNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYP  252
            MNNVLCLSVFLALVY R LTWDFS+EVLVI IVCI MG F S R+TFPLWT F+A+ LYP
Sbjct  1    MNNVLCLSVFLALVYFRELTWDFSAEVLVICIVCIAMGAFASFRTTFPLWTCFLAYFLYP  60

Query  251  LSIALVYVLDYVFGWS  204
             S+ LVYVLDYV GWS
Sbjct  61   FSLVLVYVLDYVLGWS  76



>ref|XP_006594742.1| PREDICTED: uncharacterized protein LOC100798009 isoform X2 [Glycine 
max]
Length=705

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS +     FF+SFI  PLATN+ EA SAI  AS KK R+ SL  SE+YG V MNN+L  
Sbjct  577  FSNSAGFHPFFMSFILAPLATNAREATSAIKEASHKKPRTTSLAISEIYGGVFMNNILGF  636

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
                 L++ R +TW FS+E+LV+ IVC + G+  S  S FP+W+SFIA  LYPLS+ LV+
Sbjct  637  FAISVLIFVREVTWQFSAELLVVAIVCAITGITASFHSIFPIWSSFIAILLYPLSLVLVF  696

Query  230  VLDYVFGWS  204
            +LD+V  ++
Sbjct  697  ILDHVLNYN  705



>ref|XP_006594743.1| PREDICTED: uncharacterized protein LOC100798009 isoform X3 [Glycine 
max]
Length=694

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS +     FF+SFI  PLATN+ EA SAI  AS KK R+ SL  SE+YG V MNN+L  
Sbjct  566  FSNSAGFHPFFMSFILAPLATNAREATSAIKEASHKKPRTTSLAISEIYGGVFMNNILGF  625

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
                 L++ R +TW FS+E+LV+ IVC + G+  S  S FP+W+SFIA  LYPLS+ LV+
Sbjct  626  FAISVLIFVREVTWQFSAELLVVAIVCAITGITASFHSIFPIWSSFIAILLYPLSLVLVF  685

Query  230  VLDYVFGWS  204
            +LD+V  ++
Sbjct  686  ILDHVLNYN  694



>ref|XP_006594741.1| PREDICTED: uncharacterized protein LOC100798009 isoform X1 [Glycine 
max]
Length=712

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS +     FF+SFI  PLATN+ EA SAI  AS KK R+ SL  SE+YG V MNN+L  
Sbjct  584  FSNSAGFHPFFMSFILAPLATNAREATSAIKEASHKKPRTTSLAISEIYGGVFMNNILGF  643

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
                 L++ R +TW FS+E+LV+ IVC + G+  S  S FP+W+SFIA  LYPLS+ LV+
Sbjct  644  FAISVLIFVREVTWQFSAELLVVAIVCAITGITASFHSIFPIWSSFIAILLYPLSLVLVF  703

Query  230  VLDYVFGWS  204
            +LD+V  ++
Sbjct  704  ILDHVLNYN  712



>ref|XP_005839482.1| hypothetical protein GUITHDRAFT_159252 [Guillardia theta CCMP2712]
 gb|EKX52502.1| hypothetical protein GUITHDRAFT_159252 [Guillardia theta CCMP2712]
Length=503

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -1

Query  578  TSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFL  399
            + IP FF+SF+  P A+N+SE VS++ FA +KK ++ SLT+S++YGAVTMNN +CL +FL
Sbjct  379  SHIPAFFVSFLVTPFASNASELVSSLQFAKKKKKKNISLTYSQVYGAVTMNNTMCLGLFL  438

Query  398  ALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDY  219
             +V+ R L W+FSSEV+  + +   +GV    R TFPL+ +F + SLYP+++ALVY LDY
Sbjct  439  LVVWYRNLDWNFSSEVVTTMSMIFALGVVACTRVTFPLYMAFFSLSLYPIALALVYFLDY  498

Query  218  VFGWS  204
            V GW 
Sbjct  499  VVGWQ  503



>ref|XP_004361492.1| hypothetical protein DFA_05775 [Dictyostelium fasciculatum]
 gb|EGG23641.1| hypothetical protein DFA_05775 [Dictyostelium fasciculatum]
Length=582

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            F T   I  FFISFI  P  +N+SE +S++IFAS+K+ +++SLT+S LYG+ TMNN LCL
Sbjct  454  FGTKLDINLFFISFIVTPFCSNASELISSLIFASKKRKQNSSLTYSALYGSATMNNTLCL  513

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +F ALVY R LTW+FS+E + IL V + +G+ GS++ T  L+ + +  SLYP S+ +VY
Sbjct  514  GIFFALVYFRDLTWEFSAETVTILFVTVCVGLIGSLKKTMKLYLAPLVLSLYPFSLVIVY  573

Query  230  VLDYVFGWS  204
            +L+    W 
Sbjct  574  LLETFAHWQ  582



>ref|XP_004293919.1| PREDICTED: uncharacterized protein LOC101312324 [Fragaria vesca 
subsp. vesca]
Length=562

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA SIP+FF S++ +PLA N  +A+  I  A  K   + SL+ SE+Y  V MNNV+ L
Sbjct  434  FSTAASIPSFFTSYVLIPLAINYGQALQLITSAQDKTENAVSLSLSEIYNGVFMNNVMGL  493

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            ++FLALVY R L+WD  + VL +LI+C VMG++ S  + FP WT  +A+ +YP+S+ ++Y
Sbjct  494  TIFLALVYIRNLSWDVCAAVLAVLIICSVMGLYTSFSTKFPFWTCILAYIMYPISLLMIY  553

Query  230  VLDYVFGWS  204
            VL    GW+
Sbjct  554  VLTSYLGWT  562



>gb|EYU26347.1| hypothetical protein MIMGU_mgv1a002045mg [Erythranthe guttata]
Length=723

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS + ++P+F+++F+ +PLAT +  AVSAI  A +KKL + SLT SE+YG V MNNVL L
Sbjct  591  FSKSANLPSFYVAFVFVPLATTARLAVSAISEARKKKLHTNSLTLSEIYGTVFMNNVLGL  650

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             V L+L+Y RGL+W FS+EV ++L+V  VMG   S  +  P+WT+F+A+ +YPLS+ LVY
Sbjct  651  IVLLSLIYFRGLSWSFSTEVTMVLVVSAVMGFLASYSTVLPVWTAFLAYLMYPLSLVLVY  710

Query  230  VL  225
            VL
Sbjct  711  VL  712



>ref|XP_008383659.1| PREDICTED: uncharacterized protein LOC103446347 [Malus domestica]
Length=563

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA SIP+F  S++ +PLATN   A+ ++  A  K   + SLT SE+Y A  MNN++ L
Sbjct  435  FSTAASIPSFTTSYVVIPLATNYRLALMSVSSAKEKTENAISLTLSEIYNAAFMNNIVGL  494

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLALVY R L+WD ++EVLV+LI+ I +G+  S    FP WTS +A+ LYP+S+ LVY
Sbjct  495  IIFLALVYIRNLSWDVAAEVLVVLIISIAVGLSASFSRKFPFWTSILAYILYPISLLLVY  554

Query  230  VLDYVFGWS  204
            VL  V GWS
Sbjct  555  VLTIVIGWS  563



>ref|XP_006594744.1| PREDICTED: uncharacterized protein LOC100799062 [Glycine max]
Length=503

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    I +FFISFI +PLATN  EA SAI  AS KK  + S T  E+YGAV MNN+L  
Sbjct  375  FSEEAGISSFFISFILVPLATNFREATSAIKEASHKKSSNTSQTMYEIYGAVFMNNILGF  434

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             V   L+Y R +TW+FS++VLV+ IVC VMG+  S R TFPLWTSF A+ +Y +++ LV+
Sbjct  435  VVISILIYMREITWEFSADVLVVAIVCAVMGLTASFRPTFPLWTSFPAYLMYLIALLLVF  494

Query  230  VLDYVFGW  207
            VL  V  +
Sbjct  495  VLKDVLNY  502



>gb|KHN36865.1| hypothetical protein glysoja_001596 [Glycine soja]
Length=640

 Score =   129 bits (324),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 68/128 (53%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    I +FFISFI +PLATN  EA SAI  AS KK  + S T  E+YGAV MNN+L  
Sbjct  512  FSEEAGISSFFISFILVPLATNFREATSAIKEASHKKSSNTSQTMYEIYGAVFMNNILGF  571

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             V   L+Y R +TW+FS++VLV+ IVC VMG+  S R TFPLWTSF A+ +Y +++ LV+
Sbjct  572  VVISILIYMREITWEFSADVLVVAIVCAVMGLTASFRPTFPLWTSFPAYLMYLIALLLVF  631

Query  230  VLDYVFGW  207
            VL  V  +
Sbjct  632  VLKDVLNY  639



>gb|EYU44995.1| hypothetical protein MIMGU_mgv1a002795mg [Erythranthe guttata]
Length=637

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS +  +P+F+++F+ +PL TN+  AVSA+  A RKKL   SLTFSE+Y  V MNNVL L
Sbjct  508  FSKSAKVPSFYVAFVLVPLTTNARIAVSAVREARRKKLHLTSLTFSEIYSTVLMNNVLGL  567

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             V L+LVY RGL W++S+E+L + IV  ++G+F S+   +P+WTS  A+ +YPLS+ LVY
Sbjct  568  IVLLSLVYFRGLAWNYSAEILAVTIVSGIVGIFSSLSRIYPVWTSISAYLMYPLSLVLVY  627

Query  230  VLDYVFGWS  204
            +  + +  S
Sbjct  628  IFGHFYSSS  636



>gb|KDP21053.1| hypothetical protein JCGZ_21524 [Jatropha curcas]
Length=686

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
             S    IP+FF+SF+ LP A N   A++ I  AS+KK  ++S+ FSE+YGAV MNN+L L
Sbjct  558  LSERIGIPSFFVSFVVLPFAVNFKTAMATIFPASQKKEGASSIMFSEIYGAVFMNNILGL  617

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
               + L++ARG TW +S+EVLVI+++  ++G+    R  +PLWT  +AFSLYPLS+ L Y
Sbjct  618  VTLVGLIWARGFTWVYSAEVLVIVVISAIIGLIAFRRIKYPLWTCIVAFSLYPLSLLLFY  677

Query  230  VLDYVFGWS  204
            ++ Y+ GW 
Sbjct  678  IIRYIVGWK  686



>ref|XP_008225191.1| PREDICTED: uncharacterized protein LOC103324855 [Prunus mume]
Length=563

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA SIP+F  S+I +P +TN   A+ ++  A  K   + SLT SE+Y  V MNN   L
Sbjct  435  FSTAASIPSFLTSYILIPWSTNYRLALRSVTSAREKTDNAISLTLSEIYNGVFMNNTTGL  494

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLALVY R L+W+ S+E LV+LI+C VMG+  S    FP WTS IA+ LYP+S+ LVY
Sbjct  495  IIFLALVYIRNLSWEVSAECLVVLIICTVMGLSTSFSRKFPFWTSIIAYILYPVSLLLVY  554

Query  230  VLDYVFGWS  204
            VL   FGWS
Sbjct  555  VLTTFFGWS  563



>ref|XP_009352820.1| PREDICTED: uncharacterized protein LOC103944133 [Pyrus x bretschneideri]
Length=567

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA SIPTF  S++ +PLATN   A+ ++  A  K   + SLT SE+Y A  MNN++ L
Sbjct  439  FSTAASIPTFTTSYVVIPLATNYRVALMSVSSAKEKTENAISLTLSEIYNAAFMNNIVGL  498

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLALVY R L+W  ++EVLV+LI+ I +G+  S    FPLWT  +A+ LYP+S+ LVY
Sbjct  499  VIFLALVYIRNLSWHVAAEVLVVLIISIAVGLSASFSRRFPLWTCILAYILYPISLLLVY  558

Query  230  VLDYVFGWS  204
            VL  V GWS
Sbjct  559  VLTIVIGWS  567



>gb|KCW67433.1| hypothetical protein EUGRSUZ_F01189 [Eucalyptus grandis]
Length=502

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS +  IP FFISFI +PLATN+  A +AI  A  KK R+ SLT SE+YG V M+N+L  
Sbjct  374  FSKSAGIPPFFISFILVPLATNARGASAAIKAARHKKERTTSLTLSEIYGEVFMSNMLGF  433

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             V L+L+Y R LTW+FS+EVLV+LIVC ++G+  S RSTFP+WTS +A+ LYPLS+ LVY
Sbjct  434  CVLLSLIYVRDLTWEFSAEVLVVLIVCSLVGLIASFRSTFPVWTSILAYLLYPLSLLLVY  493

Query  230  VLDYVFGWS  204
            VLD V  +S
Sbjct  494  VLDDVLNYS  502



>ref|XP_011460597.1| PREDICTED: uncharacterized protein LOC101307679 [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA SIP+F  S++ +P A N  +A+  +  A  K   + SLT SE+Y  V MNN++ L
Sbjct  287  FSTAASIPSFLSSYVLIPFAINIGQALQLVTSAQHKTENAISLTLSEIYNGVFMNNIMGL  346

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            ++FLALVY R L+WD  +  L +LI+C VMGV+ S  + FP WT  +A+ +YP+S+ ++Y
Sbjct  347  TIFLALVYIRNLSWDVGAASLAVLIICSVMGVYTSFSTKFPFWTCILAYIMYPISLLMIY  406

Query  230  VLDYVFGWS  204
            VL   FGW+
Sbjct  407  VLTSYFGWT  415



>ref|XP_011096404.1| PREDICTED: uncharacterized protein LOC105175608 [Sesamum indicum]
Length=707

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
             S A  + +F ISF+ +PLA N+  A++A++ A +K  RSASLTFSE+YG V MNN+  L
Sbjct  579  LSYAMRLSSFSISFVIVPLAMNARTAITALLPAKQKNERSASLTFSEIYGGVIMNNIAGL  638

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            +  LA+V+A+ LTWDFS+EVL IL+VC ++G+     +T+PLWT  +AF LYP S+ + Y
Sbjct  639  TTLLAIVFAKELTWDFSAEVLTILVVCAIIGILAYSCNTYPLWTCILAFFLYPFSLGMYY  698

Query  230  VLDYVFGWS  204
             +     W+
Sbjct  699  FVQVFLSWN  707



>ref|XP_004963827.1| PREDICTED: uncharacterized protein LOC101777425 [Setaria italica]
Length=168

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -1

Query  482  KLRSASLTFSELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSM  303
            + R  +   SE+YG +TMNN LCL VFLALVY R LTWDFSSEVL+  ++C+V+ +F S 
Sbjct  76   QWRRWARRGSEVYGGMTMNNTLCLGVFLALVYFRNLTWDFSSEVLISELICVVVALFTSF  135

Query  302  RSTFPLWTSFIAFSLYPLSIALVYVLDYVFGWS  204
            R+TFPLWT  +A   YPLS+ ++Y+LDYVFGWS
Sbjct  136  RNTFPLWTCLVACMFYPLSLGILYILDYVFGWS  168



>ref|XP_009352959.1| PREDICTED: uncharacterized protein LOC103944258 [Pyrus x bretschneideri]
Length=564

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA SIP+F +S++ +PLATN   A+ ++  A  K   + SLT SE+Y A  MNN++ L
Sbjct  436  FSTAASIPSFAVSYVVIPLATNYRLALMSVTSAKEKTENAISLTLSEIYNATFMNNIVGL  495

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLALVY R L+WD +++VLV+L++   +G+       FP WTS +A+ LYPLS+ LVY
Sbjct  496  VIFLALVYIRNLSWDVAADVLVVLLISTAVGLSACFSRKFPFWTSILAYILYPLSLLLVY  555

Query  230  VLDYVFGWS  204
            VL  V GWS
Sbjct  556  VLTTVIGWS  564



>gb|KDP21052.1| hypothetical protein JCGZ_21523 [Jatropha curcas]
Length=571

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            F+T  +IP+F +S+  +PLA +  +A  AI  A  K  ++ SLT SELYG V MNNV+ L
Sbjct  443  FATDINIPSFLVSYFVVPLALSFKQAYRAITSAREKTEKAVSLTLSELYGGVFMNNVMGL  502

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            ++FLALV  + L+WD S+E+L +LI+C  MG+  +  S FP WT  IA++LYP+S+A +Y
Sbjct  503  AIFLALVCIKDLSWDVSAEILTVLIICSGMGLSATFSSKFPFWTCIIAYALYPISLAFIY  562

Query  230  VLDYVFGW  207
            VL    GW
Sbjct  563  VLTTFCGW  570



>ref|XP_007025465.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
 gb|EOY28087.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
Length=574

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FST+ +IP+F +S++ +P A +   A  AI  A +K   +ASLTFSELYGAV MNNV+ L
Sbjct  446  FSTSANIPSFLVSYVVIPWALSFRLAFRAISSARQKTENAASLTFSELYGAVFMNNVMGL  505

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FL+LVY R + W  S+EVLV+L++C  MG+F +  +   LWT  + + LYP+S+ L+Y
Sbjct  506  VIFLSLVYIRNIPWGVSAEVLVVLLICTAMGLFATFSTKIELWTCILVYLLYPISLLLIY  565

Query  230  VLDYVFGWS  204
            VL  V GWS
Sbjct  566  VLTNVLGWS  574



>dbj|GAM24148.1| hypothetical protein SAMD00019534_073230, partial [Acytostelium 
subglobosum LB1]
Length=522

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            F    +I  FFISFI  P  +N+SE +S++IF+S+KK  + SLT+S LYG+ TMNN +CL
Sbjct  394  FGNKLNIKLFFISFIVTPFCSNASELISSLIFSSKKKKTNTSLTYSALYGSATMNNTMCL  453

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +F ALVY R LTW+FS+E + IL V +V+G  G++  T     + +  SLYPLSI LVY
Sbjct  454  GIFFALVYFRNLTWEFSAETVTILFVTMVVGTIGALNKTMRFMLAPLVLSLYPLSILLVY  513

Query  230  VLDYVFGWS  204
            +L+    W 
Sbjct  514  ILETFAHWQ  522



>ref|XP_010060649.1| PREDICTED: uncharacterized protein LOC104448505 [Eucalyptus grandis]
Length=727

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS +  IP FFISFI +PLATN+  A +AI  A  KK R+ SLT SE+YG V M+N+L  
Sbjct  599  FSKSAGIPPFFISFILVPLATNARGASAAIKAARHKKERTTSLTLSEIYGEVFMSNMLGF  658

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             V L+L+Y R LTW+FS+EVLV+LIVC ++G+  S RSTFP+WTS +A+ LYPLS+ LVY
Sbjct  659  CVLLSLIYVRDLTWEFSAEVLVVLIVCSLVGLIASFRSTFPVWTSILAYLLYPLSLLLVY  718

Query  230  VLDYVFGWS  204
            VLD V  +S
Sbjct  719  VLDDVLNYS  727



>gb|KCW67434.1| hypothetical protein EUGRSUZ_F01190 [Eucalyptus grandis]
Length=493

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS +  IP FFISFI +PLATN+  A  AI  A  KK R+ SLT SE+YG V M+N+L  
Sbjct  365  FSKSAGIPPFFISFILVPLATNARGASLAIKAARHKKERTTSLTLSEIYGEVFMSNMLGF  424

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             V L+L+YAR LTW+FS+E LV+LIVC ++G+  S RSTFP+WTS +A+ LYPLS+ LVY
Sbjct  425  CVLLSLIYARDLTWEFSAEFLVVLIVCGLVGLIASFRSTFPVWTSILAYLLYPLSLLLVY  484

Query  230  VLDYVFGWS  204
            V D V  +S
Sbjct  485  VPDDVLNYS  493



>gb|KDP36272.1| hypothetical protein JCGZ_09837 [Jatropha curcas]
Length=522

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS  TSIP FFISFIALPLATNS +AVSAI FA RKK+R+ASLTFSE+YG +T+  +LCL
Sbjct  416  FSKQTSIPPFFISFIALPLATNSGDAVSAINFARRKKMRAASLTFSEIYGKITVKILLCL  475

Query  410  SVFLALVYARGLTWDFSSEVL  348
            +VF ALVY RGL WDFS+EVL
Sbjct  476  TVFFALVYFRGLEWDFSAEVL  496



>ref|XP_007149414.1| hypothetical protein PHAVU_005G068300g [Phaseolus vulgaris]
 gb|ESW21408.1| hypothetical protein PHAVU_005G068300g [Phaseolus vulgaris]
Length=702

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 84/128 (66%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    I +FFISFI +PLATN  EA SAI  A  KK  + S T  E+YGAV MNN+L  
Sbjct  574  FSEEAGISSFFISFILVPLATNFREATSAIKEAGHKKRSNTSQTIYEIYGAVFMNNILGF  633

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             V   L+Y R ++W FS++VLV+ IVC VMG+    R TFPLWTSF A+ +Y +++ LV+
Sbjct  634  VVISILIYVREISWQFSADVLVVAIVCAVMGLTARFRPTFPLWTSFAAYFMYLIALLLVF  693

Query  230  VLDYVFGW  207
            VL  V  +
Sbjct  694  VLKDVLNY  701



>ref|XP_009352958.1| PREDICTED: uncharacterized protein LOC103944256 [Pyrus x bretschneideri]
Length=594

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA SIP+F  S++ +PLATN   A+ ++  A  K   + SLT SE+Y A  MNN++ L
Sbjct  466  FSTAASIPSFAASYVVIPLATNYRLALMSVTSAKEKTEDAISLTLSEIYTAAFMNNIVGL  525

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLALVY R L+WD ++EVLV+L++   +G   S    FP WTS +A+ LYP+S+ LVY
Sbjct  526  VIFLALVYIRNLSWDVAAEVLVVLLISTAVGFSASFSRKFPFWTSVLAYILYPISLLLVY  585

Query  230  VLDYVFGW  207
            VL  V GW
Sbjct  586  VLSTVIGW  593



>ref|XP_011096402.1| PREDICTED: uncharacterized protein LOC105175605 isoform X2 [Sesamum 
indicum]
Length=562

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A ++P+F +S++A+P A N   A+ +I  A +K  +S SLT S LYG V MNN++ L
Sbjct  434  FSQAANLPSFCVSYLAIPFALNYGAAIQSIASARQKTQKSISLTLSALYGGVYMNNIMGL  493

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLA VYAR L  D  +E+LV+LI+CI+M +  S R+TFP W  ++   LYP+S+AL++
Sbjct  494  IVFLAPVYARNLQADSFAEILVVLIICILMTLLTSFRTTFPRWLGYLVLLLYPISLALIF  553

Query  230  VLDYVFGWS  204
            ++  V  WS
Sbjct  554  LVTSVLNWS  562



>ref|XP_011096401.1| PREDICTED: uncharacterized protein LOC105175605 isoform X1 [Sesamum 
indicum]
Length=563

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A ++P+F +S++A+P A N   A+ +I  A +K  +S SLT S LYG V MNN++ L
Sbjct  435  FSQAANLPSFCVSYLAIPFALNYGAAIQSIASARQKTQKSISLTLSALYGGVYMNNIMGL  494

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLA VYAR L  D  +E+LV+LI+CI+M +  S R+TFP W  ++   LYP+S+AL++
Sbjct  495  IVFLAPVYARNLQADSFAEILVVLIICILMTLLTSFRTTFPRWLGYLVLLLYPISLALIF  554

Query  230  VLDYVFGWS  204
            ++  V  WS
Sbjct  555  LVTSVLNWS  563



>ref|XP_010101519.1| hypothetical protein L484_008850 [Morus notabilis]
 gb|EXB88531.1| hypothetical protein L484_008850 [Morus notabilis]
Length=536

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A ++P+F IS++ +PLA N  +AV AI  A  K  ++ SL  SE+Y  + MNN++ L
Sbjct  408  FSFAANVPSFLISYVVIPLALNFGQAVRAISSAREKTEKAISLMLSEIYNRIFMNNLMGL  467

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
              FLALVY R ++WD S+EVLV+LI+C +MG++ S  + FP+WTS +AF LYP+S+  +Y
Sbjct  468  VGFLALVYIRNVSWDVSAEVLVVLIICTLMGLYTSFSTKFPVWTSIVAFLLYPISLLSLY  527

Query  230  VLDYVFGWS  204
            +L  V GWS
Sbjct  528  LLTSVLGWS  536



>ref|XP_004489086.1| PREDICTED: uncharacterized protein LOC101490438 [Cicer arietinum]
Length=168

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    I +FF+SFI +PLATN  EA SAI  AS KK  + S T  E+YGAV MNN+L  
Sbjct  40   FSEYAGISSFFVSFILVPLATNFREATSAIKEASHKKSSNTSHTMYEIYGAVFMNNILGF  99

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIA  267
             V   L+Y R + W+FS++VLV+ IVCIVMG+  + R+TFPLWTSF A
Sbjct  100  VVISILIYMRDIAWEFSADVLVVAIVCIVMGLAATFRNTFPLWTSFPA  147



>ref|XP_008383883.1| PREDICTED: uncharacterized protein LOC103446524 [Malus domestica]
Length=594

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA SIP+F  S++ +PLATN   A+ ++  A  K   + SLT SE+Y A  MNN++ L
Sbjct  466  FSTAASIPSFAASYVVIPLATNYRLALMSVTSAKEKTEDAISLTLSEIYTAAFMNNIVGL  525

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             +FLALVY R L+WD ++EVLV+L++   +G   S    FP WT  +A+ LYP+S+ LV+
Sbjct  526  VIFLALVYIRNLSWDVAAEVLVVLLISTAVGFSASFSRKFPFWTCILAYILYPISLLLVH  585

Query  230  VLDYVFGWS  204
            VL  V GWS
Sbjct  586  VLTTVIGWS  594



>ref|XP_002275961.1| PREDICTED: uncharacterized protein LOC100260847 [Vitis vinifera]
Length=539

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            F +AT+IP FF+SFI LP A+ SSEAVSA+IFAS+KKLR A LT SE+YGAV MNN+LCL
Sbjct  446  FYSATNIPPFFVSFIVLPFAS-SSEAVSALIFASQKKLRIAPLTVSEIYGAVNMNNLLCL  504

Query  410  SVFLALVYARGLTWDFSSEVLVILIV  333
            SVFL L+Y R LTW+F+SEVL+ILI+
Sbjct  505  SVFLGLLYFRHLTWNFTSEVLIILII  530



>ref|XP_002500016.1| Ca2+:Cation antiporter family [Micromonas sp. RCC299]
 gb|ACO61274.1| Ca2+:Cation antiporter family [Micromonas sp. RCC299]
Length=554

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = -1

Query  590  FSTATSIPT-FFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  414
             S A  +P+ FF SF+  P A+N+SE VS++ FAS+K+ ++ SLT+S++YGAVTMNN +C
Sbjct  425  LSKALGLPSPFFASFVLTPFASNASELVSSLYFASKKRKKNISLTYSQVYGAVTMNNTMC  484

Query  413  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  234
            L +F+ ++ A+GL W FSSE L IL+V +++G  G+ R TF    +    +LYPLSIALV
Sbjct  485  LGLFMVVMRAQGLEWTFSSETLTILLVTLLVGYLGASRETFKSRLAVPVLALYPLSIALV  544

Query  233  YVLDYVFGWS  204
              LD+V GW+
Sbjct  545  CFLDFVVGWN  554



>ref|XP_003540477.1| PREDICTED: uncharacterized protein LOC100800452 [Glycine max]
Length=711

 Score =   120 bits (302),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 62/112 (55%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    I +FFISFI +PLATN  EA SAI  AS KK  + S T  E+YGAV MNN+L  
Sbjct  583  FSEEAGISSFFISFILVPLATNFREATSAIKEASHKKTSNTSQTMYEIYGAVFMNNILGF  642

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLY  255
             V   L+Y R +TW+FS++VLV+ IVC V G+  S R TFPLWTSF A+ +Y
Sbjct  643  VVISILIYMREITWEFSADVLVVAIVCAVTGLTASFRPTFPLWTSFPAYLMY  694



>gb|KHN28092.1| hypothetical protein glysoja_007824 [Glycine soja]
Length=640

 Score =   120 bits (300),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 62/112 (55%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    I +FFISFI +PLATN  EA SAI  AS KK  + S T  E+YGAV MNN+L  
Sbjct  512  FSEEAGISSFFISFILVPLATNFREATSAIKEASHKKTSNTSQTMYEIYGAVFMNNILGF  571

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLY  255
             V   L+Y R +TW+FS++VLV+ IVC V G+  S R TFPLWTSF A+ +Y
Sbjct  572  VVISILIYMREITWEFSADVLVVAIVCAVTGLTASFRPTFPLWTSFPAYLMY  623



>gb|KCW74041.1| hypothetical protein EUGRSUZ_E02665 [Eucalyptus grandis]
Length=472

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            F+TA  IP+FF+S++ +P A +  + + AI  A +K  +  S   +E+Y  V MNNV+ L
Sbjct  344  FATAADIPSFFVSYVLIPWAMSYRQILGAISSAKKKTKKDISGALTEVYNGVFMNNVMGL  403

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            + FLA+VY + +TWD S+EVLV+L++C  MGV  S  + F  W   +A++LYPLS+  +Y
Sbjct  404  ATFLAIVYIKDITWDVSAEVLVVLLICTFMGVITSSCTKFQFWMGILAYALYPLSLLFLY  463

Query  230  VLDYVFGWS  204
            +L  V GWS
Sbjct  464  ILTSVLGWS  472



>ref|XP_010058975.1| PREDICTED: uncharacterized protein LOC104446873 [Eucalyptus grandis]
Length=507

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            F+TA  IP+FF+S++ +P A +  + + AI  A +K  +  S   +E+Y  V MNNV+ L
Sbjct  379  FATAADIPSFFVSYVLIPWAMSYRQILGAISSAKKKTKKDISGALTEVYNGVFMNNVMGL  438

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            + FLA+VY + +TWD S+EVLV+L++C  MGV  S  + F  W   +A++LYPLS+  +Y
Sbjct  439  ATFLAIVYIKDITWDVSAEVLVVLLICTFMGVITSSCTKFQFWMGILAYALYPLSLLFLY  498

Query  230  VLDYVFGWS  204
            +L  V GWS
Sbjct  499  ILTSVLGWS  507



>emb|CBI21945.3| unnamed protein product [Vitis vinifera]
Length=892

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            F +AT+IP FF+SFI LP A+ SSEAVSA+IFAS+KKLR A LT SE+YGAV MNN+LCL
Sbjct  503  FYSATNIPPFFVSFIVLPFAS-SSEAVSALIFASQKKLRIAPLTVSEIYGAVNMNNLLCL  561

Query  410  SVFLALVYARGLTWDFSSEVLVILIV  333
            SVFL L+Y R LTW+F+SEVL+ILI+
Sbjct  562  SVFLGLLYFRHLTWNFTSEVLIILII  587



>ref|XP_010657148.1| PREDICTED: uncharacterized protein LOC100245468 [Vitis vinifera]
Length=289

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTAT+IP+F  SF  LP A+ SSEAVSA++FAS+KKLR  SLTFS++YGAV+MN +LCL
Sbjct  196  FSTATNIPSFLFSFAVLPFAS-SSEAVSALMFASQKKLRITSLTFSKIYGAVSMNKLLCL  254

Query  410  SVFLALVYARGLTWDFSSEVLVILIV  333
            SVFL L+Y R LTW+F+SEVL+ILI+
Sbjct  255  SVFLGLLYFRHLTWNFTSEVLIILII  280



>gb|KCW67430.1| hypothetical protein EUGRSUZ_F01186 [Eucalyptus grandis]
Length=649

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEA---VSAIIFASRKKLRSASLTFSELYGAVTMNNV  420
            FS A  +P+FFISFI +PLATN+  A   + AI  A  KK R+ SLTFS++YG V M+NV
Sbjct  518  FSKAAGVPSFFISFILVPLATNARGARGAIKAIKGARNKKARTTSLTFSKIYGEVFMSNV  577

Query  419  LCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIA  240
            L  SV L L+YAR LTW+FS+EVLV+LIVC V+G+  S RSTFP+WTS +A+ LYPLS+ 
Sbjct  578  LSFSVLLLLIYARNLTWEFSAEVLVVLIVCGVVGLTASFRSTFPVWTSILAYLLYPLSLL  637

Query  239  LVYVLDYVFGWS  204
            LVYVLD V  +S
Sbjct  638  LVYVLDDVLNYS  649



>gb|EYU43358.1| hypothetical protein MIMGU_mgv1a003865mg [Erythranthe guttata]
Length=559

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS A +  TF +S++A+P A N   A+ +I  A +K   S SLT S LY  V MNN++ L
Sbjct  431  FSIAANFSTFSVSYLAIPFAMNYGVAIQSIASARQKTQISISLTLSSLYAGVYMNNIIGL  490

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             VFLA VY R L+ +  +EVL++LI+C VM VF S+ +TFP W  +I  SLYP+S+A VY
Sbjct  491  IVFLAPVYVRNLSTNVCAEVLLVLIICTVMSVFTSIYTTFPRWIGYILVSLYPISLATVY  550

Query  230  VLDYVFGWS  204
            +L  V GWS
Sbjct  551  ILTTVLGWS  559



>ref|XP_004234097.2| PREDICTED: uncharacterized protein LOC101254062 isoform X1 [Solanum 
lycopersicum]
Length=694

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = -1

Query  587  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  408
            S A  +P+F I F+ +PLA N+   ++AI  AS+K  ++ASLTFSE+Y  V  NN++ ++
Sbjct  573  SEAIGMPSFLIPFVIVPLALNARMTIAAIYPASQKCSKTASLTFSEIYVGVIRNNIMGMT  632

Query  407  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYV  228
              LA+VYA+ LTWD+S++VL++L+ C ++GV     + +PLWTS +AFSLYP  +   Y+
Sbjct  633  TLLAIVYAKDLTWDYSAQVLIVLVACGIIGVLALFSTRYPLWTSLLAFSLYPSCVMFFYL  692

Query  227  L  225
            L
Sbjct  693  L  693



>ref|XP_004357876.1| hypothetical protein DFA_00160 [Dictyostelium fasciculatum]
 gb|EGG19582.1| hypothetical protein DFA_00160 [Dictyostelium fasciculatum]
Length=707

 Score =   118 bits (295),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    IP F+ISFI  P A NSSE V+A +   +KK ++ SL  S LYGAVTMNN++ L
Sbjct  563  FSQRVGIPPFYISFIIAPFALNSSELVAAYVLCQKKKRKNISLVHSSLYGAVTMNNLIAL  622

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             + L ++Y RGL W+FS+E LVI IV + +G  GS+++TF +  +    SL+P+SI ++ 
Sbjct  623  GILLFMIYYRGLIWNFSAETLVIFIVTLTVGAMGSLKTTFTMIHAVAIGSLFPVSIIIIA  682

Query  230  VLD  222
            VL+
Sbjct  683  VLE  685



>ref|XP_006340117.1| PREDICTED: uncharacterized protein LOC102587762 [Solanum tuberosum]
Length=703

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIF---ASRKKLRSASLTFSELYGAVTMNNV  420
             ++A  +P+FF+SF+ +PLA N+  A++AI     A+++   ++SLTFSE+Y  V MNN+
Sbjct  578  LASAIGVPSFFLSFVIVPLAINARTAITAITLLSSANQQSCTTSSLTFSEIYVGVIMNNI  637

Query  419  LCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIA  240
            + +S  L ++YA+ L W++S EVLV +++C V G F   R+T+PLWT  +AF  YP+++A
Sbjct  638  MGMSTVLTVLYAKDLRWEYSPEVLVSMVICAVNGSFAFTRTTYPLWTCIVAFLFYPIALA  697

Query  239  LVYVL  225
            L+Y+L
Sbjct  698  LLYIL  702



>ref|XP_010058973.1| PREDICTED: uncharacterized protein LOC104446871 [Eucalyptus grandis]
Length=542

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -1

Query  575  SIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLA  396
            ++P+F +S++ LPLA +  +A+ AI  A +K L+  S   SE+Y  V +NN++ L  FL 
Sbjct  419  NMPSFLVSYVMLPLAMSYKQALGAITSARKKTLKDISGPMSEVYRGVFLNNLMGLVTFLL  478

Query  395  LVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYV  216
            L+  + ++W+ S+EVLV+L++C  MGV  S+R+ FPLWT+ +A+SLYP SI L+YVL  V
Sbjct  479  LLLIKDISWNVSAEVLVVLLICSFMGVLTSLRTQFPLWTAVLAYSLYPFSILLLYVLTSV  538

Query  215  FGWS  204
             GWS
Sbjct  539  LGWS  542



>ref|XP_002275985.2| PREDICTED: uncharacterized protein LOC100255777 [Vitis vinifera]
Length=541

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTAT+IP+FF+SF+ LP A+  SEAVSA  FAS+KKLR ASLTFS++YGA++MNN LC+
Sbjct  448  FSTATNIPSFFVSFLVLPFAS-FSEAVSAQNFASQKKLRIASLTFSKIYGAMSMNNFLCM  506

Query  410  SVFLALVYARGLTWDFSSEVLVILIV  333
            SVFL LVY R LTW+F+SEVL++LI+
Sbjct  507  SVFLGLVYFRQLTWNFTSEVLIVLII  532



>emb|CAN78650.1| hypothetical protein VITISV_033126 [Vitis vinifera]
Length=541

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTAT+IP+FF+SF+ LP A+  SEAVSA  FAS+KKLR ASLTFS++YGA++MNN LC+
Sbjct  448  FSTATNIPSFFVSFLVLPFAS-FSEAVSAQNFASQKKLRIASLTFSKIYGAMSMNNFLCM  506

Query  410  SVFLALVYARGLTWDFSSEVLVILIV  333
            SVFL LVY R LTW+F+SEVL++LI+
Sbjct  507  SVFLGLVYFRQLTWNFTSEVLIVLII  532



>dbj|GAM24777.1| hypothetical protein SAMD00019534_079520, partial [Acytostelium 
subglobosum LB1]
Length=425

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 81/123 (66%), Gaps = 0/123 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS    IP F+ISFI  P A N+SE VS+ I +  KK +  SL  S LYGAV +NN++ L
Sbjct  298  FSARIGIPPFYISFIVAPFALNASELVSSWILSGHKKRKHISLVHSALYGAVAINNLVSL  357

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             + + ++Y RGL WDFS+E LVI IV + +G+ GS R TF +  + + F L+PLSI ++ 
Sbjct  358  GILMFMIYYRGLIWDFSAETLVIFIVTLTVGLLGSFRITFNMIHALVVFCLFPLSIGIIA  417

Query  230  VLD  222
            +L+
Sbjct  418  LLE  420



>gb|KCW74040.1| hypothetical protein EUGRSUZ_E02663 [Eucalyptus grandis]
Length=567

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -1

Query  575  SIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLA  396
            ++P+F +S++ LPLA +  +A+ AI  A +K L+  S   SE+Y  V +NN++ L  FL 
Sbjct  444  NMPSFLVSYVMLPLAMSYKQALGAITSARKKTLKDISGPMSEVYRGVFLNNLMGLVTFLL  503

Query  395  LVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYV  216
            L+  + ++W+ S+EVLV+L++C  MGV  S+R+ FPLWT+ +A+SLYP SI L+YVL  V
Sbjct  504  LLLIKDISWNVSAEVLVVLLICSFMGVLTSLRTQFPLWTAVLAYSLYPFSILLLYVLTSV  563

Query  215  FGWS  204
             GWS
Sbjct  564  LGWS  567



>ref|XP_006343216.1| PREDICTED: uncharacterized protein LOC102593213 [Solanum tuberosum]
Length=695

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = -1

Query  587  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  408
            S A  +P+F I F+ +PLA N+   ++AI  AS+K  ++ASLTFSE+Y  V  NN++ ++
Sbjct  574  SEAIGMPSFLIPFVIVPLALNARMTIAAIYPASQKCSKTASLTFSEIYVGVMRNNIMGMT  633

Query  407  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYV  228
              LA+VYA+ LTWD+S++VL++L+ C ++G+     + +PLWTS +AFSLYP  +   Y+
Sbjct  634  TLLAIVYAKDLTWDYSAQVLIVLVACSIIGLLALFSTRYPLWTSLLAFSLYPSCVVFFYL  693

Query  227  L  225
            L
Sbjct  694  L  694



>ref|XP_007149413.1| hypothetical protein PHAVU_005G068200g, partial [Phaseolus vulgaris]
 gb|ESW21407.1| hypothetical protein PHAVU_005G068200g, partial [Phaseolus vulgaris]
Length=578

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FS +  +  FF+SFI +PLATN+ EA SAI  AS KK R+ SL  SE+YG V MNN+L  
Sbjct  450  FSNSVGLHPFFMSFILVPLATNAREATSAIKEASHKKPRTTSLAISEIYGGVFMNNILGF  509

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
                 L+    +TW +S+E+LV+ IVC + G+  S  S FPL +SF A  LYPLS+ LV+
Sbjct  510  FAISVLISVGQVTWQYSAELLVVGIVCAIAGLTASFLSIFPLCSSFFAILLYPLSLVLVF  569

Query  230  VLDYVFGWS  204
            VLD V  ++
Sbjct  570  VLDQVLRYN  578



>ref|XP_005650712.1| hypothetical protein COCSUDRAFT_61158 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26168.1| hypothetical protein COCSUDRAFT_61158 [Coccomyxa subellipsoidea 
C-169]
Length=555

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 88/126 (70%), Gaps = 3/126 (2%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSE---LYGAVTMNNV  420
            FS A+ IP F+++F   P A+N+SE VS+IIFASRK+ ++ SLTFS+   +YGAVTMNN 
Sbjct  425  FSKASGIPAFYVAFCVTPFASNASELVSSIIFASRKQKKNISLTFSQARPVYGAVTMNNT  484

Query  419  LCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIA  240
            +CL +FL +++ + L W +SSEVLV +    ++G+ G   +TF  + +F   +LYPLSI 
Sbjct  485  MCLGLFLLVMHIQRLPWTYSSEVLVTVGATALVGLLGYTHTTFRTFWAFPVLALYPLSII  544

Query  239  LVYVLD  222
             V+ LD
Sbjct  545  AVWGLD  550



>emb|CBI21946.3| unnamed protein product [Vitis vinifera]
Length=806

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTAT+IP+F  SF  LP A+ SSEAVSA++FAS+KKLR  SLTFS++YGAV+MN +LCL
Sbjct  713  FSTATNIPSFLFSFAVLPFAS-SSEAVSALMFASQKKLRITSLTFSKIYGAVSMNKLLCL  771

Query  410  SVFLALVYARGLTWDFSSEVLVILIV  333
            SVFL L+Y R LTW+F+SEVL+ILI+
Sbjct  772  SVFLGLLYFRHLTWNFTSEVLIILII  797


 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTAT+IP+FF+SF+ LP A+  SEAVSA  FAS+KKLR ASLTFS++YGA++MNN LC+
Sbjct  23   FSTATNIPSFFVSFLVLPFAS-FSEAVSAQNFASQKKLRIASLTFSKIYGAMSMNNFLCM  81

Query  410  SVFLALVYARGLTWDFSSEVLV  345
            SVFL LVY R LTW+F+SEVL+
Sbjct  82   SVFLGLVYFRQLTWNFTSEVLI  103


 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FST T+IP+F +SF  LP A  SSEAV+A++FAS+ K+R  SLTFS++YGAV+MNN+LCL
Sbjct  239  FSTDTNIPSFLVSFTVLPFAI-SSEAVAALMFASQNKMR-ISLTFSKIYGAVSMNNLLCL  296

Query  410  SVFLALVYARGLTWDFSSEVLVILI  336
            SVFL L+Y R L+W+F+S+VL+ILI
Sbjct  297  SVFLGLLYFRHLSWNFTSDVLIILI  321



>ref|XP_001627159.1| predicted protein [Nematostella vectensis]
 gb|EDO35059.1| predicted protein [Nematostella vectensis]
Length=997

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = -1

Query  572  IPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLAL  393
            I +F++SF+  PL +N+SE +S++IFAS+KK  + S+TFS+LYGA TMNN LCL +F AL
Sbjct  638  ISSFYVSFVVTPLCSNASELLSSLIFASKKKKENVSMTFSQLYGAGTMNNTLCLGIFAAL  697

Query  392  VYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLD-YV  216
            VY R L W FS+EV VI+++   +G+ G +R T+ +W + +  +LY  SIAL+ +L+   
Sbjct  698  VYFRELRWYFSAEVTVIVLIQWAVGLVG-LRHTYKIWMAGLIGTLYIFSIALIALLESRA  756

Query  215  FGWS*VWSFFLQ  180
             GW  V S F +
Sbjct  757  IGWKHVPSAFPE  768



>ref|XP_011460767.1| PREDICTED: uncharacterized protein LOC105350439 [Fragaria vesca 
subsp. vesca]
Length=730

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA  IP+FF++F+ +PLATN+ +A SAI  ASR+  R+  LTFSE+YG V MNNVL  
Sbjct  602  FSTAAGIPSFFVAFVLVPLATNARQAASAISAASRQTPRTTDLTFSEIYGGVFMNNVLGF  661

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV LA++Y R +TW+FS+EVLV+LIVC+V+G+  S+RSTFPLWT+F+AF LYPLS+ LVY
Sbjct  662  SVLLAIIYVREMTWEFSAEVLVVLIVCLVVGLIASVRSTFPLWTAFVAFLLYPLSLLLVY  721

Query  230  VLDYVFGWS  204
            +L+ V G++
Sbjct  722  ILNDVIGYT  730



>ref|XP_010478257.1| PREDICTED: uncharacterized protein LOC104757229 [Camelina sativa]
Length=580

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = -1

Query  587  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  408
            S +  +P+F++ F  +PLA N   A+SA     + + R  S  FSE+Y  VT+NN+L ++
Sbjct  457  SVSAGVPSFYVVFAVIPLARNLKNALSAHFCRKKDQARITSDIFSEIYRDVTLNNLLGIT  516

Query  407  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYV  228
            + LA+VY RGLTWD+S+EVL+I+IV +++GV   +RST+P W   +AF+LY  S+ L+Y+
Sbjct  517  IILAIVYLRGLTWDYSTEVLIIVIVGLLIGVPAYVRSTYPFWICVLAFALYFFSLVLIYL  576



>emb|CAN78651.1| hypothetical protein VITISV_033127 [Vitis vinifera]
Length=533

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            F +AT+IP FF+SFI LP A+ SSEAVSA+IFAS+KKLR A LT SE+YGAV MNN+LCL
Sbjct  383  FYSATNIPPFFVSFIVLPFAS-SSEAVSALIFASQKKLRIAXLTVSEIYGAVNMNNLLCL  441

Query  410  SVFLALVYARGLTWDFSSEVLVILIV  333
            SVFL L+Y R LTW+F+SE + +  V
Sbjct  442  SVFLGLLYFRHLTWNFTSETVKLQQV  467



>ref|NP_174197.2| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
 gb|AEE31029.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
Length=564

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = -1

Query  587  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  408
            S +  +P+F++ F+ +PLA N    +SA     + K +  S TFSE+Y  VTMNN++ +S
Sbjct  430  SESAGVPSFYVVFVVIPLARNLKNTLSAHFCRKKDKAKITSDTFSEIYKDVTMNNLMGIS  489

Query  407  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            + LA+VYAR L WD+++EVL+I+IV +++G+   +R+T+P W   +AF+LY +S+ +VY
Sbjct  490  IILAIVYARELVWDYTTEVLIIVIVGLLIGLPAYVRTTYPFWICLLAFALYFISLVVVY  548



>gb|AAF24539.2|AC007508_2 F1K23.2 [Arabidopsis thaliana]
Length=1062

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = -1

Query  587   STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  408
             S +  +P+F++ F+ +PLA N    +SA     + K +  S TFSE+Y  VTMNN++ +S
Sbjct  928   SESAGVPSFYVVFVVIPLARNLKNTLSAHFCRKKDKAKITSDTFSEIYKDVTMNNLMGIS  987

Query  407   VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
             + LA+VYAR L WD+++EVL+I+IV +++G+   +R+T+P W   +AF+LY +S+ +VY
Sbjct  988   IILAIVYARELVWDYTTEVLIIVIVGLLIGLPAYVRTTYPFWICLLAFALYFISLVVVY  1046


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -1

Query  587  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  408
            S +  +P+F++ F  +PLA N   A+SA     ++K +  S TFSE+Y  VT+NN+L ++
Sbjct  451  SVSAGVPSFYVVFAVIPLARNLKNALSAHFCRKKEKAKITSDTFSEIYRDVTLNNLLGIT  510

Query  407  VFLALVYARGLTWDFSSE  354
            + LA+VY RGLTWD+S+E
Sbjct  511  IILAIVYIRGLTWDYSTE  528



>ref|XP_011027726.1| PREDICTED: uncharacterized protein LOC105127946 isoform X2 [Populus 
euphratica]
Length=507

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
             +TA  +P+F +S+  +P A N  +   +II  S KK +S SLT S++Y  V MNNVL L
Sbjct  379  LATAIKVPSFLVSYFLVPFALNFRQGYKSIISVSDKKEKSVSLTLSQIYCGVFMNNVLGL  438

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            + FL +VY R + WD ++E+LV+L++C  +G+  S  S FP WT  +A++LYP+S+  +Y
Sbjct  439  TSFLTIVYIREVEWDITAEILVVLVICSGIGLSSSFSSKFPFWTCLVAYALYPISLGFLY  498

Query  230  VLDYVFGWS  204
            VL    GW 
Sbjct  499  VLTISLGWG  507



>ref|XP_011027724.1| PREDICTED: uncharacterized protein LOC105127946 isoform X1 [Populus 
euphratica]
 ref|XP_011027725.1| PREDICTED: uncharacterized protein LOC105127946 isoform X1 [Populus 
euphratica]
Length=554

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 0/129 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
             +TA  +P+F +S+  +P A N  +   +II  S KK +S SLT S++Y  V MNNVL L
Sbjct  426  LATAIKVPSFLVSYFLVPFALNFRQGYKSIISVSDKKEKSVSLTLSQIYCGVFMNNVLGL  485

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            + FL +VY R + WD ++E+LV+L++C  +G+  S  S FP WT  +A++LYP+S+  +Y
Sbjct  486  TSFLTIVYIREVEWDITAEILVVLVICSGIGLSSSFSSKFPFWTCLVAYALYPISLGFLY  545

Query  230  VLDYVFGWS  204
            VL    GW 
Sbjct  546  VLTISLGWG  554



>emb|CBI20222.3| unnamed protein product [Vitis vinifera]
Length=661

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA +I +FFI+FI +PLATN+  A SAI  ASR+K R+ SLTFSE+YG V MNNVL +
Sbjct  533  FSTAANISSFFIAFILVPLATNARAATSAISAASRRKERTTSLTFSEIYGGVFMNNVLGI  592

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV L+++Y R LTWDFS+EVLV++IVC+VMG+F S+RSTFP+WTS +A+ LYPLS+ LVY
Sbjct  593  SVLLSIIYVRELTWDFSAEVLVVMIVCVVMGMFASLRSTFPVWTSIVAYLLYPLSLLLVY  652

Query  230  VLDYVFGW  207
             LD    W
Sbjct  653  ALDGFAKW  660



>ref|XP_002276006.2| PREDICTED: uncharacterized protein LOC100250594 [Vitis vinifera]
Length=516

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FST T+IP+F +SF  LP A  SSEAV+A++FAS+ K+R  SLTFS++YGAV+MNN+LCL
Sbjct  424  FSTDTNIPSFLVSFTVLPFAI-SSEAVAALMFASQNKMR-ISLTFSKIYGAVSMNNLLCL  481

Query  410  SVFLALVYARGLTWDFSSEVLVILIV  333
            SVFL L+Y R L+W+F+S+VL+ILIV
Sbjct  482  SVFLGLLYFRHLSWNFTSDVLIILIV  507



>ref|XP_010644148.1| PREDICTED: uncharacterized protein LOC100241883 [Vitis vinifera]
Length=718

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  590  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  411
            FSTA +I +FFI+FI +PLATN+  A SAI  ASR+K R+ SLTFSE+YG V MNNVL +
Sbjct  590  FSTAANISSFFIAFILVPLATNARAATSAISAASRRKERTTSLTFSEIYGGVFMNNVLGI  649

Query  410  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  231
            SV L+++Y R LTWDFS+EVLV++IVC+VMG+F S+RSTFP+WTS +A+ LYPLS+ LVY
Sbjct  650  SVLLSIIYVRELTWDFSAEVLVVMIVCVVMGMFASLRSTFPVWTSIVAYLLYPLSLLLVY  709

Query  230  VLDYVFGW  207
             LD    W
Sbjct  710  ALDGFAKW  717



>ref|XP_003386706.1| PREDICTED: uncharacterized protein LOC100632705 [Amphimedon queenslandica]
Length=559

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 86/128 (67%), Gaps = 5/128 (4%)
 Frame = -1

Query  572  IPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLAL  393
            IP F++SF+  PL +N+SE VS++IFAS+KK  + S+TFS+LYGA TMNN LCL +F AL
Sbjct  432  IPVFYLSFVITPLCSNASELVSSLIFASKKKKVNTSMTFSQLYGAATMNNTLCLGIFTAL  491

Query  392  VYARGLTWDFSSEVLVILIVCIVMGV----FGSM-RSTFPLWTSFIAFSLYPLSIALVYV  228
            V  RGLTW +S+EV VIL+V ++M      +G + + T+ L      F LY  SI + ++
Sbjct  492  VGIRGLTWQYSAEVTVILLVQLIMAAIALSYGFLYKHTYMLLLVIPVFLLYFGSILVTWM  551

Query  227  LDYVFGWS  204
            L+ +  W 
Sbjct  552  LETLAHWK  559



>ref|XP_002113975.1| hypothetical protein TRIADDRAFT_57950 [Trichoplax adhaerens]
 gb|EDV23065.1| hypothetical protein TRIADDRAFT_57950 [Trichoplax adhaerens]
Length=518

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 84/124 (68%), Gaps = 2/124 (2%)
 Frame = -1

Query  572  IPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLAL  393
            I  F+ISF+  P+ +N+SE +S++ FA+++K  + ++T+S+LYGA TMNN LCL+VF  L
Sbjct  396  ISAFYISFVVNPICSNASELISSLQFAAKRKRLNITVTYSQLYGAATMNNTLCLAVFTGL  455

Query  392  VYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDY-V  216
            V+ RGL W+ S+EVLVILIV   + +FG  R T+ +W  F    +Y  SI LV +L   +
Sbjct  456  VFFRGLQWESSAEVLVILIVVWFVAIFG-YRETYKVWMGFPIAVMYIFSIVLVAILQSPL  514

Query  215  FGWS  204
             GW 
Sbjct  515  VGWK  518



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370