BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF043O12

Length=589
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99712.1|  unnamed protein product                                248   9e-78   Coffea canephora [robusta coffee]
ref|XP_006449089.1|  hypothetical protein CICLE_v10015727mg             248   2e-77   Citrus clementina [clementine]
ref|XP_006467989.1|  PREDICTED: thiamine thiazole synthase 2, chl...    247   4e-77   Citrus sinensis [apfelsine]
gb|KJB57703.1|  hypothetical protein B456_009G176400                    242   5e-77   Gossypium raimondii
gb|KHG02821.1|  Thiamine thiazole synthase 2, chloroplastic             245   2e-76   Gossypium arboreum [tree cotton]
emb|CAN74175.1|  hypothetical protein VITISV_019223                     239   4e-76   Vitis vinifera
gb|KJB57700.1|  hypothetical protein B456_009G176400                    243   7e-76   Gossypium raimondii
emb|CAJ91138.1|  thiamin biosynthetic enzyme                            236   2e-75   Platanus x hispanica [London plane tree]
emb|CBI23176.3|  unnamed protein product                                241   3e-75   Vitis vinifera
gb|KJB67127.1|  hypothetical protein B456_010G176000                    241   4e-75   Gossypium raimondii
ref|XP_002267414.1|  PREDICTED: thiamine thiazole synthase 2, chl...    241   6e-75   Vitis vinifera
gb|AFM35683.1|  thiamin biosynthetic protein                            240   1e-74   Vitis pseudoreticulata
ref|XP_002305603.1|  hypothetical protein POPTR_0004s01990g             239   2e-74   Populus trichocarpa [western balsam poplar]
gb|KEH43920.1|  thiazole biosynthetic enzyme                            239   3e-74   Medicago truncatula
ref|XP_011096106.1|  PREDICTED: thiamine thiazole synthase 2, chl...    239   4e-74   Sesamum indicum [beniseed]
gb|EYU33910.1|  hypothetical protein MIMGU_mgv1a009148mg                238   6e-74   Erythranthe guttata [common monkey flower]
ref|XP_011037712.1|  PREDICTED: thiamine thiazole synthase 2, chl...    238   7e-74   Populus euphratica
ref|XP_010105570.1|  Thiamine thiazole synthase 2                       238   7e-74   
gb|KHG29710.1|  Thiamine thiazole synthase 2, chloroplastic             238   8e-74   Gossypium arboreum [tree cotton]
ref|XP_011086171.1|  PREDICTED: thiamine thiazole synthase 2, chl...    238   9e-74   Sesamum indicum [beniseed]
ref|XP_010062976.1|  PREDICTED: thiamine thiazole synthase 1, chl...    238   1e-73   
gb|ABK21260.1|  unknown                                                 232   1e-73   Picea sitchensis
ref|XP_006401539.1|  hypothetical protein EUTSA_v10013978mg             237   1e-73   Eutrema salsugineum [saltwater cress]
emb|CDY47441.1|  BnaC09g31160D                                          237   2e-73   Brassica napus [oilseed rape]
emb|CDY41008.1|  BnaA02g27980D                                          234   3e-73   Brassica napus [oilseed rape]
ref|XP_010267751.1|  PREDICTED: thiamine thiazole synthase 2, chl...    237   3e-73   Nelumbo nucifera [Indian lotus]
gb|ABK95834.1|  unknown                                                 234   3e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011000691.1|  PREDICTED: thiamine thiazole synthase 2, chl...    236   3e-73   Populus euphratica
gb|KDP39066.1|  hypothetical protein JCGZ_00823                         236   3e-73   Jatropha curcas
gb|KJB13600.1|  hypothetical protein B456_002G083700                    236   4e-73   Gossypium raimondii
gb|AFK44470.1|  unknown                                                 236   4e-73   Medicago truncatula
gb|ADG27845.1|  thiazole biosynthetic enzyme                            236   5e-73   Gossypium hirsutum [American cotton]
gb|KHG06769.1|  Thiamine thiazole synthase 1, chloroplastic             236   6e-73   Gossypium arboreum [tree cotton]
gb|KHN15802.1|  Thiamine thiazole synthase 2, chloroplastic             230   7e-73   Glycine soja [wild soybean]
ref|XP_007021022.1|  Thiazole biosynthetic enzyme, chloroplast (A...    236   7e-73   Theobroma cacao [chocolate]
ref|XP_009120006.1|  PREDICTED: thiamine thiazole synthase, chlor...    236   7e-73   Brassica rapa
ref|XP_002317206.1|  hypothetical protein POPTR_0011s00500g             235   9e-73   Populus trichocarpa [western balsam poplar]
ref|XP_007025992.1|  Thiazole biosynthetic enzyme                       236   1e-72   
gb|AFK49632.1|  unknown                                                 235   1e-72   Lotus japonicus
ref|XP_009127069.1|  PREDICTED: thiamine thiazole synthase, chlor...    235   1e-72   Brassica rapa
emb|CDY28754.1|  BnaA02g09460D                                          235   1e-72   Brassica napus [oilseed rape]
ref|XP_008803216.1|  PREDICTED: thiamine thiazole synthase 2, chl...    235   1e-72   Phoenix dactylifera
gb|AAV92535.1|  thiazole biosynthetic enzyme                            234   2e-72   Pseudotsuga menziesii var. menziesii
gb|AAV92539.1|  thiazole biosynthetic enzyme                            234   2e-72   Pseudotsuga menziesii var. menziesii
gb|AAV92531.1|  thiazole biosynthetic enzyme                            234   2e-72   Pseudotsuga menziesii var. menziesii
sp|Q38709.1|THI4_ALNGL  RecName: Full=Thiamine thiazole synthase,...    234   3e-72   Alnus glutinosa
ref|NP_001275783.1|  thiamine thiazole synthase, chloroplastic          234   3e-72   Citrus sinensis [apfelsine]
gb|AAV92529.1|  thiazole biosynthetic enzyme                            234   3e-72   Pseudotsuga menziesii var. menziesii
gb|AAV92552.1|  thiazole biosynthetic enzyme                            234   3e-72   Pseudotsuga menziesii var. menziesii
gb|AAV92537.1|  thiazole biosynthetic enzyme                            234   3e-72   Pseudotsuga menziesii var. menziesii
gb|AAV92554.1|  thiazole biosynthetic enzyme                            234   3e-72   Pseudotsuga menziesii var. menziesii
gb|KCW70139.1|  hypothetical protein EUGRSUZ_F03433                     238   3e-72   Eucalyptus grandis [rose gum]
emb|CDY43024.1|  BnaA03g11710D                                          234   4e-72   Brassica napus [oilseed rape]
gb|AAV92538.1|  thiazole biosynthetic enzyme                            233   4e-72   Pseudotsuga menziesii var. menziesii
gb|KHN47860.1|  Thiamine thiazole synthase 2, chloroplastic             228   5e-72   Glycine soja [wild soybean]
ref|XP_007143207.1|  hypothetical protein PHAVU_007G052900g             233   6e-72   Phaseolus vulgaris [French bean]
ref|XP_002973063.1|  hypothetical protein SELMODRAFT_271002             233   7e-72   Selaginella moellendorffii
ref|XP_002522858.1|  electron transfer flavoprotein-ubiquinone ox...    233   7e-72   Ricinus communis
gb|ACN66755.1|  thiazole biosynthetic enzyme                            228   8e-72   Carica papaya [mamon]
ref|XP_002994429.1|  hypothetical protein SELMODRAFT_163429             233   8e-72   
ref|XP_009408664.1|  PREDICTED: thiamine thiazole synthase 2, chl...    233   1e-71   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO52968.1|  hypothetical protein CISIN_1g018414mg                   233   1e-71   Citrus sinensis [apfelsine]
gb|AAW66657.1|  thiamine biosynthetic enzyme                            232   1e-71   Picrorhiza kurrooa
ref|XP_007213805.1|  hypothetical protein PRUPE_ppa007657mg             233   1e-71   Prunus persica
ref|XP_006452193.1|  hypothetical protein CICLE_v10008765mg             232   1e-71   Citrus clementina [clementine]
ref|XP_003556028.1|  PREDICTED: thiamine thiazole synthase 2, chl...    232   2e-71   Glycine max [soybeans]
gb|ABK23376.1|  unknown                                                 233   2e-71   Picea sitchensis
ref|XP_010923945.1|  PREDICTED: thiamine thiazole synthase, chlor...    232   2e-71   Elaeis guineensis
gb|EYU27823.1|  hypothetical protein MIMGU_mgv1a009995mg                231   2e-71   Erythranthe guttata [common monkey flower]
ref|XP_009132425.1|  PREDICTED: thiamine thiazole synthase, chlor...    231   2e-71   Brassica rapa
ref|XP_003536550.1|  PREDICTED: thiamine thiazole synthase 2, chl...    231   3e-71   Glycine max [soybeans]
gb|KFK27084.1|  hypothetical protein AALP_AA8G331900                    231   3e-71   Arabis alpina [alpine rockcress]
emb|CDP05793.1|  unnamed protein product                                229   4e-71   Coffea canephora [robusta coffee]
emb|CDY52570.1|  BnaC03g71780D                                          231   4e-71   Brassica napus [oilseed rape]
ref|XP_004504342.1|  PREDICTED: thiamine thiazole synthase, chlor...    231   4e-71   Cicer arietinum [garbanzo]
ref|XP_004505443.1|  PREDICTED: thiamine thiazole synthase, chlor...    231   4e-71   Cicer arietinum [garbanzo]
ref|NP_200288.1|  thiazole biosynthetic enzyme                          231   5e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280726.1|  hypothetical protein CARUB_v10026695mg             231   6e-71   Capsella rubella
ref|XP_002864354.1|  hypothetical protein ARALYDRAFT_918614             230   7e-71   Arabidopsis lyrata subsp. lyrata
gb|EPS63253.1|  hypothetical protein M569_11533                         230   8e-71   Genlisea aurea
ref|XP_004496776.1|  PREDICTED: thiamine thiazole synthase 2, chl...    230   8e-71   Cicer arietinum [garbanzo]
ref|XP_002316981.2|  hypothetical protein POPTR_0011s13820g             230   9e-71   Populus trichocarpa [western balsam poplar]
ref|XP_010443053.1|  PREDICTED: thiamine thiazole synthase, chlor...    230   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010545204.1|  PREDICTED: thiamine thiazole synthase, chlor...    229   2e-70   Tarenaya hassleriana [spider flower]
ref|XP_011030844.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    229   3e-70   Populus euphratica
dbj|BAA88226.1|  thiamin biosynthetic enzyme                            228   4e-70   Glycine max [soybeans]
ref|XP_010448624.1|  PREDICTED: thiamine thiazole synthase, chlor...    228   4e-70   Camelina sativa [gold-of-pleasure]
ref|XP_003563001.1|  PREDICTED: thiamine thiazole synthase 2, chl...    228   5e-70   Brachypodium distachyon [annual false brome]
ref|XP_008244366.1|  PREDICTED: thiamine thiazole synthase, chlor...    228   5e-70   Prunus mume [ume]
ref|XP_008809851.1|  PREDICTED: thiamine thiazole synthase 1, chl...    228   7e-70   Phoenix dactylifera
gb|EMT30436.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         227   1e-69   
ref|NP_001236824.1|  thiamin biosynthetic enzyme                        227   1e-69   
emb|CCJ09780.1|  putative thiazole biosynthetic enzyme                  223   2e-69   Hirudo medicinalis
gb|EMS66450.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         227   2e-69   Triticum urartu
ref|XP_003607681.1|  Thiazole biosynthetic enzyme                       227   2e-69   Medicago truncatula
gb|AFK46185.1|  unknown                                                 226   2e-69   Medicago truncatula
ref|XP_006657781.1|  PREDICTED: thiamine thiazole synthase 2, chl...    226   2e-69   Oryza brachyantha
ref|XP_009388868.1|  PREDICTED: thiamine thiazole synthase 2, chl...    226   3e-69   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC45141.1|  putative thiamine biosynthesis protein                 226   5e-69   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059841.1|  Os07g0529600                                       226   6e-69   
gb|EAZ04139.1|  hypothetical protein OsI_26282                          225   6e-69   Oryza sativa Indica Group [Indian rice]
gb|AAZ93636.1|  pathogen-induced defense-responsive protein 8           225   7e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_004957903.1|  PREDICTED: thiamine thiazole synthase 2, chl...    225   9e-69   Setaria italica
ref|XP_010485129.1|  PREDICTED: thiamine thiazole synthase, chlor...    229   2e-68   
gb|AFK48432.1|  unknown                                                 224   4e-68   Lotus japonicus
ref|XP_004244150.1|  PREDICTED: thiamine thiazole synthase, chlor...    223   5e-68   Solanum lycopersicum
ref|XP_009774029.1|  PREDICTED: thiamine thiazole synthase, chlor...    223   5e-68   Nicotiana sylvestris
ref|XP_006845176.1|  hypothetical protein AMTR_s00005p00239290          223   5e-68   Amborella trichopoda
ref|XP_009590342.1|  PREDICTED: thiamine thiazole synthase, chlor...    223   5e-68   Nicotiana tomentosiformis
ref|XP_006360084.1|  PREDICTED: thiamine thiazole synthase 1, chl...    222   1e-67   Solanum tuberosum [potatoes]
ref|XP_004965741.1|  PREDICTED: thiamine thiazole synthase 2, chl...    222   1e-67   Setaria italica
ref|XP_010670817.1|  PREDICTED: thiamine thiazole synthase, chlor...    222   1e-67   Beta vulgaris subsp. vulgaris [field beet]
gb|ACF85447.1|  unknown                                                 215   2e-67   Zea mays [maize]
gb|AAP03875.1|  putative chloroplast thiazole biosynthetic protein      222   2e-67   Nicotiana tabacum [American tobacco]
ref|XP_002281769.1|  PREDICTED: thiamine thiazole synthase 1, chl...    222   2e-67   Vitis vinifera
ref|XP_001767495.1|  predicted protein                                  221   2e-67   
ref|XP_010670818.1|  PREDICTED: thiamine thiazole synthase 2, chl...    221   2e-67   Beta vulgaris subsp. vulgaris [field beet]
gb|ACF85034.1|  unknown                                                 219   3e-67   Zea mays [maize]
ref|XP_001753819.1|  predicted protein                                  221   3e-67   
gb|KHN46540.1|  Thiamine thiazole synthase 2, chloroplastic             215   4e-67   Glycine soja [wild soybean]
ref|XP_001767548.1|  predicted protein                                  221   5e-67   
ref|XP_004294348.1|  PREDICTED: thiamine thiazole synthase, chlor...    221   6e-67   Fragaria vesca subsp. vesca
ref|XP_009378870.1|  PREDICTED: thiamine thiazole synthase, chlor...    220   1e-66   Pyrus x bretschneideri [bai li]
ref|NP_001105696.1|  thiamine thiazole synthase 1, chloroplastic ...    219   1e-66   Zea mays [maize]
gb|AGT17015.1|  thiazole biosynthetic enzyme                            219   2e-66   Saccharum hybrid cultivar R570
gb|AGT16062.1|  Thiazole biosynthetic enzyme Thi4 family                219   2e-66   Saccharum hybrid cultivar R570
gb|AGT16507.1|  Thiazole biosynthetic enzyme Thi4 family                219   3e-66   Saccharum hybrid cultivar R570
ref|XP_004294669.1|  PREDICTED: thiamine thiazole synthase, chlor...    219   3e-66   Fragaria vesca subsp. vesca
ref|XP_009358110.1|  PREDICTED: thiamine thiazole synthase, chlor...    218   4e-66   
ref|XP_001755171.1|  predicted protein                                  218   4e-66   
gb|AGT15954.1|  Thiazole biosynthetic enzyme Thi4 family                218   4e-66   Saccharum hybrid cultivar R570
gb|AGT16846.1|  Thiazole biosynthetic enzyme Thi4 family                218   4e-66   Saccharum hybrid cultivar R570
ref|XP_002463222.1|  hypothetical protein SORBIDRAFT_02g040060          218   4e-66   Sorghum bicolor [broomcorn]
gb|ACF87708.1|  unknown                                                 218   5e-66   Zea mays [maize]
ref|XP_002458014.1|  hypothetical protein SORBIDRAFT_03g025520          218   6e-66   Sorghum bicolor [broomcorn]
ref|NP_001105697.1|  thiamine thiazole synthase 2, chloroplastic ...    218   6e-66   
gb|EYU19221.1|  hypothetical protein MIMGU_mgv1a009132mg                218   8e-66   Erythranthe guttata [common monkey flower]
ref|NP_001236812.1|  thiamin biosynthetic enzyme                        217   1e-65   Glycine max [soybeans]
dbj|BAA88225.1|  thiamin biosynthetic enzyme                            217   1e-65   Glycine max [soybeans]
ref|XP_001753698.1|  predicted protein                                  217   2e-65   
ref|XP_010930933.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    216   2e-65   
ref|XP_010670808.1|  PREDICTED: thiamine thiazole synthase 2, chl...    216   3e-65   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS63028.1|  thiazole biosynthetic enzyme, chloroplastic             214   3e-65   Genlisea aurea
pdb|1RP0|A  Chain A, Crystal Structure Of Thi1 Protein From Arabi...    214   3e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AFO59577.1|  thiamine biosynthetic enzyme                            215   6e-65   Saccharum hybrid cultivar GT28
gb|AHA84206.1|  thiamin biosynthetic enzyme                             215   8e-65   Phaseolus vulgaris [French bean]
ref|XP_007132954.1|  hypothetical protein PHAVU_011G139100g             214   2e-64   Phaseolus vulgaris [French bean]
ref|XP_004152916.1|  PREDICTED: thiamine thiazole synthase, chlor...    214   2e-64   Cucumis sativus [cucumbers]
ref|XP_008463440.1|  PREDICTED: thiamine thiazole synthase, chlor...    213   4e-64   Cucumis melo [Oriental melon]
ref|XP_008366026.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    213   8e-64   
emb|CBI23938.3|  unnamed protein product                                201   2e-61   Vitis vinifera
gb|AFW83047.1|  hypothetical protein ZEAMMB73_797739                    202   9e-60   
gb|KDO47270.1|  hypothetical protein CISIN_1g039605mg                   201   3e-59   Citrus sinensis [apfelsine]
ref|XP_006441062.1|  hypothetical protein CICLE_v10024231mg             200   3e-59   
gb|AHN11672.1|  thiamin biosynthetic enzyme                             191   3e-58   Phaseolus vulgaris [French bean]
gb|AHN11665.1|  thiamin biosynthetic enzyme                             190   6e-58   Phaseolus vulgaris [French bean]
emb|CAB64776.1|  thiazole biosynthetic enzyme                           190   8e-58   Brassica juncea [brown mustard]
gb|AHN11691.1|  thiamin biosynthetic enzyme                             188   3e-57   Phaseolus vulgaris [French bean]
gb|AGZ80417.1|  thiamin biosynthetic enzyme                             188   5e-57   Phaseolus vulgaris [French bean]
gb|AGZ80414.1|  thiamin biosynthetic enzyme                             187   1e-56   Phaseolus vulgaris [French bean]
gb|AHN11708.1|  thiamin biosynthetic enzyme                             186   2e-56   Phaseolus vulgaris [French bean]
gb|AGZ80422.1|  thiamin biosynthetic enzyme                             185   7e-56   Phaseolus vulgaris [French bean]
gb|KDO52969.1|  hypothetical protein CISIN_1g018414mg                   189   3e-55   Citrus sinensis [apfelsine]
gb|KFH67165.1|  thiazole biosynthetic enzyme, chloroplastic             178   4e-51   Mortierella verticillata NRRL 6337
ref|XP_005648929.1|  thiazole biosynthetic enzyme                       175   1e-49   Coccomyxa subellipsoidea C-169
ref|XP_009844134.1|  thiazole biosynthesis enzyme, variant 2            170   2e-48   Aphanomyces astaci
gb|ABR01228.1|  thiazole biosynthetic enzyme                            171   4e-48   Chlorella vulgaris
ref|XP_008877253.1|  thiazole biosynthetic enzyme, chloroplastic,...    171   6e-48   Aphanomyces invadans
ref|XP_009844132.1|  thiazole biosynthesis enzyme                       170   9e-48   Aphanomyces astaci
ref|XP_008616182.1|  thiamine biosynthetic enzyme                       168   4e-47   Saprolegnia diclina VS20
gb|KDO30626.1|  hypothetical protein SPRG_04526                         168   4e-47   Saprolegnia parasitica CBS 223.65
ref|XP_006388786.1|  hypothetical protein POPTR_0101s00250g             159   3e-46   
ref|XP_005847930.1|  hypothetical protein CHLNCDRAFT_22703              164   9e-46   Chlorella variabilis
gb|ABW74129.1|  thiamin biosynthetic enzyme                             158   3e-45   Mucor racemosus
emb|CDM85402.1|  unnamed protein product                                162   1e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004496859.1|  PREDICTED: thiamine thiazole synthase, chlor...    161   3e-44   Cicer arietinum [garbanzo]
gb|KIY99977.1|  thiamine biosynthetic enzyme                            161   4e-44   Monoraphidium neglectum
gb|KIY92671.1|  thiamine biosynthetic enzyme                            161   5e-44   Monoraphidium neglectum
emb|CEP18429.1|  hypothetical protein                                   158   2e-43   Parasitella parasitica
gb|EPB86412.1|  thiazole biosynthetic enzyme, chloroplastic             158   3e-43   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN03507.1|  thiamin biosynthetic enzyme                            158   3e-43   Mucor ambiguus
gb|EIE83081.1|  thiazole biosynthetic enzyme, chloroplastic             157   5e-43   Rhizopus delemar RA 99-880
gb|EPB91714.1|  thiazole biosynthetic enzyme, chloroplastic             156   1e-42   Mucor circinelloides f. circinelloides 1006PhL
emb|CEG62855.1|  Putative Thiamine thiazole synthase                    155   2e-42   Rhizopus microsporus
ref|XP_003522069.1|  PREDICTED: thiamine thiazole synthase, chlor...    155   2e-42   Glycine max [soybeans]
dbj|BAC79982.1|  putative thiamine biosynthesis protein                 154   5e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002784437.1|  conserved hypothetical protein                     154   2e-41   Perkinsus marinus ATCC 50983
gb|ACN36998.1|  unknown                                                 150   2e-41   Zea mays [maize]
gb|AGB85035.1|  thiamine biosynthesis thi4 protein                      152   4e-41   Auxenochlorella protothecoides
ref|XP_011397717.1|  Thiamine thiazole synthase, chloroplastic          154   7e-41   Auxenochlorella protothecoides
ref|XP_001698672.1|  full-length thiazole biosynthetic enzyme           151   2e-40   Chlamydomonas reinhardtii
gb|ABK22862.1|  unknown                                                 150   2e-40   Picea sitchensis
ref|XP_002951140.1|  hypothetical protein VOLCADRAFT_74900              149   2e-39   Volvox carteri f. nagariensis
ref|XP_002951138.1|  hypothetical protein VOLCADRAFT_74899              148   3e-39   Volvox carteri f. nagariensis
emb|CAH25337.1|  thiazole biosynthetic enzyme                           144   6e-38   Guillardia theta
ref|XP_005834399.1|  putative THI4, thiamine                            144   6e-38   Guillardia theta CCMP2712
ref|XP_008386070.1|  PREDICTED: thiamine thiazole synthase, chlor...    142   2e-37   
gb|KFZ11494.1|  hypothetical protein V502_07520                         141   1e-36   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFY94986.1|  hypothetical protein V498_03597                         140   1e-36   Pseudogymnoascus sp. VKM F-4517 (FW-2822)
gb|KFY84898.1|  hypothetical protein V500_08902                         140   2e-36   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFY70117.1|  hypothetical protein V499_09439                         140   2e-36   Pseudogymnoascus sp. VKM F-103
gb|KFZ09843.1|  hypothetical protein V501_05470                         140   2e-36   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|ACU23028.1|  unknown                                                 134   2e-36   Glycine max [soybeans]
ref|XP_007586590.1|  putative thiazole biosynthetic enzyme protein      139   3e-36   
gb|EKG16915.1|  Thiamine biosynthesis Thi4 protein                      137   3e-36   Macrophomina phaseolina MS6
gb|KFX98431.1|  hypothetical protein O988_04337                         139   5e-36   Pseudogymnoascus sp. VKM F-3808
ref|XP_007289177.1|  thiazole biosynthetic enzyme                       138   9e-36   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|ADI88268.1|  HCF106 protein                                          133   1e-35   Silene latifolia
gb|KFY20175.1|  hypothetical protein V491_03934                         138   1e-35   Pseudogymnoascus sp. VKM F-3775
gb|EHL02685.1|  putative Thiazole biosynthetic enzyme, mitochondrial    138   1e-35   Glarea lozoyensis 74030
ref|XP_001549602.1|  thiazole biosynthetic enzyme                       138   1e-35   
ref|XP_001589094.1|  thiazole biosynthetic enzyme                       138   1e-35   Sclerotinia sclerotiorum 1980 UF-70
gb|ESZ95478.1|  thiazole biosynthetic enzyme                            138   1e-35   Sclerotinia borealis F-4128
ref|XP_008087498.1|  FAD/NAD(P)-binding protein                         138   1e-35   Glarea lozoyensis ATCC 20868
ref|XP_003842741.1|  similar to thiazole biosynthetic enzyme            138   1e-35   Leptosphaeria maculans JN3
gb|KFY43107.1|  hypothetical protein V494_02101                         137   2e-35   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KFY08103.1|  hypothetical protein V492_06538                         137   2e-35   Pseudogymnoascus sp. VKM F-4246
gb|ELR08851.1|  thiazole biosynthetic enzyme, mitochondrial             137   2e-35   Pseudogymnoascus destructans 20631-21
gb|KFY24905.1|  hypothetical protein V493_04960                         137   3e-35   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|ADI88272.1|  HCF106 protein                                          132   3e-35   Silene latifolia
gb|KIN04678.1|  hypothetical protein OIDMADRAFT_17638                   136   7e-35   Oidiodendron maius Zn
ref|XP_006370641.1|  hypothetical protein POPTR_0001s44460g             133   8e-35   
gb|ADI88468.1|  HCF106 protein                                          130   8e-35   Silene vulgaris [maiden's-tears]
gb|KFY50717.1|  hypothetical protein V496_09214                         141   1e-34   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|ADI88284.1|  HCF106 protein                                          130   1e-34   Silene latifolia
ref|XP_007928692.1|  hypothetical protein MYCFIDRAFT_211863             135   2e-34   Pseudocercospora fijiensis CIRAD86
gb|ACN39013.1|  thiazole synthase                                       134   2e-34   Epichloe festucae
ref|XP_007672530.1|  hypothetical protein BAUCODRAFT_62660              134   2e-34   Baudoinia panamericana UAMH 10762
gb|EME42084.1|  hypothetical protein DOTSEDRAFT_73000                   135   2e-34   Dothistroma septosporum NZE10
gb|ABN45968.1|  thiazole biosynthetic enzyme variant 1                  134   4e-34   Epichloe typhina
gb|EAQ71495.1|  hypothetical protein MGCH7_ch7g902                      130   5e-34   Magnaporthe oryzae 70-15
gb|KFX95262.1|  hypothetical protein V490_03958                         139   6e-34   Pseudogymnoascus sp. VKM F-3557
ref|XP_008026201.1|  hypothetical protein SETTUDRAFT_177413             134   6e-34   Exserohilum turcica Et28A
gb|ABG46357.1|  mitochondrial thiazole biosynthetic enzyme              133   6e-34   Trichoderma harzianum
gb|AGT99181.1|  thiazole biosynthetic enzyme                            134   6e-34   Acremonium chrysogenum
ref|XP_003851349.1|  hypothetical protein MYCGRDRAFT_44262              133   7e-34   Zymoseptoria tritici IPO323
gb|KFY37341.1|  hypothetical protein V495_07232                         139   7e-34   Pseudogymnoascus sp. VKM F-4514 (FW-929)
ref|XP_003344754.1|  hypothetical protein SMAC_06409                    133   7e-34   Sordaria macrospora k-hell
ref|XP_006692218.1|  hypothetical protein CTHT_0017160                  133   8e-34   Chaetomium thermophilum var. thermophilum DSM 1495
gb|EHK27008.1|  hypothetical protein TRIVIDRAFT_215037                  133   9e-34   Trichoderma virens Gv29-8
gb|EMD85953.1|  hypothetical protein COCHEDRAFT_1160889                 133   1e-33   Bipolaris maydis C5
pdb|3JSK|A  Chain A, Thiazole Synthase From Neurospora Crassa           133   1e-33   Neurospora crassa
gb|KHE80990.1|  hypothetical protein GE21DRAFT_10110                    133   1e-33   Neurospora crassa
ref|XP_009853231.1|  hypothetical protein NEUTE1DRAFT_95662             133   1e-33   Neurospora tetrasperma FGSC 2508
ref|XP_001935439.1|  thiazole biosynthesis enzyme                       133   1e-33   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_011395239.1|  thiazole biosynthetic enzyme, variant 2            133   1e-33   Neurospora crassa OR74A
ref|XP_003297921.1|  hypothetical protein PTT_08482                     133   1e-33   
gb|KDB14289.1|  thiazole biosynthetic enzyme variant 1                  132   2e-33   Ustilaginoidea virens
gb|KIW54196.1|  thiamine thiazole synthase                              132   2e-33   Exophiala xenobiotica
ref|XP_007913237.1|  putative thiazole biosynthetic enzyme protein      132   2e-33   Phaeoacremonium minimum UCRPA7
sp|P23617.1|THI4_FUSSH  RecName: Full=Thiamine thiazole synthase;...    132   2e-33   Fusarium phaseoli
gb|KEQ70131.1|  putative thiazole synthase THI4_ASPOR thiazole bi...    132   2e-33   Aureobasidium namibiae CBS 147.97
emb|CEJ80029.1|  Putative Thiamine thiazole synthase                    132   3e-33   Torrubiella hemipterigena
gb|EUN24789.1|  hypothetical protein COCVIDRAFT_17857                   132   3e-33   Bipolaris victoriae FI3
gb|KIX99472.1|  thiamine thiazole synthase                              132   3e-33   Fonsecaea multimorphosa CBS 102226
ref|XP_007713209.1|  hypothetical protein COCCADRAFT_27023              132   3e-33   Bipolaris zeicola 26-R-13
ref|XP_007701574.1|  hypothetical protein COCSADRAFT_38262              132   3e-33   Bipolaris sorokiniana ND90Pr
gb|KIX08964.1|  thiamine thiazole synthase                              132   3e-33   Rhinocladiella mackenziei CBS 650.93
gb|ELQ36693.1|  hypothetical protein OOU_Y34scaffold00646g4             131   3e-33   Magnaporthe oryzae Y34
gb|KEQ99790.1|  hypothetical protein AUEXF2481DRAFT_35726               132   3e-33   Aureobasidium subglaciale EXF-2481
emb|CCF45087.1|  thiazole biosynthetic enzyme                           131   3e-33   Colletotrichum higginsianum
ref|XP_007821738.1|  thiazole biosynthetic enzyme variant 1             131   3e-33   Metarhizium robertsii ARSEF 23
ref|XP_001819323.1|  thiazole biosynthetic enzyme                       131   4e-33   Aspergillus oryzae RIB40
ref|XP_006666857.1|  thiazole biosynthetic enzyme                       131   4e-33   Cordyceps militaris CM01
gb|AAF25444.1|AF217503_1  putative thiazole synthase                    131   4e-33   Aspergillus oryzae
ref|XP_003654402.1|  hypothetical protein THITE_2117402                 132   4e-33   Thielavia terrestris NRRL 8126
gb|KGQ06713.1|  Thiamine thiazole synthase                              131   4e-33   Beauveria bassiana D1-5
ref|XP_008598283.1|  mitochondrial thiazole biosynthetic enzyme         131   4e-33   Beauveria bassiana ARSEF 2860
ref|XP_007692325.1|  hypothetical protein COCMIDRAFT_30031              132   4e-33   Bipolaris oryzae ATCC 44560
gb|KHN95056.1|  thiazole biosynthetic enzyme variant 1                  131   4e-33   Metarhizium album ARSEF 1941
ref|XP_003665159.1|  hypothetical protein MYCTH_2315910                 131   4e-33   Thermothelomyces thermophila ATCC 42464
ref|XP_002375225.1|  thiazole biosynthesis enzyme Sti35                 131   4e-33   Aspergillus flavus NRRL3357
gb|KID90425.1|  thiazole biosynthetic enzyme variant 1                  131   4e-33   Metarhizium guizhouense ARSEF 977
ref|XP_001227644.1|  thiazole biosynthetic enzyme, mitochondrial ...    131   4e-33   Chaetomium globosum CBS 148.51
ref|XP_009228164.1|  thiazole biosynthetic enzyme                       131   4e-33   Gaeumannomyces tritici R3-111a-1
ref|XP_007807526.1|  thiazole biosynthetic enzyme variant 1             132   5e-33   Metarhizium acridum CQMa 102
gb|KID99833.1|  thiazole biosynthetic enzyme variant 1                  131   5e-33   Metarhizium majus ARSEF 297
ref|XP_006968797.1|  thiazole biosynthetic enzyme                       131   5e-33   Trichoderma reesei QM6a
gb|ABQ23424.1|  thiazole biosynthetic enzyme                            131   5e-33   Chaetomium globosum
gb|KEQ59396.1|  Thi4-domain-containing protein                          131   5e-33   
ref|XP_003044703.1|  predicted protein                                  131   5e-33   
emb|CEJ80028.1|  Putative Thiamine thiazole synthase                    132   6e-33   
gb|ENH83973.1|  thiazole biosynthetic enzyme                            131   6e-33   
ref|XP_007794010.1|  putative thiazole biosynthetic enzyme protein      131   6e-33   
ref|XP_003720575.1|  thiazole biosynthetic enzyme                       131   6e-33   
gb|KIV86535.1|  thiamine thiazole synthase, variant 2                   131   6e-33   
ref|XP_007745751.1|  thiazole biosynthetic enzyme, mitochondrial        131   6e-33   
ref|XP_007591792.1|  thiazole biosynthetic enzyme                       130   7e-33   
emb|CCE33143.1|  probable CyPBP37 protein (protein binding to CyP41)    130   7e-33   
gb|KIV86533.1|  thiamine thiazole synthase                              131   8e-33   
gb|EFW98890.1|  thiazole biosynthetic enzyme                            130   8e-33   
gb|KEY67925.1|  hypothetical protein S7711_02133                        130   8e-33   
gb|KIW92677.1|  thiamine thiazole synthase                              130   8e-33   
gb|KIV92747.1|  thiamine thiazole synthase                              130   9e-33   
gb|KIW39396.1|  thiamine thiazole synthase, variant 1                   130   9e-33   
ref|XP_007721137.1|  thiazole biosynthetic enzyme, mitochondrial        130   9e-33   
gb|KEF63437.1|  thiazole biosynthetic enzyme, mitochondrial             130   9e-33   
ref|XP_001796354.1|  hypothetical protein SNOG_05965                    130   1e-32   
gb|KDN61355.1|  putative Thi4 family protein                            130   1e-32   
ref|XP_009154920.1|  thiazole biosynthetic enzyme, mitochondrial        130   1e-32   
ref|XP_499918.1|  YALI0A09768p                                          130   1e-32   
gb|EHK44880.1|  hypothetical protein TRIATDRAFT_299703                  130   1e-32   
gb|ACB70465.1|  thiazole biosynthetic enzyme                            130   1e-32   
gb|EFQ30532.1|  Thi4 family protein                                     130   1e-32   
gb|KIW79545.1|  thiamine thiazole synthase                              130   1e-32   
gb|KFA66874.1|  hypothetical protein S40285_02303                       130   1e-32   
gb|KIW29175.1|  thiamine thiazole synthase                              130   1e-32   
ref|XP_007728533.1|  thiazole biosynthetic enzyme, mitochondrial        130   2e-32   
gb|KIW68442.1|  thiamine thiazole synthase                              130   2e-32   
ref|XP_007757037.1|  thiazole biosynthetic enzyme, mitochondrial        130   2e-32   
gb|KIW39395.1|  thiamine thiazole synthase                              130   2e-32   
ref|XP_002172093.1|  thiazole biosynthetic enzyme                       130   2e-32   
ref|XP_009253330.1|  hypothetical protein FPSE_01936                    129   2e-32   
gb|KIW21130.1|  thiamine thiazole synthase                              130   2e-32   
emb|CDP29968.1|  Putative mitochondrial thiazole biosynthetic enz...    130   2e-32   
ref|XP_008726400.1|  thiazole biosynthetic enzyme, mitochondrial        129   2e-32   
ref|NP_596642.1|  thiazole biosynthetic enzyme                          129   2e-32   
ref|XP_011318395.1|  hypothetical protein FGSG_02469                    129   2e-32   
sp|P23618.2|THI4_FUSOX  RecName: Full=Thiamine thiazole synthase;...    129   3e-32   
emb|CDK26023.1|  unnamed protein product                                128   3e-32   
dbj|GAD93648.1|  thiazole biosynthetic enzyme                           129   3e-32   
gb|EWG49587.1|  thiamine biosynthetic enzyme                            129   3e-32   
ref|XP_007835960.1|  Thiamine thiazole synthase                         129   3e-32   
ref|XP_008714161.1|  thiazole biosynthetic enzyme, mitochondrial        129   3e-32   
gb|KIL95952.1|  hypothetical protein FAVG1_00690                        129   3e-32   
gb|KEQ82031.1|  Thi4-domain-containing protein                          129   4e-32   
gb|EMT70803.1|  Thiazole biosynthetic enzyme, mitochondrial             129   4e-32   
ref|XP_750725.1|  thiazole biosynthesis enzyme                          129   4e-32   
gb|KEY78369.1|  thiazole biosynthesis enzyme                            129   5e-32   
ref|XP_001214996.1|  hypothetical protein ATEG_05818                    129   5e-32   
dbj|GAA84055.1|  thiazole biosynthesis enzyme                           129   5e-32   
ref|XP_007277744.1|  thiazole biosynthetic enzyme                       127   5e-32   
ref|XP_001394167.1|  thiazole biosynthetic enzyme                       128   5e-32   
ref|XP_001257952.1|  thiazole biosynthesis enzyme                       128   6e-32   
gb|EXK40264.1|  thiamine biosynthetic enzyme                            129   6e-32   
ref|XP_001267966.1|  thiazole biosynthesis enzyme                       128   7e-32   
gb|EPE04284.1|  thiazole biosynthetic enzyme                            128   8e-32   
ref|XP_007271222.1|  thiazole biosynthetic enzyme                       128   9e-32   
gb|EQL00755.1|  thiazole biosynthetic enzyme variant 1                  127   1e-31   
gb|ABL63512.1|  mitochondrial thiazole biosynthetic enzyme              127   1e-31   
gb|EMF12655.1|  thiazole biosynthetic enzyme, mitochondrial             127   1e-31   
gb|EWG49586.1|  thiamine biosynthetic enzyme                            129   1e-31   
ref|XP_661532.1|  THI4_ASPOR Thiazole biosynthetic enzyme, mitoch...    127   1e-31   
gb|EQB43457.1|  hypothetical protein CGLO_17887                         127   1e-31   
gb|EMG50374.1|  hypothetical protein G210_4595                          127   2e-31   
gb|ERT00649.1|  thiazole biosynthetic enzyme, mitochondrial             127   2e-31   
gb|EYE95075.1|  Thi4 family thiamine biosynthetic enzyme                127   2e-31   
gb|ELQ63963.1|  hypothetical protein OOW_P131scaffold00904g6            131   3e-31   
gb|KIH92073.1|  thiamine biosynthetic enzyme                            127   3e-31   
ref|XP_002146762.1|  thiazole biosynthesis enzyme                       126   3e-31   
dbj|GAM85562.1|  hypothetical protein ANO11243_035690                   126   4e-31   
ref|XP_009648318.1|  STI35 protein                                      126   4e-31   
gb|EUC66166.1|  thiamine thiazole synthase                              126   4e-31   
ref|XP_002479053.1|  thiazole biosynthesis enzyme                       126   4e-31   
gb|KFX46359.1|  Thiamine thiazole synthase                              126   4e-31   
ref|XP_001835983.2|  thiazole biosynthetic enzyme                       125   5e-31   
gb|EKV04849.1|  Thiazole biosynthesis enzyme                            125   6e-31   
gb|KDB24510.1|  thiazole biosynthetic enzyme, mitochondrial             125   6e-31   
gb|EGD98433.1|  Thi4 family protein                                     125   6e-31   
gb|KEZ45124.1|  Thiamine thiazole synthase                              125   6e-31   
ref|XP_007399642.1|  hypothetical protein PHACADRAFT_177254             125   7e-31   
emb|CCM00650.1|  predicted protein                                      125   1e-30   
gb|EPS32049.1|  hypothetical protein PDE_07008                          125   1e-30   
gb|KDN34978.1|  hypothetical protein RSAG8_11984                        124   1e-30   
ref|XP_461084.2|  DEHA2F16654p                                          125   1e-30   
gb|ACZ34282.1|  thiazole synthase                                       125   1e-30   
ref|XP_007866883.1|  Thi4-domain-containing protein                     124   1e-30   
emb|CEI86769.1|  Putative Thiamine thiazole synthase                    124   1e-30   
emb|CCO32846.1|  Thiamine thiazole synthase AltName: Full=Stress-...    124   1e-30   
dbj|GAM35876.1|  thiazole biosynthetic enzyme                           124   2e-30   
ref|XP_002548228.1|  hypothetical protein CTRG_02525                    124   2e-30   
ref|XP_002842761.1|  thiazole biosynthetic enzyme                       124   2e-30   
ref|XP_010759569.1|  thiazole biosynthetic enzyme, mitochondrial        124   2e-30   
ref|XP_002797266.1|  thiazole biosynthesis enzyme                       124   2e-30   
gb|EEH19379.2|  thiazole biosynthetic enzyme, mitochondrial             124   2e-30   
ref|XP_009269436.1|  Thiamine thiazole synthase                         124   2e-30   
gb|EZF72777.1|  thiazole biosynthetic enzyme, mitochondrial             124   3e-30   
ref|XP_003013828.1|  hypothetical protein ARB_07940                     124   3e-30   
gb|EPX71211.1|  thiazole biosynthetic enzyme                            124   3e-30   
ref|XP_003169195.1|  thiazole biosynthesis enzyme                       124   3e-30   
ref|XP_007364009.1|  Thi4-domain-containing protein                     124   3e-30   
gb|EPY53594.1|  thiazole biosynthetic enzyme                            124   3e-30   
ref|XP_006957782.1|  Thi4-domain-containing protein                     123   3e-30   
gb|EDK40113.2|  conserved hypothetical protein                          124   3e-30   
ref|XP_002541542.1|  thiazole biosynthesis enzyme                       123   4e-30   
ref|XP_002564812.1|  Pc22g07960                                         123   4e-30   
gb|KGO43516.1|  Thiazole biosynthetic enzyme Thi4 family                123   4e-30   
gb|EEH38204.2|  thiazole biosynthesis enzyme                            124   4e-30   
gb|KII90613.1|  hypothetical protein PLICRDRAFT_538929                  123   4e-30   
gb|KDQ62341.1|  hypothetical protein JAAARDRAFT_170661                  123   5e-30   
ref|XP_008037799.1|  Thi4-domain-containing protein                     123   5e-30   
ref|XP_001538310.1|  hypothetical protein HCAG_05915                    123   6e-30   
gb|EEH05819.1|  thiazole biosynthetic enzyme                            123   6e-30   
gb|KGO71577.1|  Thiazole biosynthetic enzyme Thi4 family                123   6e-30   
gb|EER41684.1|  thiazole biosynthetic enzyme                            123   6e-30   
gb|EMD39842.1|  hypothetical protein CERSUDRAFT_112109                  123   6e-30   
gb|KIJ24322.1|  hypothetical protein M422DRAFT_274931                   123   6e-30   
sp|C0NSF3.2|THI4_AJECG  RecName: Full=Thiamine thiazole synthase;...    123   6e-30   
gb|EPT05287.1|  hypothetical protein FOMPIDRAFT_1112158                 122   6e-30   
ref|XP_003320392.1|  thiazole biosynthetic enzyme, mitochondrial        122   8e-30   
ref|XP_007380545.1|  thiazole biosynthetic enzyme                       122   8e-30   
gb|KIO02829.1|  hypothetical protein M404DRAFT_27718                    122   1e-29   
emb|CDM36407.1|  Thiazole biosynthetic enzyme, mitochondrial            123   1e-29   
ref|XP_003235740.1|  Thi4 family protein                                122   1e-29   
ref|XP_001483482.1|  conserved hypothetical protein                     122   1e-29   
gb|KIJ62636.1|  hypothetical protein HYDPIDRAFT_94083                   122   1e-29   
gb|KIP06210.1|  hypothetical protein PHLGIDRAFT_468135                  122   1e-29   
ref|XP_002626178.1|  thiazole biosynthesis enzyme                       122   1e-29   
gb|EEQ92538.1|  thiazole biosynthesis enzyme                            122   1e-29   
gb|KDQ25745.1|  hypothetical protein PLEOSDRAFT_1057999                 121   1e-29   
gb|EFW21941.1|  thiazole biosynthetic enzyme                            121   2e-29   
ref|XP_001247344.1|  thiazole biosynthetic enzyme, mitochondrial ...    121   2e-29   
ref|XP_003066032.1|  thiazole biosynthetic enzyme, mitochondrial ...    121   2e-29   
gb|KIK99865.1|  hypothetical protein PAXRUDRAFT_822318                  121   2e-29   
emb|CCX30406.1|  Similar to Thiamine thiazole synthase; acc. no. ...    121   3e-29   
gb|EGU11956.1|  Thiazole biosynthetic enzyme                            122   3e-29   
ref|XP_007319542.1|  hypothetical protein SERLADRAFT_470126             120   4e-29   
gb|KIM63333.1|  hypothetical protein SCLCIDRAFT_752494                  120   4e-29   
ref|XP_001526313.1|  hypothetical protein LELG_02871                    121   4e-29   
ref|XP_004199741.1|  Piso0_002284                                       120   4e-29   
ref|XP_002492875.1|  Thiazole synthase, catalyzes formation of th...    120   4e-29   
ref|XP_002615665.1|  hypothetical protein CLUG_04547                    118   4e-29   
gb|EMS18749.1|  thiamine biosynthetic enzyme                            121   5e-29   
gb|KIM43217.1|  hypothetical protein M413DRAFT_444027                   120   5e-29   
gb|KIY62047.1|  thiazole biosynthetic enzyme                            119   1e-28   
dbj|GAK64104.1|  thi4-domain-containing protein                         119   1e-28   
sp|Q9UVF8.1|THI4_UROFA  RecName: Full=Thiamine thiazole synthase;...    119   1e-28   
ref|XP_007304939.1|  Thi4-domain-containing protein                     119   2e-28   
ref|XP_004198891.1|  Piso0_002284                                       119   2e-28   
gb|EJT96874.1|  thiazole biosynthetic enzyme                            119   2e-28   
ref|XP_007351669.1|  thiazole biosynthetic enzyme                       118   3e-28   
ref|XP_007416429.1|  hypothetical protein MELLADRAFT_53832              118   3e-28   
ref|WP_043641419.1|  hypothetical protein                               116   4e-28   
ref|XP_007376158.1|  hypothetical protein SPAPADRAFT_51398              118   5e-28   
gb|KDN47179.1|  putative Thiamin biosynthetic enzyme                    117   5e-28   
gb|KGK37032.1|  hypothetical protein JL09_g3847                         117   6e-28   
gb|KDR82811.1|  hypothetical protein GALMADRAFT_238371                  116   6e-28   
gb|KIM86133.1|  hypothetical protein PILCRDRAFT_816673                  117   6e-28   
ref|XP_003868755.1|  Thi4 thiamine biosynthetic enzyme precursor        117   7e-28   
ref|XP_006462581.1|  hypothetical protein AGABI2DRAFT_72787             117   7e-28   
ref|XP_007853538.1|  thiazole biosynthetic enzyme                       117   7e-28   
gb|KCW75370.1|  hypothetical protein EUGRSUZ_E04118                     115   8e-28   
emb|CDI56388.1|  probable Thiamin biosynthetic enzyme                   117   1e-27   
dbj|GAC72397.1|  hypothetical protein PANT_7d00078                      117   1e-27   
gb|KHK14205.1|  ribulose-1,5-biphosphate synthetase                     111   1e-27   
gb|ETS60793.1|  hypothetical protein PaG_04705                          117   1e-27   
gb|ESW99744.1|  Thiamine thiazole synthase                              116   1e-27   
ref|XP_001386426.1|  hypothetical protein PICST_50942                   116   2e-27   
gb|KJA21255.1|  hypothetical protein HYPSUDRAFT_42403                   116   2e-27   
gb|KIL63207.1|  hypothetical protein M378DRAFT_79929                    116   2e-27   
gb|KJB57702.1|  hypothetical protein B456_009G176400                    115   2e-27   
emb|CBQ71006.1|  probable Thiamin biosynthetic enzyme                   116   2e-27   
ref|XP_009546328.1|  hypothetical protein HETIRDRAFT_440039             116   3e-27   
emb|CCE44732.1|  hypothetical protein CPAR2_405360                      116   3e-27   
gb|EIF46156.1|  thiazole biosynthetic enzyme                            115   3e-27   
ref|XP_007882083.1|  hypothetical protein PFL1_06351                    115   3e-27   
dbj|GAC98786.1|  flavin-binding monooxygenase-like                      115   3e-27   
emb|CCF51739.1|  probable Thiamin biosynthetic enzyme                   115   3e-27   
gb|EST05805.1|  flavin-binding monooxygenase-like                       115   3e-27   
gb|KIK52064.1|  hypothetical protein GYMLUDRAFT_50135                   115   4e-27   
gb|KIY43384.1|  Thi4-domain-containing protein                          115   4e-27   
ref|XP_011388856.1|  putative Thiamin biosynthetic enzyme               115   5e-27   
emb|CDG58549.1|  Thi4-2 protein                                         115   5e-27   
emb|CDG58546.1|  Thi4 protein                                           115   5e-27   
emb|CDG58548.1|  Thi4-1 protein                                         115   5e-27   
gb|KIJ17836.1|  hypothetical protein PAXINDRAFT_9774                    114   5e-27   
gb|AAL86771.2|  THI4 enzyme                                             115   7e-27   
ref|XP_723197.1|  likely thiamine biosynthesis enzyme                   115   7e-27   
ref|XP_002419419.1|  thiamine biosynthesis enzyme, putative; thia...    115   7e-27   
gb|KGR10168.1|  thiazole biosynthesis enzyme                            115   7e-27   
gb|KGQ88127.1|  thiazole biosynthesis enzyme                            115   7e-27   
gb|KHC37210.1|  thiazole biosynthesis enzyme                            114   8e-27   
gb|KHC63824.1|  thiazole biosynthesis enzyme                            114   9e-27   
ref|XP_003034505.1|  hypothetical protein SCHCODRAFT_84820              113   2e-26   
emb|CDG58547.1|  Thi4 protein                                           113   3e-26   
emb|CCV00434.1|  unnamed protein product                                113   3e-26   
ref|XP_007768494.1|  Thi4-domain-containing protein                     112   4e-26   
sp|C4YNP4.1|THI4_CANAW  RecName: Full=Thiamine thiazole synthase;...    112   8e-26   
gb|ABN45974.1|  thiazole biosynthetic enzyme variant 1                  108   8e-25   
emb|CAA57779.1|  nmt2                                                   108   1e-24   
gb|ADI87873.1|  HCF106 protein                                          103   2e-24   
gb|ADI87867.1|  HCF106 protein                                          102   2e-24   
gb|ADI87863.1|  HCF106 protein                                          103   2e-24   
gb|ADI87875.1|  HCF106 protein                                          102   5e-24   
gb|ELU45290.1|  thiazole biosynthetic enzyme                            110   5e-24   
gb|ADI87865.1|  HCF106 protein                                          102   7e-24   
sp|Q4PC85.1|THI4_USTMA  RecName: Full=Thiamine thiazole synthase;...    103   1e-22   
ref|XP_001731131.1|  hypothetical protein MGL_1314                      103   1e-22   
emb|CEG76808.1|  Putative Thiamine thiazole synthase                    100   7e-22   
gb|KIK18380.1|  hypothetical protein PISMIDRAFT_684279                94.7    2e-21   
ref|XP_451008.1|  hypothetical protein                                99.4    2e-21   
emb|CDO93401.1|  unnamed protein product                              99.0    3e-21   
dbj|BAO40649.1|  thiazole biosynthetic enzyme                         98.2    5e-21   
gb|KHK14206.1|  ribulose-1,5-biphosphate synthetase                   91.7    1e-20   
ref|XP_001647032.1|  hypothetical protein Kpol_1050p31                97.1    2e-20   
ref|WP_004031601.1|  ribonucleoside-triphosphate reductase            94.0    1e-19   
ref|XP_449395.1|  hypothetical protein                                94.0    2e-19   
ref|XP_003683090.1|  hypothetical protein TDEL_0H00200                93.6    2e-19   
gb|AAR16530.1|  thiazole biosynthetic enzyme precursor                88.2    3e-19   
ref|XP_011273842.1|  Thiazole biosynthetic enzyme                     92.8    4e-19   



>emb|CDO99712.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   248 bits (634),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 129/135 (96%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  219  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  278

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAP  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG+PNALDG+ SEV  A P
Sbjct  279  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGQPNALDGTLSEVNTAQP  338

Query  234  ELILASAENEEIADA  190
            +LILA+AE EE+ DA
Sbjct  339  DLILAAAETEEVVDA  353



>ref|XP_006449089.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
 gb|ESR62329.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
Length=359

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 126/135 (93%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  225  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA--AP  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ SEV    P
Sbjct  285  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEVTEVQP  344

Query  234  ELILASAENEEIADA  190
            E ILA+ EN EI DA
Sbjct  345  EFILAATENSEIVDA  359



>ref|XP_006467989.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Citrus 
sinensis]
 gb|KDO75540.1| hypothetical protein CISIN_1g018188mg [Citrus sinensis]
Length=359

 Score =   247 bits (630),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 126/135 (93%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  225  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA--AP  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ SEV    P
Sbjct  285  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEVTEVQP  344

Query  234  ELILASAENEEIADA  190
            E +LA+ EN EI DA
Sbjct  345  EFVLAATENSEIVDA  359



>gb|KJB57703.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=219

 Score =   242 bits (617),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 126/135 (93%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTRE+
Sbjct  85   MDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREV  144

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAP  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ SE     P
Sbjct  145  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEAERVQP  204

Query  234  ELILASAENEEIADA  190
            E +LA+AE EEI DA
Sbjct  205  EFVLAAAETEEIVDA  219



>gb|KHG02821.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=355

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 126/135 (93%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTRE+
Sbjct  221  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREV  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAP  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ SE     P
Sbjct  281  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEAERVQP  340

Query  234  ELILASAENEEIADA  190
            E +LASAE EEI DA
Sbjct  341  EFVLASAETEEIVDA  355



>emb|CAN74175.1| hypothetical protein VITISV_019223 [Vitis vinifera]
Length=219

 Score =   239 bits (611),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 126/135 (93%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  85   MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  144

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSAS--EVAAP  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG+PNA+DG+ +  E   P
Sbjct  145  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGQPNAIDGNYTEAETMQP  204

Query  234  ELILASAENEEIADA  190
            ELILA+AE  EI DA
Sbjct  205  ELILAAAETGEIVDA  219



>gb|KJB57700.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
 gb|KJB57701.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=355

 Score =   243 bits (621),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 126/135 (93%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTRE+
Sbjct  221  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREV  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAP  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ SE     P
Sbjct  281  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTFSEAERVQP  340

Query  234  ELILASAENEEIADA  190
            E +LA+AE EEI DA
Sbjct  341  EFVLAAAETEEIVDA  355



>emb|CAJ91138.1| thiamin biosynthetic enzyme [Platanus x acerifolia]
Length=171

 Score =   236 bits (603),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 129/135 (96%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTRE+
Sbjct  37   MDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREV  96

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA--P  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+ S++ +  P
Sbjct  97   VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGLPNAMDGNYSDMGSIHP  156

Query  234  ELILASAENEEIADA  190
            ELILA+AE+ +IADA
Sbjct  157  ELILAAAESGDIADA  171



>emb|CBI23176.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 126/135 (93%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  203  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  262

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSAS--EVAAP  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG+PNA+DG+ +  E   P
Sbjct  263  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGQPNAIDGNYTEAETMQP  322

Query  234  ELILASAENEEIADA  190
            ELILA+AE  EI DA
Sbjct  323  ELILAAAETGEIVDA  337



>gb|KJB67127.1| hypothetical protein B456_010G176000 [Gossypium raimondii]
Length=356

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 125/135 (93%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  222  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  281

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEV--AAP  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ SE     P
Sbjct  282  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAVDGTFSEAERVQP  341

Query  234  ELILASAENEEIADA  190
            E +LA+AE EE  DA
Sbjct  342  EFVLAAAETEETVDA  356



>ref|XP_002267414.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Vitis 
vinifera]
 sp|F6H7K5.1|THI42_VITVI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Vitis vinifera]
Length=355

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 126/135 (93%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  221  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSAS--EVAAP  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG+PNA+DG+ +  E   P
Sbjct  281  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGQPNAIDGNYTEAETMQP  340

Query  234  ELILASAENEEIADA  190
            ELILA+AE  EI DA
Sbjct  341  ELILAAAETGEIVDA  355



>gb|AFM35683.1| thiamin biosynthetic protein [Vitis pseudoreticulata]
Length=355

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 126/135 (93%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKS+GMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  221  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSVGMIDSVPGMKALDMNTAEDAIVRLTREI  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSAS--EVAAP  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG+PNA+DG+ +  E   P
Sbjct  281  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGQPNAIDGNYTEAETMQP  340

Query  234  ELILASAENEEIADA  190
            ELILA+AE  EI DA
Sbjct  341  ELILAAAETGEIVDA  355



>ref|XP_002305603.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
 gb|ABK94925.1| unknown [Populus trichocarpa]
 gb|EEE86114.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
Length=350

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 124/133 (93%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREI
Sbjct  220  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREI  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNALDG+ S    PEL
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNALDGTFS--LQPEL  337

Query  228  ILASAENEEIADA  190
            +LA+AE  EI DA
Sbjct  338  VLAAAEAGEIVDA  350



>gb|KEH43920.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=349

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  217  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREV  276

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG  NA+DG+    + PEL
Sbjct  277  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCESASEPEL  336

Query  228  ILASAENEEIADA  190
            ILASAE+++  DA
Sbjct  337  ILASAESQDTVDA  349



>ref|XP_011096106.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=354

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 125/135 (93%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  220  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA--P  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG+PNAL+GS  EV     
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGQPNALEGSYREVKTGVE  339

Query  234  ELILASAENEEIADA  190
            E +LASAE++E  DA
Sbjct  340  EFMLASAESDETVDA  354



>gb|EYU33910.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
 gb|EYU33911.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
Length=351

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 1/133 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRL+SIGMI+SVPGMKALDMNTAEDAIVRLTREI
Sbjct  220  MDPNVMEAKIVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKALDMNTAEDAIVRLTREI  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG P+ALDGS SE A PEL
Sbjct  280  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPHALDGSYSE-AQPEL  338

Query  228  ILASAENEEIADA  190
            +LASAE +++ +A
Sbjct  339  VLASAEADDVVEA  351



>ref|XP_011037712.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   238 bits (607),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 124/133 (93%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREI
Sbjct  220  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREI  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNALDG+ S    PEL
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNALDGTFS--LQPEL  337

Query  228  ILASAENEEIADA  190
            +LA++E  EI DA
Sbjct  338  VLAASEAGEIVDA  350



>ref|XP_010105570.1| Thiamine thiazole synthase 2 [Morus notabilis]
 gb|EXC05099.1| Thiamine thiazole synthase 2 [Morus notabilis]
Length=353

 Score =   238 bits (607),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 125/134 (93%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRL+SIGMIDSVPGMKALDMN AEDAIVRLTREI
Sbjct  220  MDPNVMEAKIVVSSCGHDGPFGATGVKRLRSIGMIDSVPGMKALDMNAAEDAIVRLTREI  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSA-SEVAAPE  232
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDGS+      PE
Sbjct  280  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGSSVGSNIHPE  339

Query  231  LILASAENEEIADA  190
            LILA+AEN EIADA
Sbjct  340  LILAAAENAEIADA  353



>gb|KHG29710.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=356

 Score =   238 bits (608),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 124/135 (92%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  222  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  281

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD--GSASEVAAP  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+D   S +E   P
Sbjct  282  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDVTFSKAERVQP  341

Query  234  ELILASAENEEIADA  190
            E +LA+AE EE  DA
Sbjct  342  EFVLAAAETEETVDA  356



>ref|XP_011086171.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=353

 Score =   238 bits (607),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 125/135 (93%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  219  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  278

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA--P  235
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLAL+ALG+P+ALDG  +EV    P
Sbjct  279  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALRALGQPSALDGGRNEVKTDQP  338

Query  234  ELILASAENEEIADA  190
            E ILASAE +E  DA
Sbjct  339  EFILASAEPDETVDA  353



>ref|XP_010062976.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Eucalyptus 
grandis]
Length=357

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  225  MDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIDSVPGMKALDMNTAEDAIVRLTREI  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALDGS      PEL
Sbjct  285  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGSIQPEL  344

Query  228  ILASAENEEIADA  190
            ILA+A++ EIA+A
Sbjct  345  ILAAADSAEIAEA  357



>gb|ABK21260.1| unknown [Picea sitchensis]
Length=179

 Score =   232 bits (591),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 122/128 (95%), Gaps = 2/128 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREI
Sbjct  48   MDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREI  107

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+ +    PEL
Sbjct  108  VPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLT--VHPEL  165

Query  228  ILASAENE  205
            +LASAE+E
Sbjct  166  VLASAEDE  173



>ref|XP_006401539.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
 gb|ESQ42992.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
Length=350

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  218  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREV  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PN LDGS     +PEL
Sbjct  278  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNVLDGSYVGNLSPEL  337

Query  228  ILASAENEEIADA  190
            +LA+A++ E  DA
Sbjct  338  VLAAADSAETVDA  350



>emb|CDY47441.1| BnaC09g31160D [Brassica napus]
Length=352

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  220  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREV  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PN LDGS     +PEL
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNVLDGSYVGNLSPEL  339

Query  228  ILASAENEEIADA  190
            +LA+A++ E  DA
Sbjct  340  VLAAADSAETVDA  352



>emb|CDY41008.1| BnaA02g27980D [Brassica napus]
Length=280

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  148  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREV  207

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PN +DGS     +PEL
Sbjct  208  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNVIDGSYVGDLSPEL  267

Query  228  ILASAENEEIADA  190
            +LA+A++ E  DA
Sbjct  268  VLAAADSAETVDA  280



>ref|XP_010267751.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Nelumbo 
nucifera]
Length=356

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 127/135 (94%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKSIG+I+SVPGMKALDMN AEDAIVRLTREI
Sbjct  222  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGLIESVPGMKALDMNVAEDAIVRLTREI  281

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA--P  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+ SE  +  P
Sbjct  282  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGLPNAIDGTYSEKGSIHP  341

Query  234  ELILASAENEEIADA  190
            ELILASA++ EIADA
Sbjct  342  ELILASADSTEIADA  356



>gb|ABK95834.1| unknown [Populus trichocarpa]
Length=278

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 123/133 (92%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREI
Sbjct  148  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREI  207

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNALDG+ S    PEL
Sbjct  208  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNALDGTFS--LQPEL  265

Query  228  ILASAENEEIADA  190
            +LA+AE  +  DA
Sbjct  266  VLAAAEAGDTVDA  278



>ref|XP_011000691.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 124/133 (93%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREI
Sbjct  220  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREI  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+ S    PEL
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTLS--LQPEL  337

Query  228  ILASAENEEIADA  190
            +LA+AE  +I DA
Sbjct  338  VLAAAEAGDIVDA  350



>gb|KDP39066.1| hypothetical protein JCGZ_00823 [Jatropha curcas]
Length=354

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI+SVPGMKALDMNTAEDAIVRLTREI
Sbjct  224  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIESVPGMKALDMNTAEDAIVRLTREI  283

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNALDG+ +    PEL
Sbjct  284  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGLPNALDGTFT--IHPEL  341

Query  228  ILASAENEEIADA  190
            +LA+AE+ +IADA
Sbjct  342  MLAAAESADIADA  354



>gb|KJB13600.1| hypothetical protein B456_002G083700 [Gossypium raimondii]
Length=357

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  225  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+      PEL
Sbjct  285  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNAIDGTYVGSIQPEL  344

Query  228  ILASAENEEIADA  190
            ILA+A++ E ADA
Sbjct  345  ILAAADSAETADA  357



>gb|AFK44470.1| unknown [Medicago truncatula]
Length=349

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  217  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREV  276

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG  NA+DG+    + PEL
Sbjct  277  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCEFASEPEL  336

Query  228  ILASAENEEIADA  190
            ILA AE+++  DA
Sbjct  337  ILAFAESQDTVDA  349



>gb|ADG27845.1| thiazole biosynthetic enzyme [Gossypium hirsutum]
Length=357

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  225  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+      PEL
Sbjct  285  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNAIDGTYVGSIHPEL  344

Query  228  ILASAENEEIADA  190
            ILA+A++ E ADA
Sbjct  345  ILAAADSAETADA  357



>gb|KHG06769.1| Thiamine thiazole synthase 1, chloroplastic [Gossypium arboreum]
Length=357

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  225  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+      PEL
Sbjct  285  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNAIDGTHVGTIHPEL  344

Query  228  ILASAENEEIADA  190
            ILA A++ E ADA
Sbjct  345  ILAVADSAETADA  357



>gb|KHN15802.1| Thiamine thiazole synthase 2, chloroplastic [Glycine soja]
Length=181

 Score =   230 bits (586),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 122/134 (91%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREI
Sbjct  48   MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREI  107

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASE-VAAPE  232
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG  NA+DG+       P+
Sbjct  108  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCGVGREEPQ  167

Query  231  LILASAENEEIADA  190
            LILASA+ EEI DA
Sbjct  168  LILASADTEEIVDA  181



>ref|XP_007021022.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
 gb|EOY12547.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
Length=358

 Score =   236 bits (601),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  226  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  285

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLAL++LG PNALDG+      PEL
Sbjct  286  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALQSLGLPNALDGTYVGNIHPEL  345

Query  228  ILASAENEEIADA  190
            ILA+A++ E ADA
Sbjct  346  ILAAADSAETADA  358



>ref|XP_009120006.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Brassica 
rapa]
Length=352

 Score =   236 bits (601),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  220  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREV  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PN LDGS     +PEL
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNVLDGSYVGNLSPEL  339

Query  228  ILASAENEEIAD  193
            +LA+A++ E  D
Sbjct  340  VLAAADSAETVD  351



>ref|XP_002317206.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
 gb|EEE97818.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
Length=350

 Score =   235 bits (600),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 123/133 (92%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREI
Sbjct  220  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREI  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNALDG+ S    PEL
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNALDGTFS--LQPEL  337

Query  228  ILASAENEEIADA  190
            +LA+AE  +  DA
Sbjct  338  VLAAAEAGDTVDA  350



>ref|XP_007025992.1| Thiazole biosynthetic enzyme [Theobroma cacao]
 gb|EOY28614.1| Thiazole biosynthetic enzyme [Theobroma cacao]
Length=387

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 123/135 (91%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  253  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  312

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASE--VAAP  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PNA+DG+  E     P
Sbjct  313  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNAIDGTFIEGGRVQP  372

Query  234  ELILASAENEEIADA  190
            E +LA+AE E   DA
Sbjct  373  EFVLAAAETEGTVDA  387



>gb|AFK49632.1| unknown [Lotus japonicus]
Length=355

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 122/134 (91%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVR TRE+
Sbjct  222  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRFTREV  281

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA-APE  232
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+ NA+DG+   V   PE
Sbjct  282  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGKNNAIDGTCEAVREEPE  341

Query  231  LILASAENEEIADA  190
            L+LAS + EE  DA
Sbjct  342  LVLASVDAEETVDA  355



>ref|XP_009127069.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=349

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  217  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREV  276

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PN +DGS     +PEL
Sbjct  277  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNVIDGSYVGDLSPEL  336

Query  228  ILASAENEEIADA  190
            +LA+A++ E  DA
Sbjct  337  VLAAADSAETVDA  349



>emb|CDY28754.1| BnaA02g09460D [Brassica napus]
Length=349

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  217  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREV  276

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG+PN +DGS     +PEL
Sbjct  277  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGQPNVIDGSYVGDLSPEL  336

Query  228  ILASAENEEIADA  190
            +LA+A++ E  DA
Sbjct  337  VLAAADSAETVDA  349



>ref|XP_008803216.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Phoenix 
dactylifera]
Length=355

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 124/134 (93%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLK IGMIDSVPGMKALDMN+AEDAIVRLTREI
Sbjct  222  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKDIGMIDSVPGMKALDMNSAEDAIVRLTREI  281

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDG-SASEVAAPE  232
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNALDG S +E   PE
Sbjct  282  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNALDGISWAEKVHPE  341

Query  231  LILASAENEEIADA  190
            ++LAS+E  ++ DA
Sbjct  342  MVLASSEGGDVVDA  355



>gb|AAV92535.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 2/128 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREI
Sbjct  212  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREI  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL
Sbjct  272  VPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PEL  329

Query  228  ILASAENE  205
            +LASAENE
Sbjct  330  VLASAENE  337



>gb|AAV92539.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 2/128 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREI
Sbjct  212  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREI  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL
Sbjct  272  VPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PEL  329

Query  228  ILASAENE  205
            +LASAENE
Sbjct  330  VLASAENE  337



>gb|AAV92531.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92533.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92534.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92536.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92542.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92543.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92544.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92545.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92547.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92548.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92549.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92550.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92551.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92555.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92556.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 2/128 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREI
Sbjct  212  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREI  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL
Sbjct  272  VPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PEL  329

Query  228  ILASAENE  205
            +LASAENE
Sbjct  330  VLASAENE  337



>sp|Q38709.1|THI4_ALNGL RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Alnus 
glutinosa]
 emb|CAA66064.1| thaizole biosynthetic enzmye [Alnus glutinosa]
Length=352

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVK L+SIGMID+VPGMKALDMN AEDAIVRLTREI
Sbjct  220  MDPNVMEAKVVVSSCGHDGPFGATGVKSLRSIGMIDTVPGMKALDMNVAEDAIVRLTREI  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNALDGS      PEL
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIHPEL  339

Query  228  ILASAENEEIADA  190
            ILA+A++ EIADA
Sbjct  340  ILAAADSAEIADA  352



>ref|NP_001275783.1| thiamine thiazole synthase, chloroplastic [Citrus sinensis]
 sp|O23787.1|THI4_CITSI RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Citrus 
sinensis]
 emb|CAB05370.1| thi [Citrus sinensis]
Length=356

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLTRE+
Sbjct  224  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREV  283

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNALDG+      PEL
Sbjct  284  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPEL  343

Query  228  ILASAENEEIADA  190
            ILA+A++ E ADA
Sbjct  344  ILAAADSAETADA  356



>gb|AAV92529.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92530.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92532.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92540.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92541.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92546.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 2/128 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREI
Sbjct  212  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREI  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL
Sbjct  272  VPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PEL  329

Query  228  ILASAENE  205
            +LASAENE
Sbjct  330  VLASAENE  337



>gb|AAV92552.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92553.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 2/128 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREI
Sbjct  212  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREI  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL
Sbjct  272  VPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PEL  329

Query  228  ILASAENE  205
            +LASAENE
Sbjct  330  VLASAENE  337



>gb|AAV92537.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 2/128 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREI
Sbjct  212  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREI  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL
Sbjct  272  VPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PEL  329

Query  228  ILASAENE  205
            +LASAENE
Sbjct  330  VLASAENE  337



>gb|AAV92554.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=351

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 2/128 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREI
Sbjct  220  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREI  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL
Sbjct  280  VPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PEL  337

Query  228  ILASAENE  205
            +LASAENE
Sbjct  338  VLASAENE  345



>gb|KCW70139.1| hypothetical protein EUGRSUZ_F03433 [Eucalyptus grandis]
Length=487

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  355  MDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIDSVPGMKALDMNTAEDAIVRLTREI  414

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALDGS      PEL
Sbjct  415  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGSIQPEL  474

Query  228  ILASAENEEIADA  190
            ILA+A++ EIA+A
Sbjct  475  ILAAADSAEIAEA  487



>emb|CDY43024.1| BnaA03g11710D [Brassica napus]
Length=351

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  219  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREV  278

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA HLALKALG+PNALDG+     +PEL
Sbjct  279  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGHLALKALGQPNALDGTYVGDLSPEL  338

Query  228  ILASAENEEIADA  190
            +LA A++ E  DA
Sbjct  339  VLAVADSAETVDA  351



>gb|AAV92538.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 2/128 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREI
Sbjct  212  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREI  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+   +  PEL
Sbjct  272  VPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLKVL--PEL  329

Query  228  ILASAENE  205
            +LASAENE
Sbjct  330  LLASAENE  337



>gb|KHN47860.1| Thiamine thiazole synthase 2, chloroplastic [Glycine soja]
Length=178

 Score =   228 bits (580),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMN AEDAIV+LTRE+
Sbjct  48   MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVKLTREV  107

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALD   +    PEL
Sbjct  108  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VHPEL  165

Query  228  ILASAENEEIADA  190
            +LA+AE+ EIADA
Sbjct  166  VLAAAESAEIADA  178



>ref|XP_007143207.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
 gb|ESW15201.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
Length=355

 Score =   233 bits (595),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 122/134 (91%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  222  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  281

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASE-VAAPE  232
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG  NA+DG+       PE
Sbjct  282  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCGVGREEPE  341

Query  231  LILASAENEEIADA  190
            L+LASA  E+I DA
Sbjct  342  LVLASANTEDIVDA  355



>ref|XP_002973063.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
 gb|EFJ26284.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
Length=356

 Score =   233 bits (595),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGA GVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTRE+
Sbjct  223  MDPNVMEAKVVVSSCGHDGPFGAAGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREV  282

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+      PEL
Sbjct  283  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGMPNAIDGTLKAGYLPEL  342

Query  228  ILASAENEE  202
            +LASAE++E
Sbjct  343  VLASAEDDE  351



>ref|XP_002522858.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
 gb|EEF39556.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
Length=359

 Score =   233 bits (595),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  229  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  288

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG P+ALDG+ +    PEL
Sbjct  289  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPSALDGTFT--LHPEL  346

Query  228  ILASAENEEIADA  190
            +LA+AE+ E ADA
Sbjct  347  VLAAAESGETADA  359



>gb|ACN66755.1| thiazole biosynthetic enzyme [Carica papaya]
Length=192

 Score =   228 bits (580),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMN AEDAIVRL REI
Sbjct  60   MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPGMKALDMNVAEDAIVRLAREI  119

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+ +    PEL
Sbjct  120  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGLPNAVDGTYAGGLHPEL  179

Query  228  ILASAENEEIADA  190
            +LA+ E+ E A+A
Sbjct  180  VLAAGESAETAEA  192



>ref|XP_002994429.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
 gb|EFJ04508.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
Length=356

 Score =   233 bits (594),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGA GVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTRE+
Sbjct  223  MDPNVMEAKVVVSSCGHDGPFGAAGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREV  282

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNA+DG+      PEL
Sbjct  283  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGMPNAIDGTLKAGYLPEL  342

Query  228  ILASAENEE  202
            +LASAE++E
Sbjct  343  VLASAEDDE  351



>ref|XP_009408664.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEA++VVSSCGHDGPFGATGVKRLK IGMIDSVPGMKALDMN AEDAIVRLTRE+
Sbjct  225  MDPNVMEARVVVSSCGHDGPFGATGVKRLKGIGMIDSVPGMKALDMNAAEDAIVRLTREV  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS-ASEVAAPE  232
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +E   PE
Sbjct  285  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTIGAEAVQPE  344

Query  231  LILASAENEEIADA  190
            L+LAS++  EI DA
Sbjct  345  LVLASSDAGEIVDA  358



>gb|KDO52968.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=356

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLTRE+
Sbjct  224  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREV  283

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNALDG+      PEL
Sbjct  284  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPEL  343

Query  228  ILASAENEEIAD  193
            ILA+A++ E AD
Sbjct  344  ILAAADSAETAD  355



>gb|AAW66657.1| thiamine biosynthetic enzyme [Picrorhiza kurrooa]
Length=354

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+KIVVSSCGHDGPFGATGVKRL+SIGMIDSVPGMKALDMNTAEDAIVRL REI
Sbjct  222  MDPNVMESKIVVSSCGHDGPFGATGVKRLRSIGMIDSVPGMKALDMNTAEDAIVRLAREI  281

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG+PNALD S   + A E 
Sbjct  282  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGQPNALDDSYDGLKAEEF  341

Query  228  ILASAENEEIADA  190
            +LA+A+  +I DA
Sbjct  342  VLAAADAGDIVDA  354



>ref|XP_007213805.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
 gb|EMJ15004.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
Length=360

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGP GATGVKRL+SIGMI+SVPGMKALDMNTAEDAIV+LTREI
Sbjct  228  MDPNVMEAKVVVSSCGHDGPMGATGVKRLRSIGMIESVPGMKALDMNTAEDAIVKLTREI  287

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDGS      PEL
Sbjct  288  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGSYVGSIQPEL  347

Query  228  ILASAENEEIADA  190
            ILA+A++ EIA+A
Sbjct  348  ILAAADSAEIAEA  360



>ref|XP_006452193.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
 gb|ESR65433.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
Length=356

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLTRE+
Sbjct  224  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREV  283

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL +LG+PNALDG+      PEL
Sbjct  284  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALNSLGQPNALDGTYVGGVHPEL  343

Query  228  ILASAENEEIADA  190
            ILA+A++ E ADA
Sbjct  344  ILAAADSAETADA  356



>ref|XP_003556028.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 122/134 (91%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREI
Sbjct  218  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREI  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASE-VAAPE  232
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG  NA+DG+       P+
Sbjct  278  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCGVGREEPQ  337

Query  231  LILASAENEEIADA  190
            LILASA+ EEI DA
Sbjct  338  LILASADTEEIVDA  351



>gb|ABK23376.1| unknown [Picea sitchensis]
Length=368

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 122/128 (95%), Gaps = 2/128 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTREI
Sbjct  237  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTREI  296

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMM+SGQKAAHLALKALG+PNALDG+ +    PEL
Sbjct  297  VPGMIVTGMEVAEIDGSPRMGPTFGAMMVSGQKAAHLALKALGQPNALDGTLT--VHPEL  354

Query  228  ILASAENE  205
            +LASAE+E
Sbjct  355  VLASAEDE  362



>ref|XP_010923945.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Elaeis 
guineensis]
Length=360

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 124/134 (93%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLK IGMIDSVPGMKALDMN+AEDAIVRLTREI
Sbjct  227  MDPNVMESKVVVSSCGHDGPFGATGVKRLKDIGMIDSVPGMKALDMNSAEDAIVRLTREI  286

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS-ASEVAAPE  232
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNALDG+  +E   PE
Sbjct  287  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNALDGTIGTEQVHPE  346

Query  231  LILASAENEEIADA  190
            ++LAS++  ++ DA
Sbjct  347  MVLASSDGGDVVDA  360



>gb|EYU27823.1| hypothetical protein MIMGU_mgv1a009995mg [Erythranthe guttata]
Length=325

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 124/136 (91%), Gaps = 3/136 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRL+SIGMI+SVPGMKALDMNTAEDAIVRLTREI
Sbjct  190  MDPNVMEAKIVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKALDMNTAEDAIVRLTREI  249

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSAS---EVAA  238
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLAL+ALG PNALD S +   E A 
Sbjct  250  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALRALGLPNALDVSYAGGVETAQ  309

Query  237  PELILASAENEEIADA  190
            PE ILASA+++   DA
Sbjct  310  PEFILASADSDVSVDA  325



>ref|XP_009132425.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=351

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFG TGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  219  MDPNVMEAKIVVSSCGHDGPFGDTGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREV  278

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA HLALKALG+PNALDG+     +PEL
Sbjct  279  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGHLALKALGQPNALDGTYVGDLSPEL  338

Query  228  ILASAENEEIADA  190
            +LA A++ E  DA
Sbjct  339  VLAVADSAETVDA  351



>ref|XP_003536550.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 121/134 (90%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREI
Sbjct  218  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREI  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASE-VAAPE  232
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG  NA+DG+       P+
Sbjct  278  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCGVGREEPQ  337

Query  231  LILASAENEEIADA  190
            LI ASA+ EEI DA
Sbjct  338  LIFASADTEEIVDA  351



>gb|KFK27084.1| hypothetical protein AALP_AA8G331900 [Arabis alpina]
Length=345

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  213  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREV  272

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL
Sbjct  273  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTNVGELSPEL  332

Query  228  ILASAENEEIADA  190
            +LA+A++ E  DA
Sbjct  333  VLAAADSAETVDA  345



>emb|CDP05793.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   229 bits (583),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNV+EAK+VVSSCGHDGPFGATGVKRLKSIGMI++VPGMKALDMN AEDAIVRLTREI
Sbjct  148  MDPNVVEAKVVVSSCGHDGPFGATGVKRLKSIGMIENVPGMKALDMNAAEDAIVRLTREI  207

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALDG+ +    PEL
Sbjct  208  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDGTYAGSIHPEL  267

Query  228  ILASAENEEIADA  190
            ILA+A+  E  DA
Sbjct  268  ILAAADASETVDA  280



>emb|CDY52570.1| BnaC03g71780D [Brassica napus]
Length=352

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKI-VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTRE  412
            MDPNVMEAKI VVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE
Sbjct  219  MDPNVMEAKIIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTRE  278

Query  411  IVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPE  232
            +VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA HLALKALG+PNALDG+     +PE
Sbjct  279  VVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGHLALKALGQPNALDGTYVGDLSPE  338

Query  231  LILASAENEEIADA  190
            L+LA+A++ E  DA
Sbjct  339  LVLAAADSAETVDA  352



>ref|XP_004504342.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=349

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 125/133 (94%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMNTAEDAIVRLTRE+
Sbjct  219  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDTVPGMKALDMNTAEDAIVRLTREV  278

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNA+D + +    PEL
Sbjct  279  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGLPNAVDYATN--IHPEL  336

Query  228  ILASAENEEIADA  190
            +LA+A+++E ADA
Sbjct  337  VLAAADSDETADA  349



>ref|XP_004505443.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=352

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMNTAEDAIVRLTRE+
Sbjct  220  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNTAEDAIVRLTREV  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHL L++LG PNA+D +      PEL
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLVLRSLGLPNAVDHAGDINTQPEL  339

Query  228  ILASAENEEIADA  190
            +LA+A++ EIADA
Sbjct  340  VLAAADSVEIADA  352



>ref|NP_200288.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
 sp|Q38814.1|THI4_ARATH RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16153.1|AF428385_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL16285.1|AF428355_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL31936.1|AF419604_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAC97124.1| Thi1 protein [Arabidopsis thaliana]
 dbj|BAB08756.1| thiazole biosynthetic enzyme precursor (ARA6) [Arabidopsis thaliana]
 gb|AAL06876.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL24202.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAN12914.1| At5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AED96539.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
Length=349

 Score =   231 bits (588),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  217  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREV  276

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL
Sbjct  277  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPEL  336

Query  228  ILASAENEEIADA  190
            +LA+A++ E  DA
Sbjct  337  VLAAADSAETVDA  349



>ref|XP_006280726.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
 gb|EOA13624.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
Length=350

 Score =   231 bits (588),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  218  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREV  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL
Sbjct  278  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTNVGNLSPEL  337

Query  228  ILASAENEEIADA  190
            +LA+A++ E  DA
Sbjct  338  VLAAADSAETVDA  350



>ref|XP_002864354.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40613.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   230 bits (587),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  220  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREV  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTNVGNLSPEL  339

Query  228  ILASAENEEIADA  190
            +LA+A++ E  DA
Sbjct  340  VLAAADSAETVDA  352



>gb|EPS63253.1| hypothetical protein M569_11533 [Genlisea aurea]
Length=344

 Score =   230 bits (586),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMN AEDAIVRLTREI
Sbjct  212  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDAVPGMKALDMNAAEDAIVRLTREI  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLAL+ALG PNALDG    V   E 
Sbjct  272  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALRALGLPNALDGGDLPVKEAEF  331

Query  228  ILASAENEEIADA  190
            +LA+AE +EI +A
Sbjct  332  VLAAAETDEIVEA  344



>ref|XP_004496776.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Cicer 
arietinum]
Length=350

 Score =   230 bits (587),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 121/134 (90%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  217  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDFVPGMKALDMNTAEDAIVRLTREV  276

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSA-SEVAAPE  232
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG  NA+DG+  S    PE
Sbjct  277  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRNNAIDGTCDSAREEPE  336

Query  231  LILASAENEEIADA  190
            L+LAS E E+  DA
Sbjct  337  LVLASVELEDTVDA  350



>ref|XP_002316981.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
 gb|ABK94930.1| unknown [Populus trichocarpa]
 gb|EEE97593.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
Length=357

 Score =   230 bits (587),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIV+LTRE+
Sbjct  225  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVKLTREV  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDG+      PEL
Sbjct  285  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGMPNALDGTFVGGIHPEL  344

Query  228  ILASAENEEIAD  193
            ILA+ E+ EIA+
Sbjct  345  ILAAVESAEIAE  356



>ref|XP_010443053.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=351

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRL+SIGMID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  219  MDPNVMEAKIVVSSCGHDGPFGATGVKRLRSIGMIDHVPGMKALDMNTAEDAIVRLTREV  278

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL
Sbjct  279  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPEL  338

Query  228  ILASAENEEIADA  190
            +LA+AE+ E  DA
Sbjct  339  VLAAAESAETVDA  351



>ref|XP_010545204.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Tarenaya 
hassleriana]
Length=359

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMN+AEDAIVRLTRE+
Sbjct  226  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPGMKALDMNSAEDAIVRLTREV  285

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNAL-DGSASEVAAPE  232
            VPGMIVTGMEVAEIDGA RMGPTFGAMMISGQKAAHLALKALG PNAL DGS      PE
Sbjct  286  VPGMIVTGMEVAEIDGAARMGPTFGAMMISGQKAAHLALKALGMPNALDDGSYLGKLHPE  345

Query  231  LILASAENEEIADA  190
            L+LA+AE+ E ADA
Sbjct  346  LVLAAAESAETADA  359



>ref|XP_011030844.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic-like 
[Populus euphratica]
Length=357

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMN AEDAIV+LTRE+
Sbjct  225  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVKLTREV  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDG+      PEL
Sbjct  285  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGMPNALDGTFVGGIHPEL  344

Query  228  ILASAENEEIAD  193
            ILA+ E+ +IA+
Sbjct  345  ILAAVESADIAE  356



>dbj|BAA88226.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMN AEDAIV+LTRE+
Sbjct  219  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVKLTREV  278

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALD   +    PEL
Sbjct  279  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VHPEL  336

Query  228  ILASAENEEIADA  190
            +LA+AE+ EIADA
Sbjct  337  VLAAAESAEIADA  349



>ref|XP_010448624.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010448632.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X2 [Camelina sativa]
Length=351

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRL+SIGMID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  219  MDPNVMEAKIVVSSCGHDGPFGATGVKRLRSIGMIDHVPGMKALDMNTAEDAIVRLTREV  278

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL
Sbjct  279  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPEL  338

Query  228  ILASAENEEIADA  190
            +LA+A++ E  DA
Sbjct  339  VLAAADSAETVDA  351



>ref|XP_003563001.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Brachypodium 
distachyon]
Length=352

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 122/136 (90%), Gaps = 3/136 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMID+VPGMKALDMN AEDAIVRLTRE+
Sbjct  217  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIDTVPGMKALDMNMAEDAIVRLTREV  276

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS---ASEVAA  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PN +DG+   A+    
Sbjct  277  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNGIDGTLKNATPALH  336

Query  237  PELILASAENEEIADA  190
            PE++LASA N ++ DA
Sbjct  337  PEMVLASANNGDVVDA  352



>ref|XP_008244366.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Prunus 
mume]
Length=360

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGP GATGVKRL+SIGMI+SVPGMKALDMN AEDAIV LTREI
Sbjct  228  MDPNVMEAKVVVSSCGHDGPMGATGVKRLRSIGMIESVPGMKALDMNAAEDAIVELTREI  287

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDGS      PEL
Sbjct  288  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGSYVGSIQPEL  347

Query  228  ILASAENEEIADA  190
            ILA+A++ EIA+A
Sbjct  348  ILAAADSAEIAEA  360



>ref|XP_008809851.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Phoenix 
dactylifera]
Length=359

 Score =   228 bits (581),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 124/134 (93%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLK IGMIDSVPGMKALDMN+AEDAIVRLTREI
Sbjct  226  MDPNVMESKVVVSSCGHDGPFGATGVKRLKDIGMIDSVPGMKALDMNSAEDAIVRLTREI  285

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS-ASEVAAPE  232
            VPGMIVTGMEVAEIDGAPRMGPTFGAMM+SGQKAAHLALK+LG PNALDG+  +E   PE
Sbjct  286  VPGMIVTGMEVAEIDGAPRMGPTFGAMMVSGQKAAHLALKSLGRPNALDGTIGAEKVHPE  345

Query  231  LILASAENEEIADA  190
            ++LAS++  ++ +A
Sbjct  346  MVLASSDGGDVVEA  359



>gb|EMT30436.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Aegilops tauschii]
Length=348

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 120/136 (88%), Gaps = 3/136 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAEDAIVRLTRE+
Sbjct  213  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIQAVPGMKALDMNTAEDAIVRLTREV  272

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---A  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PN +DG+   V     
Sbjct  273  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNGIDGTLKNVTPALH  332

Query  237  PELILASAENEEIADA  190
            PE+ILA+  N +I DA
Sbjct  333  PEMILAATNNGDIVDA  348



>ref|NP_001236824.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88228.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 122/133 (92%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMN AEDAIV LTRE+
Sbjct  219  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVELTREV  278

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALD   +    PEL
Sbjct  279  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VHPEL  336

Query  228  ILASAENEEIADA  190
            +LA+AE+ EIADA
Sbjct  337  VLAAAESAEIADA  349



>emb|CCJ09780.1| putative thiazole biosynthetic enzyme, partial [Hirudo medicinalis]
Length=242

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 121/134 (90%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMNTAEDAIVRLTREI
Sbjct  109  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPGMKALDMNTAEDAIVRLTREI  168

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ LG PN LDG+      P+L
Sbjct  169  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRTLGLPNELDGTNVGNVQPKL  228

Query  228  ILASAEN-EEIADA  190
             LA+A++  EI +A
Sbjct  229  TLAAADDGNEIVEA  242



>gb|EMS66450.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Triticum urartu]
Length=348

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 120/136 (88%), Gaps = 3/136 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAEDAIVRLTRE+
Sbjct  213  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIQAVPGMKALDMNTAEDAIVRLTREV  272

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---A  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PN +DG+   V     
Sbjct  273  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNGIDGTLKNVTPALH  332

Query  237  PELILASAENEEIADA  190
            PE+ILA+  N +I DA
Sbjct  333  PEMILAATNNGDIVDA  348



>ref|XP_003607681.1| Thiazole biosynthetic enzyme [Medicago truncatula]
 gb|AES89878.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=350

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 125/133 (94%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMNTAEDAIVRLTRE+
Sbjct  220  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGLIDTVPGMKALDMNTAEDAIVRLTREV  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNA+D + +    PEL
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNAVDHAGN--IHPEL  337

Query  228  ILASAENEEIADA  190
            +LA+A++ +IA+A
Sbjct  338  VLAAADSADIAEA  350



>gb|AFK46185.1| unknown [Medicago truncatula]
Length=350

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 125/133 (94%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMNTAEDAIVRLTRE+
Sbjct  220  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSIGLIDTVPGMKALDMNTAEDAIVRLTREV  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNA+D + +    PEL
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNAVDHAGN--IHPEL  337

Query  228  ILASAENEEIADA  190
            +LA+A++ +IA+A
Sbjct  338  VLAAADSADIAEA  350



>ref|XP_006657781.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Oryza 
brachyantha]
Length=351

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 121/136 (89%), Gaps = 3/136 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRL+ IGMID+VPGM+ALDMNTAED IVRLTRE+
Sbjct  216  MDPNVMESKVVVSSCGHDGPFGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREV  275

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS---ASEVAA  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+   A     
Sbjct  276  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAPSATH  335

Query  237  PELILASAENEEIADA  190
            PELILAS ++ E  DA
Sbjct  336  PELILASKDDGETVDA  351



>ref|XP_009388868.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=360

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 118/127 (93%), Gaps = 1/127 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLK IGMIDSVPGMKALDMN AEDAIVRLTRE+
Sbjct  226  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKGIGMIDSVPGMKALDMNAAEDAIVRLTREV  285

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSA-SEVAAPE  232
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHL LKALG PNALDG+  +E   PE
Sbjct  286  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLTLKALGRPNALDGTTRAEPLHPE  345

Query  231  LILASAE  211
            L+LASA+
Sbjct  346  LVLASAD  352



>dbj|BAC45141.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
 gb|EAZ40087.1| hypothetical protein OsJ_24530 [Oryza sativa Japonica Group]
Length=352

 Score =   226 bits (575),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 124/137 (91%), Gaps = 4/137 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+++VVSSCGHDGPFGATGVKRL+ IGMID+VPGM+ALDMNTAED IVRLTRE+
Sbjct  216  MDPNVMESRVVVSSCGHDGPFGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREV  275

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA---  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  + AA   
Sbjct  276  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAAAAAA  335

Query  237  -PELILASAENEEIADA  190
             PELILAS ++ EI DA
Sbjct  336  HPELILASKDDGEIVDA  352



>ref|NP_001059841.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAC78562.1| thiamine biosynthetic enzyme [Oryza sativa Japonica Group]
 dbj|BAF21755.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAG94352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 124/137 (91%), Gaps = 4/137 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+++VVSSCGHDGPFGATGVKRL+ IGMID+VPGM+ALDMNTAED IVRLTRE+
Sbjct  219  MDPNVMESRVVVSSCGHDGPFGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREV  278

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA---  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  + AA   
Sbjct  279  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAAAAAA  338

Query  237  -PELILASAENEEIADA  190
             PELILAS ++ EI DA
Sbjct  339  HPELILASKDDGEIVDA  355



>gb|EAZ04139.1| hypothetical protein OsI_26282 [Oryza sativa Indica Group]
Length=353

 Score =   225 bits (574),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 124/138 (90%), Gaps = 5/138 (4%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+++VVSSCGHDGPFGATGVKRL+ IGMID+VPGM+ALDMNTAED IVRLTRE+
Sbjct  216  MDPNVMESRVVVSSCGHDGPFGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREV  275

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA---  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  + AA   
Sbjct  276  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAAAAAA  335

Query  237  --PELILASAENEEIADA  190
              PELILAS ++ EI DA
Sbjct  336  AHPELILASKDDGEIVDA  353



>gb|AAZ93636.1| pathogen-induced defense-responsive protein 8 [Oryza sativa Indica 
Group]
Length=352

 Score =   225 bits (574),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 123/137 (90%), Gaps = 4/137 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME K+VVSSCGHDGPFGATGVKRL+ IGMID+VPGM+ALDMNTAED IVRLTRE+
Sbjct  216  MDPNVMEFKVVVSSCGHDGPFGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREV  275

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA---  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  + AA   
Sbjct  276  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTIKKAAAAAA  335

Query  237  -PELILASAENEEIADA  190
             PELILAS ++ EI DA
Sbjct  336  HPELILASKDDGEIVDA  352



>ref|XP_004957903.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=350

 Score =   225 bits (573),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 124/136 (91%), Gaps = 4/136 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAEDAIVRLTRE+
Sbjct  216  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDAIVRLTREV  275

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDG---SASEVAA  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG   +AS+   
Sbjct  276  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTTQTASQAWR  335

Query  237  PELILASAENEEIADA  190
             EL++AS +++E+ DA
Sbjct  336  EELVMAS-KDDEVVDA  350



>ref|XP_010485129.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=548

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRL+SIGMID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  416  MDPNVMEAKIVVSSCGHDGPFGATGVKRLRSIGMIDHVPGMKALDMNTAEDAIVRLTREV  475

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKA  LALKALG PNA+DG+     +PEL
Sbjct  476  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPEL  535

Query  228  ILASAENEEIADA  190
            +LA+A++ E  DA
Sbjct  536  VLAAADSAETVDA  548



>gb|AFK48432.1| unknown [Lotus japonicus]
Length=363

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 124/135 (92%), Gaps = 2/135 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  229  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDRVPGMKALDMNTAEDAIVRLTREV  288

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD-GSASEVAAPE  232
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL +LG PNA+D  +A+    PE
Sbjct  289  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALGSLGLPNAVDKNNAAGKIHPE  348

Query  231  LILASA-ENEEIADA  190
            L+LA+A E+ EIADA
Sbjct  349  LVLAAATESAEIADA  363



>ref|XP_004244150.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Solanum 
lycopersicum]
Length=354

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGP GATGVKRL+SIGMI+SVPGMKALDMN AEDAIVRLTRE+
Sbjct  222  MDPNVMEAKIVVSSCGHDGPMGATGVKRLRSIGMINSVPGMKALDMNAAEDAIVRLTREV  281

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNALDG+A     PEL
Sbjct  282  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNALDGTAETSVLPEL  341

Query  228  IL  223
            +L
Sbjct  342  ML  343



>ref|XP_009774029.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Nicotiana 
sylvestris]
Length=358

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGP GATGVKRLKSIGMI+ VPGMKALDMN AEDAIVRLTRE+
Sbjct  226  MDPNVMEAKIVVSSCGHDGPMGATGVKRLKSIGMINHVPGMKALDMNAAEDAIVRLTREV  285

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNALDG+A     PEL
Sbjct  286  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNALDGTAESSIHPEL  345

Query  228  IL  223
            IL
Sbjct  346  IL  347



>ref|XP_006845176.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
 gb|ERN06851.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
Length=355

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 121/134 (90%), Gaps = 1/134 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL++IGMI+SVPGMKALDMN AEDAIVRLTRE+
Sbjct  222  MDPNVMEAKVVVSSCGHDGPFGATGVKRLRNIGMIESVPGMKALDMNVAEDAIVRLTREV  281

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAA-PE  232
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNA+DG+ S     PE
Sbjct  282  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNAVDGTYSLGGVHPE  341

Query  231  LILASAENEEIADA  190
            L+LAS+   E A A
Sbjct  342  LVLASSAEGETASA  355



>ref|XP_009590342.1| PREDICTED: thiamine thiazole synthase, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158} 
[Nicotiana tomentosiformis]
Length=359

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGP GATGVKRLKSIGMI+ VPGMKALDMN AEDAIVRLTRE+
Sbjct  227  MDPNVMEAKIVVSSCGHDGPMGATGVKRLKSIGMINHVPGMKALDMNAAEDAIVRLTREV  286

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNALDG+A     PEL
Sbjct  287  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNALDGTAESSIHPEL  346

Query  228  IL  223
            IL
Sbjct  347  IL  348



>ref|XP_006360084.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Solanum 
tuberosum]
Length=357

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGP GATGVKRL+SIGMI+SVPGMKALDMN AEDAIVRLTRE+
Sbjct  225  MDPNVMEAKVVVSSCGHDGPMGATGVKRLRSIGMINSVPGMKALDMNAAEDAIVRLTREV  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNALDG+A     PEL
Sbjct  285  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNALDGTAETSILPEL  344

Query  228  IL  223
            +L
Sbjct  345  ML  346



>ref|XP_004965741.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=351

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 122/136 (90%), Gaps = 4/136 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+
Sbjct  217  MDPNVMEAKIVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREV  276

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSAS---EVAA  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+A    +V  
Sbjct  277  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAIDGTAQTVPQVWR  336

Query  237  PELILASAENEEIADA  190
             E ++AS +++E+ DA
Sbjct  337  EEFVIAS-KDDEVVDA  351



>ref|XP_010670817.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 120/133 (90%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI SVPGM ALDMN+AEDAIVRLTRE+
Sbjct  222  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIKSVPGMSALDMNSAEDAIVRLTREV  281

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMM+SGQKAAHLAL++LG  NALDG  S+   PEL
Sbjct  282  VPGMIVTGMEVAEIDGAPRMGPTFGAMMLSGQKAAHLALRSLGLDNALDG--SDNLQPEL  339

Query  228  ILASAENEEIADA  190
             LASAE+ E+ DA
Sbjct  340  QLASAESSEVVDA  352



>gb|ACF85447.1| unknown [Zea mays]
Length=143

 Score =   215 bits (547),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 121/136 (89%), Gaps = 4/136 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMN AED IVRLTRE+
Sbjct  9    MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLTREV  68

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---A  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  EV+    
Sbjct  69   VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPEVSPALR  128

Query  237  PELILASAENEEIADA  190
             E ++AS +++E+ DA
Sbjct  129  EEFVIAS-KDDEVVDA  143



>gb|AAP03875.1| putative chloroplast thiazole biosynthetic protein [Nicotiana 
tabacum]
Length=358

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGP GATGVKRLKSIGMI+ VPGMKAL+MN AEDAIVRLTRE+
Sbjct  226  MDPNVMEAKIVVSSCGHDGPMGATGVKRLKSIGMINHVPGMKALNMNAAEDAIVRLTREV  285

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNALDG+A     PEL
Sbjct  286  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRALGLPNALDGTAESSIHPEL  345

Query  228  IL  223
            IL
Sbjct  346  IL  347



>ref|XP_002281769.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Vitis 
vinifera]
 sp|F6H9A9.1|THI41_VITVI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Vitis vinifera]
Length=353

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+S+GMIDSVPGMKALDMNTAED IVRLTRE+
Sbjct  220  MDPNVMEAKVVVSSCGHDGPFGATGVKRLRSVGMIDSVPGMKALDMNTAEDEIVRLTREV  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDG+      PEL
Sbjct  280  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGTYIGNLHPEL  339

Query  228  IL  223
            +L
Sbjct  340  VL  341



>ref|XP_001767495.1| predicted protein [Physcomitrella patens]
 sp|A9SMC8.1|THI44_PHYPA RecName: Full=Thiamine thiazole synthase 4, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 4; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67630.1| predicted protein [Physcomitrella patens]
Length=343

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ TRE+
Sbjct  212  MDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHTREV  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PN LDG+      PEL
Sbjct  272  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNELDGNYKLNVHPEL  331

Query  228  ILASAENE  205
            +LAS ++E
Sbjct  332  VLASTDDE  339



>ref|XP_010670818.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 120/133 (90%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI SVPGM ALDMN+AEDAIVRLTRE+
Sbjct  222  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIKSVPGMSALDMNSAEDAIVRLTREV  281

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMM+SGQKAAHLAL++LG  NALDG  S+   PEL
Sbjct  282  VPGMIVTGMEVAEIDGAPRMGPTFGAMMLSGQKAAHLALRSLGLDNALDG--SDNLQPEL  339

Query  228  ILASAENEEIADA  190
             LASAE+ E+ DA
Sbjct  340  QLASAESSEVVDA  352



>gb|ACF85034.1| unknown [Zea mays]
Length=307

 Score =   219 bits (559),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 120/133 (90%), Gaps = 1/133 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+
Sbjct  176  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREV  235

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+ S     EL
Sbjct  236  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTMSPPLREEL  295

Query  228  ILASAENEEIADA  190
            ++A  +++E+ DA
Sbjct  296  MIAY-KDDEVVDA  307



>ref|XP_001753819.1| predicted protein [Physcomitrella patens]
 sp|A9RHX1.1|THI41_PHYPA RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81571.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ TRE+
Sbjct  226  MDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHTREV  285

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PN LDG+      PEL
Sbjct  286  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNELDGNYKPNVHPEL  345

Query  228  ILASAENE  205
            +LAS ++E
Sbjct  346  VLASTDDE  353



>gb|KHN46540.1| Thiamine thiazole synthase 2, chloroplastic [Glycine soja]
Length=178

 Score =   215 bits (547),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMN AEDAIVRLTRE+
Sbjct  48   MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVRLTREV  107

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALD   +    PEL
Sbjct  108  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VHPEL  165

Query  228  IL  223
            +L
Sbjct  166  VL  167



>ref|XP_001767548.1| predicted protein [Physcomitrella patens]
 sp|A9SME1.1|THI42_PHYPA RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67683.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   221 bits (562),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ TRE+
Sbjct  225  MDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHTREV  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PN LDG+      PEL
Sbjct  285  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNELDGNYKPNVHPEL  344

Query  228  ILASAENE  205
            +LAS ++E
Sbjct  345  VLASTDDE  352



>ref|XP_004294348.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=361

 Score =   221 bits (562),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGP GATGVKRL+S+GMIDSVPGMKALDMN AEDAIV+LTREI
Sbjct  228  MDPNVMEAKVVVSSCGHDGPMGATGVKRLRSVGMIDSVPGMKALDMNAAEDAIVKLTREI  287

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALDGS      PEL
Sbjct  288  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQPEL  347

Query  228  IL  223
            IL
Sbjct  348  IL  349



>ref|XP_009378870.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGP GATGVKRL+S+GMI+SVPGMKALDMNTAEDAIV+LTREI
Sbjct  227  MDPNVMEAKVVVSSCGHDGPMGATGVKRLRSVGMIESVPGMKALDMNTAEDAIVKLTREI  286

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALDGS      PEL
Sbjct  287  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQPEL  346

Query  228  IL  223
            IL
Sbjct  347  IL  348



>ref|NP_001105696.1| thiamine thiazole synthase 1, chloroplastic precursor [Zea mays]
 sp|Q41738.1|THI41_MAIZE RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Zea mays]
 gb|AAA96738.1| thiamine biosynthetic enzyme [Zea mays]
 gb|ACF86401.1| unknown [Zea mays]
 gb|AFW83048.1| thiazole biosynthetic enzyme 1-1, Precursor [Zea mays]
Length=354

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 120/133 (90%), Gaps = 1/133 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+
Sbjct  223  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREV  282

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+ S     EL
Sbjct  283  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTMSPPLREEL  342

Query  228  ILASAENEEIADA  190
            ++A  +++E+ DA
Sbjct  343  MIAY-KDDEVVDA  354



>gb|AGT17015.1| thiazole biosynthetic enzyme [Saccharum hybrid cultivar R570]
Length=355

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 122/136 (90%), Gaps = 4/136 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+
Sbjct  221  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREV  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---A  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V+    
Sbjct  281  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSPALR  340

Query  237  PELILASAENEEIADA  190
             E ++AS +++E+ DA
Sbjct  341  EEFVIAS-KDDEVVDA  355



>gb|AGT16062.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 122/136 (90%), Gaps = 4/136 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+
Sbjct  221  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREV  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---A  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V+    
Sbjct  281  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSPALR  340

Query  237  PELILASAENEEIADA  190
             E ++AS +++E+ DA
Sbjct  341  EEFVIAS-KDDEVVDA  355



>gb|AGT16507.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 122/136 (90%), Gaps = 4/136 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+
Sbjct  221  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREV  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---A  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V+    
Sbjct  281  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSPALR  340

Query  237  PELILASAENEEIADA  190
             E ++AS +++E+ DA
Sbjct  341  EEFVIAS-KDDEVVDA  355



>ref|XP_004294669.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=360

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGP GATGVKRL+S+GMI+SVPGMKALDMN AEDAIV+LTREI
Sbjct  227  MDPNVMEAKVVVSSCGHDGPMGATGVKRLRSVGMIESVPGMKALDMNAAEDAIVKLTREI  286

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALDGS      PEL
Sbjct  287  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQPEL  346

Query  228  IL  223
            IL
Sbjct  347  IL  348



>ref|XP_009358110.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGP GATGVKRL+S+GMI+SVPGMKALDMN AEDAIV+LTREI
Sbjct  227  MDPNVMEAKVVVSSCGHDGPMGATGVKRLRSVGMIESVPGMKALDMNAAEDAIVKLTREI  286

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALDGS      PEL
Sbjct  287  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQPEL  346

Query  228  IL  223
            IL
Sbjct  347  IL  348



>ref|XP_001755171.1| predicted protein [Physcomitrella patens]
 gb|EDQ80115.1| predicted protein [Physcomitrella patens]
Length=358

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ TREI
Sbjct  227  MDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHTREI  286

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PN +DG+      PEL
Sbjct  287  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGLPNEVDGNYKPNVHPEL  346

Query  228  ILASAEN  208
            +LAS ++
Sbjct  347  VLASTDD  353



>gb|AGT15954.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16278.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16833.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT17116.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 122/136 (90%), Gaps = 4/136 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+
Sbjct  221  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREV  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---A  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V+    
Sbjct  281  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSPALR  340

Query  237  PELILASAENEEIADA  190
             E ++AS +++E+ DA
Sbjct  341  EEFVIAS-KDDEVVDA  355



>gb|AGT16846.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16900.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 122/136 (90%), Gaps = 4/136 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+
Sbjct  221  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREV  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---A  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V+    
Sbjct  281  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSPALR  340

Query  237  PELILASAENEEIADA  190
             E ++AS +++E+ DA
Sbjct  341  EEFVIAS-KDDEVVDA  355



>ref|XP_002463222.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
 sp|C5X2M4.1|THI42_SORBI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Sorghum bicolor]
 gb|EER99743.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
Length=352

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 6/137 (4%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI  VPGMKALDMNTAED IVRLTRE+
Sbjct  218  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISDVPGMKALDMNTAEDEIVRLTREV  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAP--  235
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V +P  
Sbjct  278  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTI-KVVSPAL  336

Query  234  --ELILASAENEEIADA  190
              E ++AS +++E+ DA
Sbjct  337  RQEFVIAS-KDDEVVDA  352



>gb|ACF87708.1| unknown [Zea mays]
 gb|ACN36053.1| unknown [Zea mays]
 tpg|DAA58589.1| TPA: thiazole biosynthetic enzyme 1-2, Precursor [Zea mays]
Length=355

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 121/136 (89%), Gaps = 4/136 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMN AED IVRLTRE+
Sbjct  221  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLTREV  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---A  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  EV+    
Sbjct  281  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPEVSPALR  340

Query  237  PELILASAENEEIADA  190
             E ++AS +++E+ DA
Sbjct  341  EEFVIAS-KDDEVVDA  355



>ref|XP_002458014.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
 sp|C5XNN6.1|THI41_SORBI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Sorghum bicolor]
 gb|EES03134.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
Length=354

 Score =   218 bits (555),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 122/136 (90%), Gaps = 4/136 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMN AEDAIVRLTRE+
Sbjct  220  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIAAVPGMKALDMNAAEDAIVRLTREV  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---A  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  +V+    
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPKVSPALR  339

Query  237  PELILASAENEEIADA  190
             E ++AS +++E+ DA
Sbjct  340  EEFVIAS-KDDEVVDA  354



>ref|NP_001105697.1| thiamine thiazole synthase 2, chloroplastic precursor [Zea mays]
 sp|Q41739.1|THI42_MAIZE RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Zea mays]
 gb|AAA96739.1| thiamine biosynthetic enzyme [Zea mays]
Length=354

 Score =   218 bits (555),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 121/136 (89%), Gaps = 4/136 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMN AED IVRLTRE+
Sbjct  220  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLTREV  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---A  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNA+DG+  EV+    
Sbjct  280  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTIPEVSPALR  339

Query  237  PELILASAENEEIADA  190
             E ++AS +++E+ DA
Sbjct  340  EEFVIAS-KDDEVVDA  354



>gb|EYU19221.1| hypothetical protein MIMGU_mgv1a009132mg [Erythranthe guttata]
Length=352

 Score =   218 bits (554),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 120/133 (90%), Gaps = 5/133 (4%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI
Sbjct  225  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH+AL++LG  N + GS      PE+
Sbjct  285  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHIALQSLGLANNV-GSIH----PEM  339

Query  228  ILASAENEEIADA  190
            +LA+ ++ EI DA
Sbjct  340  VLAAVDDAEILDA  352



>ref|NP_001236812.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88227.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMN AEDAIVRLTRE+
Sbjct  215  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVRLTREV  274

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALD   +    PEL
Sbjct  275  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VHPEL  332

Query  228  IL  223
            +L
Sbjct  333  VL  334



>dbj|BAA88225.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMN AEDAIVRLTRE+
Sbjct  215  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNKAEDAIVRLTREV  274

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNALD   +    PEL
Sbjct  275  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALDSVGN--VHPEL  332

Query  228  IL  223
            +L
Sbjct  333  VL  334



>ref|XP_001753698.1| predicted protein [Physcomitrella patens]
 ref|XP_001753700.1| predicted protein [Physcomitrella patens]
 sp|A9RHW6.1|THI43_PHYPA RecName: Full=Thiamine thiazole synthase 3, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 3; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81450.1| predicted protein [Physcomitrella patens]
 gb|EDQ81452.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+SIGMI+SVPGMK LDMN AEDAIV+ TRE+
Sbjct  226  MDPNVMEAKVVVSSCGHDGPFGATGVKRLRSIGMIESVPGMKCLDMNAAEDAIVKHTREV  285

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLAL+ALG PN +DG+      PEL
Sbjct  286  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALRALGLPNEVDGNYKPNVHPEL  345

Query  228  ILASAEN  208
            +LAS ++
Sbjct  346  VLASTDD  352



>ref|XP_010930933.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase 1, 
chloroplastic-like [Elaeis guineensis]
Length=358

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 1/128 (1%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNV+EAK+VVSS GHDGPFGATGVKRLK IGMIDSVPGMKA+DMN AEDAIVRLT+EI
Sbjct  224  MDPNVVEAKVVVSSYGHDGPFGATGVKRLKDIGMIDSVPGMKAVDMNAAEDAIVRLTKEI  283

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS-ASEVAAPE  232
            VPGMI+TGME AEIDGAPRMGPTFGAMMISGQKAAHLALKALG PNALDG+  +E   PE
Sbjct  284  VPGMIITGMEDAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNALDGTIGTEKVQPE  343

Query  231  LILASAEN  208
            ++LAS+++
Sbjct  344  MVLASSDD  351



>ref|XP_010670808.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=352

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 117/133 (88%), Gaps = 2/133 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI SVPGM ALDMN+AEDAIVRLTRE+
Sbjct  222  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMIKSVPGMSALDMNSAEDAIVRLTREV  281

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMM+SGQKAAHLAL++ G  NALD   S+   PEL
Sbjct  282  VPGMIVTGMEVAEIDGAPRMGPTFGAMMLSGQKAAHLALRSFGLDNALD--RSDNLQPEL  339

Query  228  ILASAENEEIADA  190
             LAS E+ E+ DA
Sbjct  340  QLASVEDAEVVDA  352



>gb|EPS63028.1| thiazole biosynthetic enzyme, chloroplastic, partial [Genlisea 
aurea]
Length=291

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMI +VPGMKALDMN AEDAIVRLTRE+
Sbjct  169  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIQNVPGMKALDMNQAEDAIVRLTREV  228

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAM+ISGQKAAHLALK+L  PNA+D + S +  PEL
Sbjct  229  VPGMIVTGMEVAEIDGAPRMGPTFGAMIISGQKAAHLALKSLNLPNAIDQNHSPLPFPEL  288

Query  228  I  226
            +
Sbjct  289  V  289



>pdb|1RP0|A Chain A, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
 pdb|1RP0|B Chain B, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
Length=284

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/111 (94%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMID VPGMKALDMNTAEDAIVRLTRE+
Sbjct  173  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREV  232

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGS  256
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALKALG PNA+DG+
Sbjct  233  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGT  283



>gb|AFO59577.1| thiamine biosynthetic enzyme [Saccharum hybrid cultivar GT28]
Length=355

 Score =   215 bits (548),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 121/136 (89%), Gaps = 4/136 (3%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVR TRE+
Sbjct  221  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRHTREV  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVA---A  238
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+ALG PNA+DG+  +V+    
Sbjct  281  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALQALGRPNAVDGTIPKVSPALR  340

Query  237  PELILASAENEEIADA  190
             E ++AS +++E+ DA
Sbjct  341  EEFVIAS-KDDEVVDA  355



>gb|AHA84206.1| thiamin biosynthetic enzyme [Phaseolus vulgaris]
Length=348

 Score =   215 bits (547),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMN AEDAIVRLTREI
Sbjct  217  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPGMKALDMNKAEDAIVRLTREI  276

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNAL+   +    PEL
Sbjct  277  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALESVGN--VHPEL  334

Query  228  IL  223
            +L
Sbjct  335  VL  336



>ref|XP_007132954.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
 gb|ESW04948.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
Length=348

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 113/122 (93%), Gaps = 2/122 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLTREI
Sbjct  217  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLTREI  276

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL++LG PNAL+   +    PEL
Sbjct  277  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALRSLGLPNALESVGN--VHPEL  334

Query  228  IL  223
            +L
Sbjct  335  VL  336



>ref|XP_004152916.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004172748.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56149.1| hypothetical protein Csa_3G078800 [Cucumis sativus]
Length=359

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVR TRE+
Sbjct  221  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRFTREV  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNAL  265
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LGE N++
Sbjct  281  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGEANSI  328



>ref|XP_008463440.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Cucumis 
melo]
Length=359

 Score =   213 bits (543),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+IDSVPGMKALDMNTAEDAIVR TRE+
Sbjct  221  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDSVPGMKALDMNTAEDAIVRFTREV  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDG  259
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LGE N++ G
Sbjct  281  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGEANSIGG  330



>ref|XP_008366026.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic 
[Malus domestica]
Length=378

 Score =   213 bits (542),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGP GATGVKRL+S+GMI+SVPGMKALDMN AEDAIV+LTREI
Sbjct  227  MDPNVMEAKVVVSSCGHDGPMGATGVKRLRSVGMIESVPGMKALDMNAAEDAIVKLTREI  286

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIVTGMEVAEIDG+PRMGPTFGAMMISGQKAAHLALKALG PNALD S         
Sbjct  287  VPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGXPNALDESYVGGXXXXX  346

Query  228  ILASAENEEIA  196
            I  +  + EIA
Sbjct  347  IJXAXXSAEIA  357



>emb|CBI23938.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  561  IVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGM  382
            +VVSSCGHDGPFGATGVKRL+S+GMIDSVPGMKALDMNTAED IVRLTRE+VPGMIVTGM
Sbjct  88   VVVSSCGHDGPFGATGVKRLRSVGMIDSVPGMKALDMNTAEDEIVRLTREVVPGMIVTGM  147

Query  381  EVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELIL  223
            EVAEIDG+PRMGPTFGAMMISGQKAAHLALK+LG PNALDG+      PEL+L
Sbjct  148  EVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGTYIGNLHPELVL  200



>gb|AFW83047.1| hypothetical protein ZEAMMB73_797739 [Zea mays]
Length=384

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 120/163 (74%), Gaps = 31/163 (19%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL+ IGMI +VPGMKALDMNTAED IVRLTRE+
Sbjct  223  MDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREV  282

Query  408  VPGMIVTGMEVAEIDGAPRM------------------------------GPTFGAMMIS  319
            VPGMIVTGMEVAEIDGAPRM                              GPTFGAMMIS
Sbjct  283  VPGMIVTGMEVAEIDGAPRMVSSEEDNTHVIAILTESMRNMSKIVCWLLQGPTFGAMMIS  342

Query  318  GQKAAHLALKALGEPNALDGSASEVAAPELILASAENEEIADA  190
            GQKAAHLALKALG PNA+DG+ S     EL++A  +++E+ DA
Sbjct  343  GQKAAHLALKALGRPNAVDGTMSPPLREELMIAY-KDDEVVDA  384



>gb|KDO47270.1| hypothetical protein CISIN_1g039605mg [Citrus sinensis]
Length=352

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 111/133 (83%), Gaps = 12/133 (9%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGV+            GMKALDMNTAEDAIV+LTREI
Sbjct  232  MDPNVMEAKVVVSSCGHDGPFGATGVR------------GMKALDMNTAEDAIVKLTREI  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIV GMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNA+DG+      PEL
Sbjct  280  VPGMIVAGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNAMDGTYVGSIHPEL  339

Query  228  ILASAENEEIADA  190
            +LA++   EIADA
Sbjct  340  VLAASSPAEIADA  352



>ref|XP_006441062.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
 gb|ESR54302.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
Length=353

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 111/133 (83%), Gaps = 11/133 (8%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATG           SVPGMKALDMNTAEDAIV+LTREI
Sbjct  232  MDPNVMEAKVVVSSCGHDGPFGATG-----------SVPGMKALDMNTAEDAIVKLTREI  280

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
            VPGMIV GMEVAEIDGA RMGPTFGAMMISGQKAAHLALK+LG+PNA+DG+      PEL
Sbjct  281  VPGMIVAGMEVAEIDGALRMGPTFGAMMISGQKAAHLALKSLGQPNAMDGTYVGSIHPEL  340

Query  228  ILASAENEEIADA  190
            +LA++   EIADA
Sbjct  341  VLAASSPAEIADA  353



>gb|AHN11672.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11673.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11675.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11676.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11682.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11683.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11684.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11686.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11687.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11694.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11695.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11698.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11699.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11706.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11707.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11710.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11712.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11717.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11718.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11719.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11720.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11721.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11722.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11730.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11731.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11732.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11734.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11740.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11742.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11743.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11744.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11749.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11751.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11752.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11756.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=142

 Score =   191 bits (486),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMN AEDAIVRLTREI
Sbjct  47   MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPGMKALDMNKAEDAIVRLTREI  106

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  301
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH
Sbjct  107  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  142



>gb|AHN11665.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11666.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11667.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11668.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11669.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11670.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11671.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11674.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11677.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11678.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11679.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11680.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11681.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11685.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11688.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11689.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11690.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11692.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11693.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11696.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11697.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11700.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11701.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11702.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11703.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11704.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11705.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11709.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11711.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11713.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11714.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11715.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11716.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11723.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11724.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11725.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11726.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11727.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11728.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11729.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11733.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11735.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11736.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11737.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11738.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11739.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11741.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11745.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11746.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11747.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11748.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11750.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11753.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11754.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11755.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AHN11757.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=142

 Score =   190 bits (483),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLTREI
Sbjct  47   MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLTREI  106

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  301
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH
Sbjct  107  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  142



>emb|CAB64776.1| thiazole biosynthetic enzyme [Brassica juncea]
Length=134

 Score =   190 bits (482),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIG+ID VPGMKALDMNT EDAIVRLTRE+
Sbjct  8    MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGLIDHVPGMKALDMNTVEDAIVRLTREV  67

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
               MIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL +PN +DGS     +PEL
Sbjct  68   DLDMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALAQPNVIDGSYVGELSPEL  127

Query  228  ILASAEN  208
            +LA+ ++
Sbjct  128  VLAAPDS  134



>gb|AHN11691.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=142

 Score =   188 bits (478),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLTREI
Sbjct  47   MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLTREI  106

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  301
            VPGMIVTGMEVAEIDG PRMGPTFGAMMISGQKAAH
Sbjct  107  VPGMIVTGMEVAEIDGGPRMGPTFGAMMISGQKAAH  142



>gb|AGZ80417.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80423.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80424.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80426.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80427.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80429.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80430.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=145

 Score =   188 bits (477),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VPGMKALDMN AEDAIVRLTREI
Sbjct  51   MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPGMKALDMNKAEDAIVRLTREI  110

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  304
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA
Sbjct  111  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  145



>gb|AGZ80414.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80415.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80416.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80418.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80419.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80420.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80421.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80425.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80428.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80431.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80432.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80433.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80434.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
 gb|AGZ80435.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=145

 Score =   187 bits (475),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLTREI
Sbjct  51   MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLTREI  110

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  304
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA
Sbjct  111  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  145



>gb|AHN11708.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=142

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMID+VP MKALDMN AEDAIVRLTREI
Sbjct  47   MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPRMKALDMNKAEDAIVRLTREI  106

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  301
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMIS QKAAH
Sbjct  107  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISXQKAAH  142



>gb|AGZ80422.1| thiamin biosynthetic enzyme, partial [Phaseolus vulgaris]
Length=145

 Score =   185 bits (470),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIG+ID+VPGMKALDMN AEDAIVRLTREI
Sbjct  51   MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGLIDNVPGMKALDMNKAEDAIVRLTREI  110

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  304
            VPGMIVTGMEVAEIDG PRMGPTFGAMMISGQKAA
Sbjct  111  VPGMIVTGMEVAEIDGGPRMGPTFGAMMISGQKAA  145



>gb|KDO52969.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=321

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLTRE+
Sbjct  224  MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREV  283

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHL  298
            VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA +
Sbjct  284  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAARM  320



>gb|KFH67165.1| thiazole biosynthetic enzyme, chloroplastic [Mortierella verticillata 
NRRL 6337]
Length=307

 Score =   178 bits (451),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNV+EAK+VVSS GHDGP GA+GVKRL+ IG+I +VPGM ALDMN AED IVR TRE+
Sbjct  198  MDPNVIEAKVVVSSTGHDGPMGASGVKRLQKIGLIKNVPGMIALDMNAAEDGIVRNTREV  257

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  262
            VPGM++TGMEVAE+DG PRMGPTFGAMM+SGQKAAH ALK+LG  N LD
Sbjct  258  VPGMVITGMEVAELDGCPRMGPTFGAMMLSGQKAAHCALKSLGLANVLD  306



>ref|XP_005648929.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
 gb|EIE24385.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 100/126 (79%), Gaps = 3/126 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNV+E K++VSS GHDGP GA+GVKRL+ +GM+  VPGM ALDMNTAEDA+VR TRE+
Sbjct  192  MDPNVLECKVMVSSTGHDGPMGASGVKRLQRLGMVTGVPGMAALDMNTAEDAVVRNTREV  251

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDG---SASEVAA  238
            VPGM++ GMEVAE+DG PRMGPTFGAM +SGQKAAH AL +L   NALD    S   V A
Sbjct  252  VPGMVICGMEVAELDGCPRMGPTFGAMFMSGQKAAHCALNSLRRQNALDKDVPSRVAVPA  311

Query  237  PELILA  220
            PEL  A
Sbjct  312  PELTKA  317



>ref|XP_009844134.1| thiazole biosynthesis enzyme, variant 2 [Aphanomyces astaci]
 gb|ETV66359.1| thiazole biosynthesis enzyme, variant 2 [Aphanomyces astaci]
Length=270

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME K+++S+CGHDGP GA+GVKRL++IGM+D +PGM  LDM  AEDAIV+ T+EI
Sbjct  148  MDPNVMEGKVLISACGHDGPMGASGVKRLQNIGMVDHIPGMGCLDMGAAEDAIVKGTQEI  207

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  262
            VPGMIV GMEVAE++GAPRMGPTFG MMISGQKAAHLAL++LG  + LD
Sbjct  208  VPGMIVCGMEVAELEGAPRMGPTFGGMMISGQKAAHLALESLGIKSHLD  256



>gb|ABR01228.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01230.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01236.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
Length=340

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNV+EAK++VSSCGHDGP GA GVKRL  +GM+++ PGM ALDMN+AEDA+V  TREI
Sbjct  216  MDPNVIEAKVMVSSCGHDGPMGAAGVKRLAKLGMVEATPGMGALDMNSAEDAVVDRTREI  275

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASE  247
            VPGM++ GMEVAE+DG PRMGPTFGAM +SGQKAAH+AL +L     L+ +A E
Sbjct  276  VPGMVICGMEVAELDGCPRMGPTFGAMFMSGQKAAHVALNSLRRQQELEAAAKE  329



>ref|XP_008877253.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
 ref|XP_008877254.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94050.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94051.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
Length=333

 Score =   171 bits (432),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+++S+CGHDGP GA+GVKRL++IGM+D +PGM  LDM  AEDAIV+ T+EI
Sbjct  211  MDPNVMESKVLISACGHDGPMGASGVKRLQNIGMVDHIPGMGCLDMAAAEDAIVKGTQEI  270

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  262
            VPGMIV GMEVAE++GAPRMGPTFG MMISGQKAAHLAL++LG  + LD
Sbjct  271  VPGMIVAGMEVAELEGAPRMGPTFGGMMISGQKAAHLALESLGIKSHLD  319



>ref|XP_009844132.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 ref|XP_009844133.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
 gb|ETV66357.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 gb|ETV66358.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
Length=333

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME K+++S+CGHDGP GA+GVKRL++IGM+D +PGM  LDM  AEDAIV+ T+EI
Sbjct  211  MDPNVMEGKVLISACGHDGPMGASGVKRLQNIGMVDHIPGMGCLDMGAAEDAIVKGTQEI  270

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  262
            VPGMIV GMEVAE++GAPRMGPTFG MMISGQKAAHLAL++LG  + LD
Sbjct  271  VPGMIVCGMEVAELEGAPRMGPTFGGMMISGQKAAHLALESLGIKSHLD  319



>ref|XP_008616182.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
 gb|EQC30329.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
Length=334

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME K+++S+CGHDGP GA+GVKRL++IGM++++PGM  LDM  AEDAIV  T+EI
Sbjct  212  MDPNVMEGKVLISACGHDGPMGASGVKRLQNIGMVENIPGMGPLDMGAAEDAIVAGTKEI  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAP  235
            VPGMIV GMEVAE+DGAPRMGPTFG MMISGQKAAHLAL+ALG  + ++ + S   +P
Sbjct  272  VPGMIVAGMEVAELDGAPRMGPTFGGMMISGQKAAHLALEALGIKSHINPNMSFAMSP  329



>gb|KDO30626.1| hypothetical protein SPRG_04526 [Saprolegnia parasitica CBS 223.65]
Length=334

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME K+++S+CGHDGP GA+GVKRL++IGM++++PGM  LDM  AEDAIV  T+EI
Sbjct  212  MDPNVMEGKVLISACGHDGPMGASGVKRLQNIGMVENIPGMGPLDMGAAEDAIVAGTKEI  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAP  235
            VPGMIV GMEVAE+DGAPRMGPTFG MMISGQKAAHLAL+ALG  + ++ + S   +P
Sbjct  272  VPGMIVAGMEVAELDGAPRMGPTFGGMMISGQKAAHLALEALGIKSHINPNMSFAMSP  329



>ref|XP_006388786.1| hypothetical protein POPTR_0101s00250g [Populus trichocarpa]
 gb|ERP47700.1| hypothetical protein POPTR_0101s00250g [Populus trichocarpa]
Length=116

 Score =   159 bits (403),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 92/124 (74%), Gaps = 24/124 (19%)
 Frame = -2

Query  585  DPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREIV  406
            DPNVMEAK+VV SCGHDGPFGA GVKRLKSIGMIDSVPGMKALDMN AEDAIVRLTREIV
Sbjct  10   DPNVMEAKVVVGSCGHDGPFGAAGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREIV  69

Query  405  PGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPELI  226
            PGMIVTGME                      KAAHLALK LG+PNA DG+ S    PEL+
Sbjct  70   PGMIVTGME----------------------KAAHLALKDLGQPNAQDGTFS--LQPELV  105

Query  225  LASA  214
            LA+A
Sbjct  106  LAAA  109



>ref|XP_005847930.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
 gb|EFN55828.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
Length=300

 Score =   164 bits (415),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNV+EAK++VSSCGHDGP GA GVKRL  +GM++  PGM ALDMN+AEDA+V  TREI
Sbjct  174  MDPNVIEAKVMVSSCGHDGPMGAAGVKRLARLGMVEKTPGMGALDMNSAEDAVVDRTREI  233

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPGM++ GMEVAE+DG PRMGPTFGAM +SGQKAAH+AL +L
Sbjct  234  VPGMVICGMEVAELDGCPRMGPTFGAMFMSGQKAAHVALNSL  275



>gb|ABW74129.1| thiamin biosynthetic enzyme, partial [Mucor racemosus]
Length=145

 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK++VS  GHDGP GA+GVKRL+SIG+I+   GM +LDMN AED IV+ TRE+
Sbjct  31   MDPNVMEAKVIVSGTGHDGPMGASGVKRLESIGLIEGNKGMLSLDMNAAEDDIVKYTREV  90

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA+ A  +L
Sbjct  91   VPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAAYAARASL  132



>emb|CDM85402.1| unnamed protein product [Triticum aestivum]
Length=338

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 93/113 (82%), Gaps = 4/113 (4%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATG--VKRLKSIGMIDSVP--GMKALDMNTAEDAIVRL  421
            MD NVMEAKIVVSSCGH+G F A G  VKRL+ IGMI +VP  GM+ALD N +EDAIV L
Sbjct  220  MDANVMEAKIVVSSCGHEGLFSANGKGVKRLEDIGMIKTVPRTGMEALDTNVSEDAIVGL  279

Query  420  TREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  262
            TRE+VPGMIV G+EVAEIDG  RM PTFGA +ISGQKAAHLALKALG PN +D
Sbjct  280  TREVVPGMIVAGIEVAEIDGPQRMCPTFGATIISGQKAAHLALKALGRPNGID  332



>ref|XP_004496859.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=360

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            M+P+ MEAK+VVSSCGHDGPFGA G+K L+ +GMID V G+ +LDMNT+E A VRLT+EI
Sbjct  252  MNPHAMEAKVVVSSCGHDGPFGANGLKMLERVGMIDFVRGINSLDMNTSEHAFVRLTKEI  311

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALD  262
            VPGMI+TGMEVAE+ G PR+G  FGAMMISGQK AHLAL  L + NA++
Sbjct  312  VPGMIITGMEVAEMYGTPRVGLIFGAMMISGQKTAHLALMTLEKNNAIN  360



>gb|KIY99977.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=359

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNV+EAK+VVS+CGHDGP GA  VKRL  +GM+D +PGM ALDMN AED IV  TRE+
Sbjct  235  MDPNVLEAKVVVSTCGHDGPMGAHSVKRLAKLGMVDEIPGMAALDMNAAEDRIVANTREV  294

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPGM++ GME++EIDG+PRMGPTFGAM +SGQKAAH+AL  L
Sbjct  295  VPGMVLAGMELSEIDGSPRMGPTFGAMFVSGQKAAHVALGVL  336



>gb|KIY92671.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=351

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNV+EAK+VVS+CGHDGP GA  VKRL  +GM+D +PGM ALDMN AED IV  TRE+
Sbjct  226  MDPNVLEAKVVVSTCGHDGPMGAHSVKRLAKLGMVDEIPGMAALDMNAAEDRIVANTREV  285

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPGM++ GME++EIDG+PRMGPTFGAM +SGQKAAH+AL  L
Sbjct  286  VPGMVLAGMELSEIDGSPRMGPTFGAMFVSGQKAAHVALGVL  327



>emb|CEP18429.1| hypothetical protein [Parasitella parasitica]
Length=309

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVS  GHDGP GA+GVKRL+SIG+I    GM +LDMN AED IV+ TRE+
Sbjct  195  MDPNVMEAKVVVSGTGHDGPMGASGVKRLESIGLIKENKGMLSLDMNAAEDDIVKYTREV  254

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA+ A  +L
Sbjct  255  VPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAAYAARASL  296



>gb|EPB86412.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK++VS  GHDGP GA+GVKRL+SIG+I+   GM +LDMN AED IV+ TRE+
Sbjct  196  MDPNVMEAKVIVSGTGHDGPMGASGVKRLESIGLIEGNKGMLSLDMNAAEDDIVKYTREV  255

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA+ A  +L
Sbjct  256  VPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAAYAARASL  297



>dbj|GAN03507.1| thiamin biosynthetic enzyme [Mucor ambiguus]
Length=313

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK++VS  GHDGP GA+GVKRL+SIG+I+   GM +LDMN AED IV+ TRE+
Sbjct  198  MDPNVMEAKVIVSGTGHDGPMGASGVKRLESIGLIEGNKGMLSLDMNAAEDDIVKYTREV  257

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA+ A  +L
Sbjct  258  VPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAAYAARASL  299



>gb|EIE83081.1| thiazole biosynthetic enzyme, chloroplastic [Rhizopus delemar 
RA 99-880]
Length=305

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNV+EAK++VS  GHDGP GA+GVKRL+SIG+ID   GM +LDMN AED IVR TRE+
Sbjct  191  MDPNVIEAKVIVSGTGHDGPMGASGVKRLESIGLIDQKKGMLSLDMNAAEDDIVRYTREV  250

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  304
            VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA
Sbjct  251  VPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAA  285



>gb|EPB91714.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNV+EAK+VVS  GHDGP GA+GVKRL++IG+ID   GM +LDMN AED IV+ TRE+
Sbjct  196  MDPNVVEAKVVVSGTGHDGPMGASGVKRLEAIGLIDEKKGMLSLDMNAAEDDIVKYTREV  255

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAH  301
            VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA+
Sbjct  256  VPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAAY  291



>emb|CEG62855.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=307

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNV+EAK+VVS  GHDGP GA+GVKRL+SIG+I    GM +LDMN AED IV+ TRE+
Sbjct  193  MDPNVIEAKVVVSGTGHDGPMGASGVKRLESIGLIAQKKGMLSLDMNAAEDDIVKYTREV  252

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPGM+VTGME+AE+DGAPRMGPTFGAM+ISGQKAA+ A  +L
Sbjct  253  VPGMVVTGMELAELDGAPRMGPTFGAMLISGQKAAYAARASL  294



>ref|XP_003522069.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Glycine 
max]
Length=284

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 93/127 (73%), Gaps = 2/127 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGP  ATGVKRLKSIGMID+VPGMKALD  +    +VRLTREI
Sbjct  141  MDPNVMEAKVVVSSCGHDGPLSATGVKRLKSIGMIDNVPGMKALDTKSIGMVVVRLTREI  200

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMM-ISGQKAAHLALKALGEPNALDGSASE-VAAP  235
            V GMIVTGMEVAEI G+PRMGP    M  ++ +    + LKALG  NA+DG+       P
Sbjct  201  VLGMIVTGMEVAEIGGSPRMGPYLSMMFKLTFKLMERVELKALGRNNAIDGTCGVGTEEP  260

Query  234  ELILASA  214
             LI AS 
Sbjct  261  HLIFAST  267



>dbj|BAC79982.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
Length=306

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+++VVSSCGHDGPFGATGVKRL+ IGMID+VPGM+ALDMNTAED IVRLTRE+
Sbjct  216  MDPNVMESRVVVSSCGHDGPFGATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREV  275

Query  408  VPGMIVTGMEVAEIDGAPRM  349
            VPGMIVTGMEVAEIDGAPRM
Sbjct  276  VPGMIVTGMEVAEIDGAPRM  295



>ref|XP_002784437.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER16233.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=325

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+++V+S+ GHDGP GA+GVKRL+ +G++DS+ GM ALDMN+AEDAIV  TREI
Sbjct  194  MDPNVMESRVVISATGHDGPMGASGVKRLEKLGLVDSLRGMGALDMNSAEDAIVEGTREI  253

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
             PGMIV GMEVAE+ GAPRMGPTFGAMMISG KAA +A + L
Sbjct  254  APGMIVAGMEVAELSGAPRMGPTFGAMMISGVKAARVAQQIL  295



>gb|ACN36998.1| unknown [Zea mays]
Length=218

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 87/101 (86%), Gaps = 4/101 (4%)
 Frame = -2

Query  483  DSVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  304
             SVPGMKALDMN AED IVRLTRE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA
Sbjct  119  QSVPGMKALDMNAAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAA  178

Query  303  HLALKALGEPNALDGSASEVAAP---ELILASAENEEIADA  190
            HLALKALG PNA+DG+  EV+     E ++AS +++E+ DA
Sbjct  179  HLALKALGRPNAVDGTIPEVSPALREEFVIAS-KDDEVVDA  218



>gb|AGB85035.1| thiamine biosynthesis thi4 protein, partial [Auxenochlorella 
protothecoides]
Length=327

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + +K++VSS GHDGP GA+GVKRL  +GMI+  PGM ALDMNTAEDA+V  TREI
Sbjct  164  MDPNTILSKVMVSSTGHDGPMGASGVKRLAKLGMIEKAPGMGALDMNTAEDAVVDRTREI  223

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPGM++ GMEVAE+DG PRMGPTFGAM ISG KA H AL +L
Sbjct  224  VPGMVICGMEVAELDGCPRMGPTFGAMFISGLKAVHCALASL  265



>ref|XP_011397717.1| Thiamine thiazole synthase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM24829.1| Thiamine thiazole synthase, chloroplastic [Auxenochlorella protothecoides]
Length=419

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + +K++VSS GHDGP GA+GVKRL  +GMI+  PGM ALDMNTAEDA+V  TREI
Sbjct  294  MDPNTILSKVMVSSTGHDGPMGASGVKRLAKLGMIEKAPGMGALDMNTAEDAVVDRTREI  353

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPGM++ GMEVAE+DG PRMGPTFGAM ISG KAAH AL +L
Sbjct  354  VPGMVICGMEVAELDGCPRMGPTFGAMFISGLKAAHCALASL  395



>ref|XP_001698672.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
 sp|A8J9T5.1|THI4_CHLRE RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|EDO99354.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
Length=357

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMI--DSVPGMKALDMNTAEDAIVRLTR  415
            MDPNV+EA +VVS+CGHDGPFGATGVKRL  +GM+    VPGM ALDM  AE +IV  TR
Sbjct  234  MDPNVIEAGVVVSACGHDGPFGATGVKRLARLGMVPGGEVPGMGALDMEAAEGSIVNNTR  293

Query  414  EIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            E+VPGM++TGME+AE+DG+PRMGPTFGAM++SG +AAH+A+ AL
Sbjct  294  EVVPGMVLTGMELAEVDGSPRMGPTFGAMIVSGMRAAHMAVAAL  337



>gb|ABK22862.1| unknown [Picea sitchensis]
Length=335

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 89/128 (70%), Gaps = 35/128 (27%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVME+K+VVSSCGHDGPFGATGVKRLKS+GMID VPGMKALDMNTAEDAIVRLTRE 
Sbjct  237  MDPNVMESKVVVSSCGHDGPFGATGVKRLKSVGMIDKVPGMKALDMNTAEDAIVRLTRE-  295

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDGSASEVAAPEL  229
                                            KAAHLALKALG+PNALDG+ +    PEL
Sbjct  296  --------------------------------KAAHLALKALGQPNALDGTLT--VHPEL  321

Query  228  ILASAENE  205
            +LASAE+E
Sbjct  322  VLASAEDE  329



>ref|XP_002951140.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
 gb|EFJ47669.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
Length=359

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMI--DSVPGMKALDMNTAEDAIVRLTR  415
            MDPNV+EA +VVS+CGHDGPFGAT VKRL  +GM+    VPGM ALDM  AE AIV  TR
Sbjct  233  MDPNVIEAGVVVSACGHDGPFGATSVKRLARLGMVPGGEVPGMGALDMEAAEGAIVGGTR  292

Query  414  EIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            E+VPGM++ GME+AE+DG+PRMGPTFGAM++SG++AAH+AL  L
Sbjct  293  EVVPGMVLAGMELAEVDGSPRMGPTFGAMIVSGRRAAHVALAVL  336



>ref|XP_002951138.1| hypothetical protein VOLCADRAFT_74899 [Volvox carteri f. nagariensis]
 gb|EFJ47667.1| hypothetical protein VOLCADRAFT_74899 [Volvox carteri f. nagariensis]
Length=355

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMI--DSVPGMKALDMNTAEDAIVRLTR  415
            MDPNV+EA +VVS+CGHDGPFGAT VKRL  +GM+    VPGM ALDM  AE AIV  TR
Sbjct  232  MDPNVIEAGVVVSACGHDGPFGATSVKRLARLGMVPGGEVPGMGALDMEAAEGAIVGGTR  291

Query  414  EIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            E+VPGM++ GME+AE+DG+PRMGPTFGAM++SG++AAH+AL  L
Sbjct  292  EVVPGMVLAGMELAEVDGSPRMGPTFGAMIVSGRRAAHVALAVL  335



>emb|CAH25337.1| thiazole biosynthetic enzyme [Guillardia theta]
Length=328

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 81/98 (83%), Gaps = 5/98 (5%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDS-----VPGMKALDMNTAEDAIVR  424
            MDPNV+E+K++VS CGHDGPFGA  VKRL  +GM+D      + GM ALDMN+AED IV 
Sbjct  212  MDPNVIESKVIVSGCGHDGPFGAQCVKRLAKLGMLDEYAQNGIQGMGALDMNSAEDKIVN  271

Query  423  LTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQK  310
             TRE+VPGMI+TGME+AE+DG+PRMGPTFGAM +SGQ+
Sbjct  272  NTREVVPGMILTGMELAEVDGSPRMGPTFGAMFVSGQR  309



>ref|XP_005834399.1| putative THI4, thiamine [Guillardia theta CCMP2712]
 gb|EKX47419.1| putative THI4, thiamine [Guillardia theta CCMP2712]
Length=325

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 81/98 (83%), Gaps = 5/98 (5%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDS-----VPGMKALDMNTAEDAIVR  424
            MDPNV+E+K++VS CGHDGPFGA  VKRL  +GM+D      + GM ALDMN+AED IV 
Sbjct  209  MDPNVIESKVIVSGCGHDGPFGAQCVKRLAKLGMLDEYAQNGIQGMGALDMNSAEDKIVN  268

Query  423  LTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQK  310
             TRE+VPGMI+TGME+AE+DG+PRMGPTFGAM +SGQ+
Sbjct  269  NTREVVPGMILTGMELAEVDGSPRMGPTFGAMFVSGQR  306



>ref|XP_008386070.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Malus 
domestica]
Length=312

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGP GATGVKRL+S+GMI+SVPG KALDMNTA+D IV+LTREI
Sbjct  227  MDPNVMEAKVVVSSCGHDGPMGATGVKRLRSVGMIESVPGXKALDMNTAKDTIVKLTREI  286

Query  408  VPGMIVTGMEVAEIDGAPRM  349
            +PG IVTGME+ EI+G+PRM
Sbjct  287  MPGXIVTGMEITEINGSPRM  306



>gb|KFZ11494.1| hypothetical protein V502_07520 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=335

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  225  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  285  VPGLIVGGMELSEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  331



>gb|KFY94986.1| hypothetical protein V498_03597 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=328

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  218  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  278  VPGLIVGGMELSEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  324



>gb|KFY84898.1| hypothetical protein V500_08902 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=330

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  220  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  280  VPGLIVGGMELSEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  326



>gb|KFY70117.1| hypothetical protein V499_09439 [Pseudogymnoascus pannorum VKM 
F-103]
Length=328

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  218  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  278  VPGLIVGGMELSEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  324



>gb|KFZ09843.1| hypothetical protein V501_05470 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=330

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  220  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  280  VPGLIVGGMELSEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  326



>gb|ACU23028.1| unknown [Glycine max]
Length=91

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 2/82 (2%)
 Frame = -2

Query  468  MKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK  289
            MKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL+
Sbjct  1    MKALDMNKAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALR  60

Query  288  ALGEPNALDGSASEVAAPELIL  223
            +LG PNALD   +    PEL+L
Sbjct  61   SLGLPNALDSVGN--VHPELVL  80



>ref|XP_007586590.1| putative thiazole biosynthetic enzyme protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD45932.1| putative thiazole biosynthetic enzyme protein [Neofusicoccum 
parvum UCRNP2]
Length=329

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGPFGA  VKRL S+  +D + GM+ LDMN AEDAIV+ TREI
Sbjct  218  MDPNTINAPVVISTTGHDGPFGAFSVKRLVSMQQLDKLGGMRGLDMNNAEDAIVKRTREI  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   E  A
Sbjct  278  VPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVFDERKA  324



>gb|EKG16915.1| Thiamine biosynthesis Thi4 protein [Macrophomina phaseolina MS6]
Length=236

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A IV+S+ GHDGPFGA  VKRL S+  ++ + GM+ LDMN AEDAIV+ TREI
Sbjct  125  MDPNTINAPIVISTTGHDGPFGAFSVKRLVSMQQLEKLGGMRGLDMNNAEDAIVKRTREI  184

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  277
            VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   E
Sbjct  185  VPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVFDE  228



>gb|KFX98431.1| hypothetical protein O988_04337, partial [Pseudogymnoascus pannorum 
VKM F-3808]
Length=343

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  233  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  292

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++EIDG+ RMGPTFGAM +SG KAA  AL+   +  A
Sbjct  293  VPGLIVGGMELSEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDQRKA  339



>ref|XP_007289177.1| thiazole biosynthetic enzyme [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD20606.1| thiazole biosynthetic enzyme [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=327

 Score =   138 bits (348),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ TREI
Sbjct  217  MDPNTINAPLVISTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMNTAEDAIVKRTREI  276

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  277
            VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   E
Sbjct  277  VPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVFEE  320



>gb|ADI88268.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88269.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88270.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88271.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88276.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88277.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88282.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88283.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88286.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88287.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88288.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88289.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88291.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88292.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88293.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88294.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88295.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88296.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88297.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88298.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88299.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88300.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88301.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88302.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88303.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88304.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88305.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88306.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88307.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88308.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88309.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88310.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88311.1| HCF106 protein, partial [Silene latifolia]
Length=137

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL  IG+I +VPGM ALDMNTAEDAIVRLTRE+
Sbjct  67   MDPNVMEAKVVVSSCGHDGPFGATGVKRLLDIGLIKNVPGMSALDMNTAEDAIVRLTREV  126

Query  408  VPGMIVTGMEV  376
            VPGMIVTGMEV
Sbjct  127  VPGMIVTGMEV  137



>gb|KFY20175.1| hypothetical protein V491_03934 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=328

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  218  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++EIDG+ RMGPTFGAM +SG KAA  AL+   +  A
Sbjct  278  VPGLIVGGMELSEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDQRKA  324



>gb|EHL02685.1| putative Thiazole biosynthetic enzyme, mitochondrial [Glarea 
lozoyensis 74030]
Length=322

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A IVVS+ GHDGPFGA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ TRE+
Sbjct  212  MDPNTINAPIVVSTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMNTAEDAIVKRTREV  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  277
            VPG++V GME++E+DGA RMGPTFGAM +SG KAA   LK   E
Sbjct  272  VPGLVVGGMELSEVDGANRMGPTFGAMALSGVKAAEEVLKVFDE  315



>ref|XP_001549602.1| thiazole biosynthetic enzyme [Botrytis cinerea B05.10]
 emb|CCD55366.1| similar to thiazole biosynthetic enzyme [Botrytis cinerea T4]
 gb|EMR84691.1| putative thiazole biosynthetic enzyme protein [Botrytis cinerea 
BcDW1]
Length=328

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A IV+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDMN AEDAIV+ TREI
Sbjct  218  MDPNTINAPIVISTTGHDGPFGAFCVKRLVSMNQIEKLGGMRGLDMNVAEDAIVKRTREI  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  AL+   E  A
Sbjct  278  VPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALRVFDERKA  324



>ref|XP_001589094.1| thiazole biosynthetic enzyme [Sclerotinia sclerotiorum 1980]
 sp|A7EWL8.1|THI4_SCLS1 RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Sclerotinia sclerotiorum 1980 UF-70]
 gb|EDN93860.1| thiazole biosynthetic enzyme [Sclerotinia sclerotiorum 1980 UF-70]
Length=326

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A IV+S+ GHDGPFGA  VKRL S+  I  + GM+ LDMN AEDAIV+ TREI
Sbjct  216  MDPNTINAPIVISTTGHDGPFGAFCVKRLVSMNQIKELGGMRGLDMNVAEDAIVKKTREI  275

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   E  A
Sbjct  276  VPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVFDERKA  322



>gb|ESZ95478.1| thiazole biosynthetic enzyme [Sclerotinia borealis F-4157]
Length=328

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDMN AEDAIV+ TREI
Sbjct  218  MDPNTINAPVVISTTGHDGPFGAFCVKRLVSMNQIEQLGGMRGLDMNVAEDAIVKRTREI  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   E  A
Sbjct  278  VPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKIFDERKA  324



>ref|XP_008087498.1| FAD/NAD(P)-binding protein [Glarea lozoyensis ATCC 20868]
 gb|EPE26179.1| FAD/NAD(P)-binding protein [Glarea lozoyensis ATCC 20868]
Length=328

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A IVVS+ GHDGPFGA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ TRE+
Sbjct  218  MDPNTINAPIVVSTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMNTAEDAIVKRTREV  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  277
            VPG++V GME++E+DGA RMGPTFGAM +SG KAA   LK   E
Sbjct  278  VPGLVVGGMELSEVDGANRMGPTFGAMALSGVKAAEEVLKVFDE  321



>ref|XP_003842741.1| similar to thiazole biosynthetic enzyme [Leptosphaeria maculans 
JN3]
 emb|CBX99262.1| similar to thiazole biosynthetic enzyme [Leptosphaeria maculans 
JN3]
Length=334

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +++S+ GHDGPFGA  VKRL S+  I+ + GM+ LDM TAEDAIV+ TREI
Sbjct  224  MDPNTINAPLIISTTGHDGPFGAFSVKRLVSMQQIEKLGGMRGLDMRTAEDAIVKRTREI  283

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNALDG  259
            VPG+IV GME++E+DGA RMGPTFGAM++SG KAA  A+    E NA +G
Sbjct  284  VPGLIVGGMELSEVDGANRMGPTFGAMVLSGVKAAEEAVGVWDERNAQNG  333



>gb|KFY43107.1| hypothetical protein V494_02101 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=328

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  218  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++EIDG+ RMGPTFGAM +SG KAA  AL+      A
Sbjct  278  VPGLIVGGMELSEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDRRKA  324



>gb|KFY08103.1| hypothetical protein V492_06538 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=328

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  218  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++EIDG+ RMGPTFGAM +SG KAA  AL+      A
Sbjct  278  VPGLIVGGMELSEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDRRKA  324



>gb|ELR08851.1| thiazole biosynthetic enzyme, mitochondrial [Pseudogymnoascus 
destructans 20631-21]
Length=328

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  218  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++EIDG+ RMGPTFGAM+ SG  AA  ALK   +  A
Sbjct  278  VPGLIVGGMELSEIDGSNRMGPTFGAMVYSGVAAAEAALKVFDQRKA  324



>gb|KFY24905.1| hypothetical protein V493_04960 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=329

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  218  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++EIDG+ RMGPTFGAM+ SG  AA  ALK   +  A
Sbjct  278  VPGLIVGGMELSEIDGSNRMGPTFGAMVYSGVVAAETALKVFDQRKA  324



>gb|ADI88272.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88273.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88274.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88275.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88278.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88279.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88280.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88281.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88290.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88312.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88313.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88314.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88315.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88467.1| HCF106 protein [Silene vulgaris]
Length=137

 Score =   132 bits (331),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL  IG+I +VPGM ALDMN+AEDAIVRLTRE+
Sbjct  67   MDPNVMEAKVVVSSCGHDGPFGATGVKRLLDIGLIKNVPGMSALDMNSAEDAIVRLTREV  126

Query  408  VPGMIVTGMEV  376
            VPGMIVTGMEV
Sbjct  127  VPGMIVTGMEV  137



>gb|KIN04678.1| hypothetical protein OIDMADRAFT_17638 [Oidiodendron maius Zn]
Length=322

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A IV+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDMN+AEDAIV  TRE+
Sbjct  212  MDPNTINAPIVISTTGHDGPFGAFSVKRLVSMQQIEKLGGMRGLDMNSAEDAIVTKTREV  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  277
            +PG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   E
Sbjct  272  IPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVFEE  315



>ref|XP_006370641.1| hypothetical protein POPTR_0001s44460g [Populus trichocarpa]
 gb|ERP67210.1| hypothetical protein POPTR_0001s44460g [Populus trichocarpa]
Length=207

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI SVPGM ALDMN AEDAI RL REI
Sbjct  9    MDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIVSVPGMNALDMNAAEDAIERLPREI  68

Query  408  VPGMIVTGME  379
            VPGMIVTGME
Sbjct  69   VPGMIVTGME  78



>gb|ADI88468.1| HCF106 protein [Silene vulgaris]
Length=137

 Score =   130 bits (328),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL  IG+I +VPGM ALDMN+AEDAIVRLTRE+
Sbjct  67   MDPNVMEAKVVVSSCGHDGPFGATGVKRLLDIGLIKNVPGMSALDMNSAEDAIVRLTREV  126

Query  408  VPGMIVTGMEV  376
            VPGMIVTG+EV
Sbjct  127  VPGMIVTGLEV  137



>gb|KFY50717.1| hypothetical protein V496_09214 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=1290

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -2

Query  588   MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
             MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  1180  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  1239

Query  408   VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
             VPG+IV GME++EIDG+ RMGPTFGAM++SG KAA  AL+A  +  A
Sbjct  1240  VPGLIVGGMELSEIDGSNRMGPTFGAMVLSGCKAAEAALEAFDQRKA  1286



>gb|ADI88284.1| HCF106 protein, partial [Silene latifolia]
 gb|ADI88285.1| HCF106 protein, partial [Silene latifolia]
Length=137

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPNVMEAK+VVSSCGHDGPFGATGVKRL  IG+I +VPGM ALDMN+AEDAIVR+TRE+
Sbjct  67   MDPNVMEAKVVVSSCGHDGPFGATGVKRLLDIGLIKNVPGMSALDMNSAEDAIVRVTREV  126

Query  408  VPGMIVTGMEV  376
            VPGMIVTGMEV
Sbjct  127  VPGMIVTGMEV  137



>ref|XP_007928692.1| hypothetical protein MYCFIDRAFT_211863 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME81519.1| hypothetical protein MYCFIDRAFT_211863 [Pseudocercospora fijiensis 
CIRAD86]
Length=340

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A ++VS+ GHDGPFGA  VKRL S+G+I ++ GM+ LDMNTAEDAIV+ TREI
Sbjct  226  MDPNTINAPVIVSTTGHDGPFGAFSVKRLVSMGVIPTLGGMRGLDMNTAEDAIVKGTREI  285

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
             PG++V GME++E+DGA RMGPTFGAM +SG KAA + L+   +  A
Sbjct  286  APGLVVGGMELSEVDGANRMGPTFGAMALSGVKAAEVVLEIFDQRKA  332



>gb|ACN39013.1| thiazole synthase [Epichloe festucae]
Length=320

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGP GA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ TREI
Sbjct  210  MDPNTINAPLVISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKNTREI  269

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPG+IV GME++EIDGA RMGPTFGAM++SG KAA  ALK  
Sbjct  270  VPGLIVGGMELSEIDGANRMGPTFGAMVLSGLKAAEEALKVF  311



>ref|XP_007672530.1| hypothetical protein BAUCODRAFT_62660 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMD00030.1| hypothetical protein BAUCODRAFT_62660 [Baudoinia compniacensis 
UAMH 10762]
Length=315

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +++S+ GHDGPFGA   KRL S+  + ++ GM+ LDMNTAEDAIV+ TREI
Sbjct  198  MDPNTINAPVIISTTGHDGPFGAFSAKRLVSMNALSALGGMRGLDMNTAEDAIVKGTREI  257

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+I+ GME++E+DGA RMGPTFGAM +SG KAA  ALK   E  A
Sbjct  258  VPGLIIGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVFEERRA  304



>gb|EME42084.1| hypothetical protein DOTSEDRAFT_73000 [Dothistroma septosporum 
NZE10]
Length=339

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +++S+ GHDGPFGA  VKRL S+G I ++ GM+ LDMN AEDAIV+ TREI
Sbjct  225  MDPNTINAPVIISTTGHDGPFGAFSVKRLVSMGSIPALGGMRGLDMNVAEDAIVKCTREI  284

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
             PG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK   +  A
Sbjct  285  APGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKIFEQRKA  331



>gb|ABN45968.1| thiazole biosynthetic enzyme variant 1 [Epichloe typhina]
 gb|ABN45969.1| thiazole biosynthetic enzyme variant 2 [Epichloe typhina]
 gb|ABN45970.1| thiazole biosynthetic enzyme variant 3 [Epichloe typhina]
 gb|ABN45971.1| thiazole biosynthetic enzyme variant 4 [Epichloe typhina]
 gb|ABN45972.1| thiazole biosynthetic enzyme variant 5 [Epichloe typhina]
Length=320

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGP GA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ TREI
Sbjct  210  MDPNTINAPLVISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKNTREI  269

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPG+IV GME++E+DGA RMGPTFGAM++SG KAA  ALK  
Sbjct  270  VPGLIVGGMELSEVDGANRMGPTFGAMVLSGLKAAEEALKVF  311



>gb|EAQ71495.1| hypothetical protein MGCH7_ch7g902 [Magnaporthe oryzae 70-15]
Length=202

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGPFGA   KRL S+  I+ + GM+ LDM +AEDAIV+ TREI
Sbjct  92   MDPNTINAPVVISTTGHDGPFGAFSAKRLVSMKQIEQLGGMRGLDMQSAEDAIVKRTREI  151

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLAL  292
            VPG+I+ GME++EIDGA RMGPTFGAM++SG KAA  A+
Sbjct  152  VPGLIIGGMELSEIDGANRMGPTFGAMVLSGVKAAEEAM  190



>gb|KFX95262.1| hypothetical protein V490_03958 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=1293

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  588   MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
             MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  1183  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  1242

Query  408   VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
             VPG+IV GME++EIDG+ RMGPTFGAM +SG KAA  AL+   +  A
Sbjct  1243  VPGLIVGGMELSEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDQRKA  1289



>ref|XP_008026201.1| hypothetical protein SETTUDRAFT_177413 [Setosphaeria turcica 
Et28A]
 gb|EOA86208.1| hypothetical protein SETTUDRAFT_177413 [Setosphaeria turcica 
Et28A]
Length=335

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDM TAEDAIV+ TREI
Sbjct  223  MDPNTINAPLVISTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMRTAEDAIVKRTREI  282

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  A+    E +A
Sbjct  283  VPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEAMNVWEERHA  329



>gb|ABG46357.1| mitochondrial thiazole biosynthetic enzyme [Trichoderma harzianum]
Length=322

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGP GA  VKRL S+G I+ + GM+ LDMN AEDAIV+ TRE+
Sbjct  212  MDPNTINAPLVISTTGHDGPMGAFCVKRLVSMGRIEKLGGMRGLDMNRAEDAIVKNTREV  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPG+IV GME++EIDGA RMGPTFGAM +SG KAA  ALK  
Sbjct  272  VPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAAEEALKVF  313



>gb|AGT99181.1| thiazole biosynthetic enzyme [Acremonium chrysogenum]
 gb|KFH43147.1| Thiamine thiazole synthase-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=328

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +++S+ GHDGP GA  VKRL S+  I+ + GM+ LDMNTAEDAIV+ TREI
Sbjct  218  MDPNTINAPVIISTTGHDGPMGAFSVKRLVSMQRIEKLGGMRGLDMNTAEDAIVKNTREI  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPG+IV GME++E+DGA RMGPTFGAM++SG KAA  AL+  
Sbjct  278  VPGLIVGGMELSEVDGANRMGPTFGAMVLSGVKAAEEALRVF  319



>ref|XP_003851349.1| hypothetical protein MYCGRDRAFT_44262 [Zymoseptoria tritici IPO323]
 gb|EGP86325.1| hypothetical protein MYCGRDRAFT_44262 [Zymoseptoria tritici IPO323]
Length=318

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A I++S+ GHDGPFGA   KRL + GM+  + GM+ LDMNTAEDAIV+ TRE+
Sbjct  208  MDPNTINAPIIISTTGHDGPFGAFCAKRLVATGMLSQLGGMRGLDMNTAEDAIVKNTREV  267

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGE  277
             PG+I+ GME++E+DGA RMGPTFGAM +SG KAA   LK   E
Sbjct  268  APGLIIGGMELSEVDGANRMGPTFGAMALSGVKAAEECLKVYEE  311



>gb|KFY37341.1| hypothetical protein V495_07232 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY55933.1| hypothetical protein V497_06604 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=1286

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -2

Query  588   MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
             MDPN + A I++S+ GHDGPFGA  VKRL S+G ++ + GM+ LDMNTAEDAIV+ TREI
Sbjct  1176  MDPNTINAPIIISTTGHDGPFGAFCVKRLVSMGQLEKLNGMRGLDMNTAEDAIVKGTREI  1235

Query  408   VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
             VPG+IV GME++EIDG+ RMGPTFGAM +SG KAA  AL+   +  A
Sbjct  1236  VPGLIVGGMELSEIDGSNRMGPTFGAMCLSGCKAAEAALEVFDQRKA  1282



>ref|XP_003344754.1| hypothetical protein SMAC_06409 [Sordaria macrospora k-hell]
 emb|CCC13190.1| unnamed protein product [Sordaria macrospora k-hell]
Length=319

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +++S+ GHDGPFGA  VKRL S+  ++ + GM+ LDM +AEDAIV  TREI
Sbjct  208  MDPNTINAPVIISTTGHDGPFGAFSVKRLVSMKQMERLNGMRGLDMQSAEDAIVNNTREI  267

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPG+IV GME++EIDGA RMGPTFGAM +SG KAAH A++  
Sbjct  268  VPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAAHEAIRVF  309



>ref|XP_006692218.1| hypothetical protein CTHT_0017160 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS22199.1| hypothetical protein CTHT_0017160 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=330

 Score =   133 bits (335),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +++S+ GHDGPFGA  VKRL S+  I+ + GM+ LDM  AEDAIV+ TREI
Sbjct  220  MDPNTINAPVIISTTGHDGPFGAFSVKRLVSMKQIEQLEGMRGLDMQRAEDAIVKNTREI  279

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPG+IV GME++EIDGA RMGPTFGAM +SG KAA  AL+  
Sbjct  280  VPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAAEEALRVF  321



>gb|EHK27008.1| hypothetical protein TRIVIDRAFT_215037 [Trichoderma virens Gv29-8]
Length=322

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGP GA  VKRL S+G I+ + GM+ LDMN AEDAIV+ TRE+
Sbjct  212  MDPNTINAPLVISTTGHDGPMGAFCVKRLVSMGRIEKLGGMRGLDMNRAEDAIVKNTREV  271

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK  289
            VPG+IV GME++EIDGA RMGPTFGAM +SG KAA  ALK
Sbjct  272  VPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAAEEALK  311



>gb|EMD85953.1| hypothetical protein COCHEDRAFT_1160889 [Bipolaris maydis C5]
 gb|ENI01956.1| hypothetical protein COCC4DRAFT_146503 [Bipolaris maydis ATCC 
48331]
Length=337

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGPFGA  VKRL S+  +D + GM+ LDM TAEDAIV+ TREI
Sbjct  226  MDPNTINAPLVISTTGHDGPFGAFSVKRLVSMQQLDKLGGMRGLDMRTAEDAIVKRTREI  285

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK  289
            VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  A+ 
Sbjct  286  VPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEAMN  325



>pdb|3JSK|A Chain A, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|B Chain B, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|C Chain C, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|D Chain D, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|E Chain E, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|F Chain F, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|G Chain G, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|H Chain H, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|I Chain I, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|J Chain J, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|K Chain K, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|L Chain L, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|M Chain M, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|N Chain N, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|O Chain O, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|P Chain P, Thiazole Synthase From Neurospora Crassa
Length=344

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +++S+ GHDGPFGA  VKRL S+  ++ + GM+ LDM +AEDAIV  TREI
Sbjct  233  MDPNTINAPVIISTTGHDGPFGAFSVKRLVSMKQMERLNGMRGLDMQSAEDAIVNNTREI  292

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPG+IV GME++EIDGA RMGPTFGAM +SG KAAH A++  
Sbjct  293  VPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAAHEAIRVF  334



>gb|KHE80990.1| hypothetical protein GE21DRAFT_10110, partial [Neurospora crassa]
Length=343

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +++S+ GHDGPFGA  VKRL S+  ++ + GM+ LDM +AEDAIV  TREI
Sbjct  232  MDPNTINAPVIISTTGHDGPFGAFSVKRLVSMKQMERLNGMRGLDMQSAEDAIVNNTREI  291

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPG+IV GME++EIDGA RMGPTFGAM +SG KAAH A++  
Sbjct  292  VPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAAHEAIRVF  333



>ref|XP_009853231.1| hypothetical protein NEUTE1DRAFT_95662 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO55392.1| hypothetical protein NEUTE1DRAFT_95662 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ69381.1| CyPBP37 protein [Neurospora tetrasperma FGSC 2509]
Length=344

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +++S+ GHDGPFGA  VKRL S+  ++ + GM+ LDM +AEDAIV  TREI
Sbjct  233  MDPNTINAPVIISTTGHDGPFGAFSVKRLVSMKQMERLNGMRGLDMQSAEDAIVNNTREI  292

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPG+IV GME++EIDGA RMGPTFGAM +SG KAAH A++  
Sbjct  293  VPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAAHEAIRVF  334



>ref|XP_001935439.1| thiazole biosynthesis enzyme [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU48013.1| thiazole biosynthesis enzyme [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=329

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDM TAEDAIV+ TRE+
Sbjct  218  MDPNTINAPLVISTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMRTAEDAIVKRTREV  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  A+    E  A
Sbjct  278  VPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEAVSVWEERQA  324



>ref|XP_011395239.1| thiazole biosynthetic enzyme, variant 2 [Neurospora crassa OR74A]
 ref|XP_011395240.1| thiazole biosynthetic enzyme [Neurospora crassa OR74A]
 ref|XP_011395241.1| thiazole biosynthetic enzyme, variant 1 [Neurospora crassa OR74A]
 ref|XP_011395242.1| thiazole biosynthetic enzyme, variant 3 [Neurospora crassa OR74A]
 sp|Q1K6I4.1|THI4_NEUCR RecName: Full=Thiamine thiazole synthase; AltName: Full=37 kDa 
NcCyP41-binding protein; Short=CyPBP37; AltName: Full=Thiazole 
biosynthetic enzyme [Neurospora crassa OR74A]
 emb|CAC03570.1| CyPBP37 protein [Neurospora crassa]
 gb|ESA41902.1| thiazole biosynthetic enzyme [Neurospora crassa OR74A]
 gb|ESA41903.1| thiazole biosynthetic enzyme, variant 1 [Neurospora crassa OR74A]
 gb|ESA41904.1| thiazole biosynthetic enzyme, variant 2 [Neurospora crassa OR74A]
 gb|ESA41905.1| thiazole biosynthetic enzyme, variant 3 [Neurospora crassa OR74A]
Length=344

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +++S+ GHDGPFGA  VKRL S+  ++ + GM+ LDM +AEDAIV  TREI
Sbjct  233  MDPNTINAPVIISTTGHDGPFGAFSVKRLVSMKQMERLNGMRGLDMQSAEDAIVNNTREI  292

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPG+IV GME++EIDGA RMGPTFGAM +SG KAAH A++  
Sbjct  293  VPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAAHEAIRVF  334



>ref|XP_003297921.1| hypothetical protein PTT_08482 [Pyrenophora teres f. teres 0-1]
 gb|EFQ93956.1| hypothetical protein PTT_08482 [Pyrenophora teres f. teres 0-1]
Length=329

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGPFGA  VKRL S+  I+ + GM+ LDM TAEDAIV+ TRE+
Sbjct  218  MDPNTINAPLVISTTGHDGPFGAFCVKRLVSMQQIEKLGGMRGLDMRTAEDAIVKRTREV  277

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGEPNA  268
            VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  A+    E  A
Sbjct  278  VPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEAVNVWEERKA  324



>gb|KDB14289.1| thiazole biosynthetic enzyme variant 1 [Ustilaginoidea virens]
Length=321

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGP GA  VKRL S+  I+ + GM+ LDMN+AEDAIV+ TREI
Sbjct  211  MDPNTINAPLVISTTGHDGPMGAFSVKRLVSMQRIEKLGGMRGLDMNSAEDAIVKNTREI  270

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK  
Sbjct  271  VPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALKVF  312



>gb|KIW54196.1| thiamine thiazole synthase [Exophiala xenobiotica]
 gb|KIW54197.1| thiamine thiazole synthase, variant 1 [Exophiala xenobiotica]
 gb|KIW54198.1| thiamine thiazole synthase, variant 2 [Exophiala xenobiotica]
 gb|KIW54199.1| thiamine thiazole synthase, variant 3 [Exophiala xenobiotica]
Length=329

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGPFGA   KRL S+  I+ + GM+ALDMN+AEDAIV+ TRE+
Sbjct  219  MDPNTINAPLVISTTGHDGPFGAFCAKRLVSMNAIEKLGGMRALDMNSAEDAIVKGTREV  278

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
             PG+I+ GME++E+DGA RMGPTFGAM++SG KAA  ALK L
Sbjct  279  SPGLIMGGMELSELDGANRMGPTFGAMVLSGVKAAEEALKVL  320



>ref|XP_007913237.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
 gb|EOO01967.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
Length=326

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -2

Query  588  MDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNTAEDAIVRLTREI  409
            MDPN + A +V+S+ GHDGPFGA  VKRL S+  ++ + GM+ LDM +AEDAIV+ TREI
Sbjct  216  MDPNTINAPLVISTTGHDGPFGAFSVKRLVSMKQLEQLGGMRGLDMASAEDAIVKGTREI  275

Query  408  VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKAL  283
            VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK  
Sbjct  276  VPGLIVGGMELSEVDGANRMGPTFGAMALSGVKAAEEALKVF  317



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925