BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF043O10

Length=553
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625976.1|  PREDICTED: probable glycerophosphoryl dieste...  72.4    2e-11   Nicotiana tomentosiformis
ref|XP_006344880.1|  PREDICTED: probable glycerophosphoryl dieste...  70.1    1e-10   Solanum tuberosum [potatoes]
ref|XP_009787408.1|  PREDICTED: probable glycerophosphoryl dieste...  69.3    2e-10   Nicotiana sylvestris
ref|XP_004251903.1|  PREDICTED: glycerophosphodiester phosphodies...  67.0    1e-09   Solanum lycopersicum
ref|XP_009794308.1|  PREDICTED: probable glycerophosphoryl dieste...  64.7    2e-09   Nicotiana sylvestris
ref|XP_009588257.1|  PREDICTED: probable glycerophosphoryl dieste...  64.7    6e-09   
gb|KHG12016.1|  putative glycerophosphoryl diester phosphodiester...  64.3    8e-09   Gossypium arboreum [tree cotton]
gb|KJB13799.1|  hypothetical protein B456_002G094900                  62.8    3e-08   Gossypium raimondii
gb|KHN43860.1|  Putative glycerophosphoryl diester phosphodiester...  61.6    6e-08   Glycine soja [wild soybean]
gb|KHG08046.1|  putative glycerophosphoryl diester phosphodiester...  60.1    2e-07   Gossypium arboreum [tree cotton]
ref|XP_009364630.1|  PREDICTED: probable glycerophosphoryl dieste...  58.2    2e-07   
ref|XP_003519608.1|  PREDICTED: probable glycerophosphoryl dieste...  58.9    5e-07   Glycine max [soybeans]
ref|XP_002529027.1|  glycerophosphoryl diester phosphodiesterase,...  58.5    6e-07   Ricinus communis
ref|XP_007020653.1|  PLC-like phosphodiesterase family protein, p...  58.2    7e-07   
ref|XP_007020652.1|  PLC-like phosphodiesterase family protein, p...  58.2    7e-07   
ref|XP_009335427.1|  PREDICTED: probable glycerophosphoryl dieste...  58.2    8e-07   Pyrus x bretschneideri [bai li]
ref|XP_008366428.1|  PREDICTED: probable glycerophosphoryl dieste...  57.8    1e-06   
gb|EYU33686.1|  hypothetical protein MIMGU_mgv1a001772mg              57.8    1e-06   Erythranthe guttata [common monkey flower]
emb|CDY11996.1|  BnaC03g14220D                                        57.4    1e-06   Brassica napus [oilseed rape]
ref|XP_010099974.1|  putative glycerophosphoryl diester phosphodi...  57.0    2e-06   
ref|XP_011097815.1|  PREDICTED: glycerophosphodiester phosphodies...  56.6    3e-06   Sesamum indicum [beniseed]
ref|XP_010252665.1|  PREDICTED: glycerophosphodiester phosphodies...  56.2    3e-06   Nelumbo nucifera [Indian lotus]
ref|XP_006280047.1|  hypothetical protein CARUB_v10025925mg           56.2    4e-06   
ref|XP_006280048.1|  hypothetical protein CARUB_v10025925mg           55.8    5e-06   Capsella rubella
ref|XP_010253010.1|  PREDICTED: glycerophosphodiester phosphodies...  55.5    6e-06   Nelumbo nucifera [Indian lotus]
ref|XP_011095489.1|  PREDICTED: glycerophosphodiester phosphodies...  55.5    6e-06   Sesamum indicum [beniseed]
gb|EYU27402.1|  hypothetical protein MIMGU_mgv1a001806mg              54.7    1e-05   Erythranthe guttata [common monkey flower]
ref|XP_008345027.1|  PREDICTED: probable glycerophosphoryl dieste...  53.9    1e-05   
ref|XP_010513618.1|  PREDICTED: glycerophosphodiester phosphodies...  54.3    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010415240.1|  PREDICTED: glycerophosphodiester phosphodies...  54.3    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_004294052.1|  PREDICTED: glycerophosphodiester phosphodies...  54.3    2e-05   Fragaria vesca subsp. vesca
ref|XP_002276757.1|  PREDICTED: glycerophosphodiester phosphodies...  54.3    2e-05   Vitis vinifera
ref|XP_010913178.1|  PREDICTED: glycerophosphodiester phosphodies...  53.9    2e-05   
ref|XP_010270134.1|  PREDICTED: glycerophosphodiester phosphodies...  53.5    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_009132384.1|  PREDICTED: probable glycerophosphoryl dieste...  53.5    3e-05   Brassica rapa
ref|XP_010913177.1|  PREDICTED: glycerophosphodiester phosphodies...  53.5    3e-05   Elaeis guineensis
emb|CDY36746.1|  BnaA03g11400D                                        53.5    3e-05   Brassica napus [oilseed rape]
ref|XP_010449676.1|  PREDICTED: glycerophosphodiester phosphodies...  53.5    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009127510.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  53.1    3e-05   Brassica rapa
ref|XP_010443178.1|  PREDICTED: glycerophosphodiester phosphodies...  53.1    3e-05   Camelina sativa [gold-of-pleasure]
emb|CDY12605.1|  BnaA02g12730D                                        52.8    4e-05   Brassica napus [oilseed rape]
gb|KJB62956.1|  hypothetical protein B456_009G445400                  52.8    4e-05   Gossypium raimondii
gb|KJB62955.1|  hypothetical protein B456_009G445400                  52.8    5e-05   Gossypium raimondii
ref|XP_006346174.1|  PREDICTED: probable glycerophosphoryl dieste...  52.4    5e-05   Solanum tuberosum [potatoes]
ref|XP_009142640.1|  PREDICTED: probable glycerophosphoryl dieste...  52.4    5e-05   Brassica rapa
emb|CDX89312.1|  BnaA01g15810D                                        52.4    5e-05   
ref|XP_010324292.1|  PREDICTED: glycerophosphodiester phosphodies...  52.4    6e-05   Solanum lycopersicum
ref|XP_010482994.1|  PREDICTED: glycerophosphodiester phosphodies...  52.4    6e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009415406.1|  PREDICTED: probable glycerophosphoryl dieste...  52.4    7e-05   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY45656.1|  BnaC09g31980D                                        52.0    7e-05   Brassica napus [oilseed rape]
ref|XP_009120058.1|  PREDICTED: probable glycerophosphoryl dieste...  52.0    8e-05   Brassica rapa
emb|CDY17323.1|  BnaA10g09570D                                        52.0    8e-05   Brassica napus [oilseed rape]
gb|AAL07129.1|  unknown protein                                       52.0    9e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36515.1|  putative protein                                     52.0    9e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010252664.1|  PREDICTED: glycerophosphodiester phosphodies...  52.0    9e-05   Nelumbo nucifera [Indian lotus]
ref|NP_567755.1|  glycerophosphoryl diester phosphodiesterase-like 3  52.0    9e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496108.1|  PREDICTED: glycerophosphodiester phosphodies...  52.0    9e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002867546.1|  MRH5/SHV3                                        52.0    9e-05   
emb|CDX94294.1|  BnaC01g18900D                                        51.6    1e-04   
ref|XP_006413151.1|  hypothetical protein EUTSA_v10024494mg           51.6    1e-04   Eutrema salsugineum [saltwater cress]
ref|NP_176870.2|  suppressor of npr1-1 constitutive 4                 51.6    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010474164.1|  PREDICTED: glycerophosphodiester phosphodies...  51.2    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_006283180.1|  hypothetical protein CARUB_v10004210mg           51.2    1e-04   Capsella rubella
ref|XP_008447692.1|  PREDICTED: probable glycerophosphoryl dieste...  51.2    1e-04   Cucumis melo [Oriental melon]
gb|KCW70259.1|  hypothetical protein EUGRSUZ_F03515                   51.2    1e-04   Eucalyptus grandis [rose gum]
ref|XP_006279182.1|  hypothetical protein CARUB_v10007932mg           51.2    2e-04   Capsella rubella
ref|XP_010064948.1|  PREDICTED: probable glycerophosphoryl dieste...  51.2    2e-04   
emb|CDX92806.1|  BnaC07g40640D                                        50.8    2e-04   
emb|CDY46687.1|  BnaA03g48210D                                        50.8    2e-04   Brassica napus [oilseed rape]
ref|XP_009137609.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  50.8    2e-04   Brassica rapa
gb|KFK29182.1|  hypothetical protein AALP_AA7G100300                  50.8    2e-04   Arabis alpina [alpine rockcress]
ref|XP_008645878.1|  PREDICTED: probable glycerophosphoryl dieste...  50.8    2e-04   Zea mays [maize]
ref|XP_006401453.1|  hypothetical protein EUTSA_v10012748mg           50.4    2e-04   Eutrema salsugineum [saltwater cress]
gb|KFK27133.1|  hypothetical protein AALP_AA8G339300                  50.1    3e-04   Arabis alpina [alpine rockcress]
ref|NP_200359.1|  putative glycerophosphoryl diester phosphodiest...  50.1    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864395.1|  glycerophosphoryl diester phosphodiesterase ...  49.7    4e-04   
ref|XP_007142366.1|  hypothetical protein PHAVU_008G274200g           49.7    4e-04   Phaseolus vulgaris [French bean]
gb|AAO42211.1|  unknown protein                                       49.7    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188688.1|  glycerophosphodiester phosphodiesterase-like pr...  49.7    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433459.1|  PREDICTED: glycerophosphodiester phosphodies...  48.5    7e-04   
ref|XP_009361078.1|  PREDICTED: probable glycerophosphoryl dieste...  48.9    9e-04   Pyrus x bretschneideri [bai li]
ref|XP_006297062.1|  hypothetical protein CARUB_v10013062mg           48.9    9e-04   Capsella rubella
ref|XP_009348463.1|  PREDICTED: probable glycerophosphoryl dieste...  48.9    9e-04   Pyrus x bretschneideri [bai li]
ref|NP_001185333.1|  putative glycerophosphoryl diester phosphodi...  48.9    0.001   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_009625976.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Nicotiana tomentosiformis]
 dbj|BAE53680.1| putative glycerophosphoryl diester phosphodiesterase family protein 
[Nicotiana tabacum]
 dbj|BAF34116.1| glycerophosphodiesterase-like protein [Nicotiana tabacum]
Length=752

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            V PGSLL+LM+PQ+LPPAEAP PVLTESDVVEPPLPPVAKI
Sbjct  672  VQPGSLLELMAPQFLPPAEAPNPVLTESDVVEPPLPPVAKI  712



>ref|XP_006344880.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            V PG LLQ MS Q LPPAEAP P+LTESDVVEPPLPPVAKI
Sbjct  671  VSPGVLLQFMSRQSLPPAEAPSPILTESDVVEPPLPPVAKI  711



>ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=752

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            V PGSLL L++PQ+LPPAEAP PVLTESDVVEPPLPPVAKI
Sbjct  672  VQPGSLLGLIAPQFLPPAEAPNPVLTESDVVEPPLPPVAKI  712



>ref|XP_004251903.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Solanum lycopersicum]
Length=751

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            V PG L Q MS Q LPPAEAP P+LTESDVVEPPLPPVAKI
Sbjct  669  VSPGVLQQFMSRQSLPPAEAPSPILTESDVVEPPLPPVAKI  709



>ref|XP_009794308.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2, partial [Nicotiana sylvestris]
Length=305

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            V PG LLQ M+PQ LP AEAP P+LT+SDVVEPPLPPVAKI
Sbjct  225  VEPGGLLQFMAPQLLPAAEAPNPILTDSDVVEPPLPPVAKI  265



>ref|XP_009588257.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana tomentosiformis]
Length=741

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            V PG LLQ M+PQ LP AEAP P+LT+SDVVEPPLPPVAKI
Sbjct  660  VEPGGLLQFMAPQLLPAAEAPNPILTDSDVVEPPLPPVAKI  700



>gb|KHG12016.1| putative glycerophosphoryl diester phosphodiesterase 1 -like 
protein [Gossypium arboreum]
Length=762

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -3

Query  545  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  432
            PGSLLQL++  YLPPAEAP P LTESDVVEPPLPPVAK
Sbjct  681  PGSLLQLVTTDYLPPAEAPKPYLTESDVVEPPLPPVAK  718



>gb|KJB13799.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=762

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  432
            V PGSLL L++  YLPPAEAP P LTESDVVEPPLPPVAK
Sbjct  679  VQPGSLLSLVTTDYLPPAEAPKPYLTESDVVEPPLPPVAK  718



>gb|KHN43860.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=753

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            V PGSL  L++ ++LPPAEAP+P LTES+V EPPLPPVAKI
Sbjct  674  VQPGSLFGLITKEFLPPAEAPFPPLTESEVAEPPLPPVAKI  714



>gb|KHG08046.1| putative glycerophosphoryl diester phosphodiesterase 2 -like 
protein [Gossypium arboreum]
Length=775

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PGSL QL++  YLPPAEAP P LTE+DV EPPLPPVA
Sbjct  694  VQPGSLYQLITAPYLPPAEAPNPFLTEADVNEPPLPPVA  732



>ref|XP_009364630.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
 ref|XP_009364651.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=242

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            V P SL+Q+++P YLPPAEAP PVLTESDV+EPPLP V  +
Sbjct  161  VQPASLVQVITPSYLPPAEAPNPVLTESDVIEPPLPSVTAL  201



>ref|XP_003519608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=753

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            V PGSL  L++ ++LPPAEAP+P LTES+V EPPLPPVAKI
Sbjct  674  VQPGSLFGLITKEFLPPAEAPFPPLTESEVAEPPLPPVAKI  714



>ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=768

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V PGSLLQL++  YLPPAEAP PVLTE+DV E PLPPV
Sbjct  685  VQPGSLLQLITQDYLPPAEAPNPVLTEADVAEAPLPPV  722



>ref|XP_007020653.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY12178.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
Length=758

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PGSLLQL++ +YLPPAEAP P LTE+D+ E PLPPVA
Sbjct  677  VQPGSLLQLVTAEYLPPAEAPNPYLTEADIAESPLPPVA  715



>ref|XP_007020652.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY12177.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
Length=760

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PGSLLQL++ +YLPPAEAP P LTE+D+ E PLPPVA
Sbjct  679  VQPGSLLQLVTAEYLPPAEAPNPYLTEADIAESPLPPVA  717



>ref|XP_009335427.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            V P SL+Q+++P YLPPAEAP PVLTESDV+EPPLP V  +
Sbjct  671  VQPASLVQVITPSYLPPAEAPNPVLTESDVIEPPLPSVTAL  711



>ref|XP_008366428.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=752

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  545  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            P SL+Q+++P YLPPAEAP PVLTESDV+EPPLP V  +
Sbjct  673  PASLVQVITPSYLPPAEAPNPVLTESDVIEPPLPSVTAV  711



>gb|EYU33686.1| hypothetical protein MIMGU_mgv1a001772mg [Erythranthe guttata]
Length=761

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V PG LL LM+ Q+LPPAEAP PVLTE DV EPPLP V
Sbjct  677  VQPGGLLTLMTSQFLPPAEAPSPVLTEDDVAEPPLPAV  714



>emb|CDY11996.1| BnaC03g14220D [Brassica napus]
Length=773

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V P  LL+++SP +LPPAEAP PV T++D+ EPPLPPV
Sbjct  685  VRPAGLLEIVSPTFLPPAEAPNPVFTDADITEPPLPPV  722



>ref|XP_010099974.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
 gb|EXB81079.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
Length=748

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PGSL++L++  YLPPAEAP PVLTE DV EPPLPP A
Sbjct  661  VQPGSLVELITTDYLPPAEAPNPVLTEDDVSEPPLPPAA  699



>ref|XP_011097815.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=760

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  432
            V P  L+ LM+P++LPPAEAP PVLTE+DV EPPLPPV +
Sbjct  677  VQPAGLISLMAPKFLPPAEAPNPVLTENDVTEPPLPPVVE  716



>ref|XP_010252665.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=754

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  432
            V PG+L+Q+++ ++LPPAE+P PVLTESDV EPPL  + K
Sbjct  674  VEPGALMQVITAEFLPPAESPNPVLTESDVAEPPLASITK  713



>ref|XP_006280047.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12945.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=682

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V P  LL ++SP  LPPAEAP PV T++DV EPPLPPV
Sbjct  601  VQPAGLLTIVSPTSLPPAEAPNPVFTDADVTEPPLPPV  638



>ref|XP_006280048.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12946.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=767

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V P  LL ++SP  LPPAEAP PV T++DV EPPLPPV
Sbjct  686  VQPAGLLTIVSPTSLPPAEAPNPVFTDADVTEPPLPPV  723



>ref|XP_010253010.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Nelumbo nucifera]
Length=734

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  432
            V PG+L Q +S +YLP AEAP PVLT+SDV EPPLP V K
Sbjct  669  VQPGNLFQAISAEYLPLAEAPSPVLTDSDVAEPPLPHVIK  708



>ref|XP_011095489.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
 ref|XP_011095490.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=767

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -3

Query  536  LLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            L+ L+SP YLPPAEAP P+LT++DV EPPLPPV
Sbjct  678  LIDLISPTYLPPAEAPSPILTDNDVAEPPLPPV  710



>gb|EYU27402.1| hypothetical protein MIMGU_mgv1a001806mg [Erythranthe guttata]
Length=757

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V PG L+ LM+P  L PAEAPYPVLT  DV EPPLP V
Sbjct  678  VRPGGLISLMAPGSLTPAEAPYPVLTGDDVAEPPLPAV  715



>ref|XP_008345027.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=299

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            + P SL+Q+++P YLPPAEAP P L ESDV+EPPLP V
Sbjct  218  IQPASLIQVVTPSYLPPAEAPNPTLRESDVIEPPLPSV  255



>ref|XP_010513618.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like, 
partial [Camelina sativa]
Length=647

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  432
            V PG+LL  MSPQ LPPAEAP  ++T++DV+EPPLPPV +
Sbjct  554  VKPGALLAYMSPQSLPPAEAPNLIITDADVIEPPLPPVTE  593



>ref|XP_010415240.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=780

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  432
            V P +LL  MSPQ LPPAEAP  ++T++DV+EPPLPP+ +
Sbjct  687  VKPRALLAFMSPQSLPPAEAPNLIITDADVIEPPLPPITE  726



>ref|XP_004294052.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=753

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  444
            V PGSL+Q++S  Y+PPAEAP P LTESDV+EPPLP
Sbjct  672  VQPGSLIQVISSVYMPPAEAPKPYLTESDVIEPPLP  707



>ref|XP_002276757.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Vitis 
vinifera]
 emb|CBI26719.3| unnamed protein product [Vitis vinifera]
Length=757

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PGSL+Q+++   +PPA APYPVLTESDV EPPL  VA
Sbjct  674  VQPGSLMQVITSDDMPPALAPYPVLTESDVAEPPLQEVA  712



>ref|XP_010913178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 isoform 
X2 [Elaeis guineensis]
Length=674

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PG+LLQL+     PPA AP PVL  SDVVEPPLPPVA
Sbjct  594  VEPGALLQLIPAASQPPALAPMPVLNVSDVVEPPLPPVA  632



>ref|XP_010270134.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Nelumbo 
nucifera]
Length=751

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  444
            V PGSL+Q+++P +LPPAEAP PVL +S+V EPP P
Sbjct  671  VQPGSLMQVITPDFLPPAEAPNPVLEDSNVAEPPFP  706



>ref|XP_009132384.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=766

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V P  LL+++SP +LPPAEAP PV+T++DV EPPLPPV 
Sbjct  685  VRPAGLLEIVSPTFLPPAEAPNPVITDADVTEPPLPPVT  723



>ref|XP_010913177.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 isoform 
X1 [Elaeis guineensis]
Length=759

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PG+LLQL+     PPA AP PVL  SDVVEPPLPPVA
Sbjct  679  VEPGALLQLIPAASQPPALAPMPVLNVSDVVEPPLPPVA  717



>emb|CDY36746.1| BnaA03g11400D [Brassica napus]
Length=766

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V P  LL+++SP +LPPAEAP PV T++DV EPPLPPV 
Sbjct  685  VRPAGLLEIVSPTFLPPAEAPNPVFTDADVTEPPLPPVT  723



>ref|XP_010449676.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Camelina sativa]
 ref|XP_010449685.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Camelina sativa]
Length=767

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V PG LL ++SP  LPPAEAP PV T++DV+EPPLPPV
Sbjct  686  VQPGGLLTIVSPASLPPAEAPNPVFTDADVIEPPLPPV  723



>ref|XP_009127510.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=749

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  441
            + PG LL L +P+ LPPAEAPYPV TE DV E P PP
Sbjct  675  IKPGILLSLANPRSLPPAEAPYPVFTEDDVTESPQPP  711



>ref|XP_010443178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Camelina sativa]
Length=767

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V PG LL ++SP  LPPAEAP PV T++DV+EPPLPPV
Sbjct  686  VQPGGLLTIVSPASLPPAEAPNPVFTDADVIEPPLPPV  723



>emb|CDY12605.1| BnaA02g12730D [Brassica napus]
Length=716

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  441
            + PG LL L +P+ LPPAEAPYPV TE DV E P PP
Sbjct  642  IKPGILLSLANPRSLPPAEAPYPVFTEDDVTESPQPP  678



>gb|KJB62956.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=604

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PGSL  L++  YLPPAEAP P LTE+DV EPPLPPVA
Sbjct  523  VQPGSLYGLITAPYLPPAEAPNPFLTEADVNEPPLPPVA  561



>gb|KJB62955.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=760

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PGSL  L++  YLPPAEAP P LTE+DV EPPLPPVA
Sbjct  679  VQPGSLYGLITAPYLPPAEAPNPFLTEADVNEPPLPPVA  717



>ref|XP_006346174.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            V PGSLL LM+ Q +PP E P PVL  SDV EPPLPPVAKI
Sbjct  671  VQPGSLLGLMTVQSMPPVEPPNPVLDVSDVTEPPLPPVAKI  711



>ref|XP_009142640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=757

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PG LL+++SP  LPPAEAP PV T++DV EPPLPPV 
Sbjct  676  VQPGGLLEVVSPGSLPPAEAPNPVFTDADVTEPPLPPVT  714



>emb|CDX89312.1| BnaA01g15810D [Brassica napus]
Length=757

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PG LL+++SP  LPPAEAP PV T++DV EPPLPPV 
Sbjct  676  VQPGGLLEVVSPGSLPPAEAPNPVFTDADVTEPPLPPVT  714



>ref|XP_010324292.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Solanum 
lycopersicum]
Length=753

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            V PGSLL LM+ Q +PP E P PVL  SDV EPPLPPVAKI
Sbjct  671  VQPGSLLGLMTVQSMPPVEPPSPVLDVSDVTEPPLPPVAKI  711



>ref|XP_010482994.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Camelina 
sativa]
Length=769

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PG LL ++SP  LPPAEAP PV T++DV EPPLPPV 
Sbjct  688  VQPGGLLTIVSPASLPPAEAPNPVFTDADVTEPPLPPVT  726



>ref|XP_009415406.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=760

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  542  GSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            G LLQL+SPQ LPPA +P PVL  SDVVEPPLPPVA
Sbjct  682  GGLLQLISPQSLPPALSPMPVLDVSDVVEPPLPPVA  717



>emb|CDY45656.1| BnaC09g31980D [Brassica napus]
Length=653

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V P  LL +MSP  LPPAEAP PV T++DV EPPLPPV
Sbjct  572  VQPAGLLSIMSPTSLPPAEAPNPVFTDADVTEPPLPPV  609



>ref|XP_009120058.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=768

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V P  LL +MSP  LPPAEAP PV T++DV EPPLPPV
Sbjct  687  VQPAGLLSIMSPTSLPPAEAPNPVFTDADVTEPPLPPV  724



>emb|CDY17323.1| BnaA10g09570D [Brassica napus]
Length=768

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V P  LL +MSP  LPPAEAP PV T++DV EPPLPPV
Sbjct  687  VQPAGLLSIMSPTSLPPAEAPNPVFTDADVTEPPLPPV  724



>gb|AAL07129.1| unknown protein [Arabidopsis thaliana]
Length=759

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  545  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            PG+LL L+SP   PPAEAP PV T++DV EPPLPPV
Sbjct  680  PGALLTLVSPTAFPPAEAPNPVFTDADVTEPPLPPV  715



>emb|CAB36515.1| putative protein [Arabidopsis thaliana]
 emb|CAB79524.1| putative protein [Arabidopsis thaliana]
Length=770

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  545  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            PG+LL L+SP   PPAEAP PV T++DV EPPLPPV
Sbjct  691  PGALLTLVSPTAFPPAEAPNPVFTDADVTEPPLPPV  726



>ref|XP_010252664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=756

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  432
            V P  LL L +P  LP  EAP PVLTESDV EPPLP V K
Sbjct  674  VLPNGLLSLGNPALLPSVEAPNPVLTESDVAEPPLPSVTK  713



>ref|NP_567755.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
 sp|Q9SZ11.3|GPDL3_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL3; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
3; Short=ATGDPDL3; AltName: Full=Glycerophosphodiesterase-like 
2; AltName: Full=Protein MUTANT ROOT HAIR 5; AltName: Full=Protein 
SHAVEN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85238.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
Length=759

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  545  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            PG+LL L+SP   PPAEAP PV T++DV EPPLPPV
Sbjct  680  PGALLTLVSPTAFPPAEAPNPVFTDADVTEPPLPPV  715



>ref|XP_010496108.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=764

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = -3

Query  551  VGPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            + PG LL  L+SP  LPPA+AP PV T+ DV EPPLPPV
Sbjct  685  IQPGDLLNTLVSPLSLPPAQAPNPVFTDGDVTEPPLPPV  723



>ref|XP_002867546.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43805.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
Length=756

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  545  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            PG+LL L+SP  LPPA+AP PV T++DV EPPLPPV 
Sbjct  677  PGALLTLVSPTSLPPAQAPNPVFTDADVTEPPLPPVT  713



>emb|CDX94294.1| BnaC01g18900D [Brassica napus]
Length=757

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PG LL+++SP  +PPAEAP PV T++DV EPPLPPV 
Sbjct  676  VQPGGLLEVVSPGSIPPAEAPNPVFTDADVTEPPLPPVT  714



>ref|XP_006413151.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
 gb|ESQ54604.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
Length=757

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  545  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            PG LL+++SP  LPPAEAP PV T++DV EPPLPPV 
Sbjct  678  PGGLLEVVSPGSLPPAEAPKPVFTDADVTEPPLPPVT  714



>ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
 sp|D7SFH9.1|GPDL2_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase protein 
kinase domain-containing GDPDL2; AltName: Full=Glycerophosphodiester 
phosphodiesterase-like 2; Short=ATGDPDL2; AltName: 
Full=Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ADI71282.1| SNC4 [Arabidopsis thaliana]
 gb|AEE34581.1| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
Length=1118

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V PG +L L+S   LPPA+ P P+ T  DV EPPLPPV
Sbjct  687  VNPGGVLTLISTSSLPPAQDPNPIFTHDDVTEPPLPPV  724



>ref|XP_010474164.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=654

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -3

Query  551  VGPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  432
            + PG LL  L+SP  LPPAEAP  V T  DV EPPLPPVAK
Sbjct  583  IQPGDLLNTLVSPLSLPPAEAPNLVFTNVDVSEPPLPPVAK  623



>ref|XP_006283180.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
 gb|EOA16078.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
Length=757

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PG+LL L+S   LPPAEAP PV T++DV EPPLPPV 
Sbjct  676  VQPGALLALVSSASLPPAEAPNPVFTDADVTEPPLPPVT  714



>ref|XP_008447692.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
 ref|XP_008447693.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
Length=764

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PGSLLQL++P YLPP   P PVL + DV EPPLPPV+
Sbjct  678  VQPGSLLQLVTPNYLPPKTPPSPVLDDKDVAEPPLPPVS  716



>gb|KCW70259.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=640

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V PGSL+Q+++   LPPA+APYPVL ESDV EPPLP V
Sbjct  557  VQPGSLMQVITTPMLPPAQAPYPVLIESDVDEPPLPAV  594



>ref|XP_006279182.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12080.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=760

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            + PGSLL ++SP  LPPAEAP  + T++DV EP LPPV+
Sbjct  688  IQPGSLLGVVSPLSLPPAEAPSLIFTDADVTEPHLPPVS  726



>ref|XP_010064948.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=746

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V PGSL+Q+++   LPPA+APYPVL ESDV EPPLP V
Sbjct  663  VQPGSLMQVITTPMLPPAQAPYPVLIESDVDEPPLPAV  700



>emb|CDX92806.1| BnaC07g40640D [Brassica napus]
Length=716

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PG LLQ+++   LPPAEAP PV T++DV EPPLPPV 
Sbjct  632  VQPGGLLQVVNHASLPPAEAPNPVFTDADVTEPPLPPVT  670



>emb|CDY46687.1| BnaA03g48210D [Brassica napus]
Length=717

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PG LLQ+++   LPPAEAP PV T++DV EPPLPPV 
Sbjct  632  VQPGGLLQVVNHASLPPAEAPNPVFTDADVTEPPLPPVT  670



>ref|XP_009137609.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=759

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PG LLQ+++   LPPAEAP PV T++DV EPPLPPV 
Sbjct  674  VQPGGLLQVVNHASLPPAEAPNPVFTDADVTEPPLPPVT  712



>gb|KFK29182.1| hypothetical protein AALP_AA7G100300 [Arabis alpina]
Length=758

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V PG LL+++SP   PPA+AP PV T++DV EPPLPPV
Sbjct  677  VEPGGLLKIVSPTSFPPAQAPNPVFTDADVTEPPLPPV  714



>ref|XP_008645878.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW72077.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=750

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  545  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            PGSLL  M+P   PPA AP P+LT++DV EP LPPV+
Sbjct  680  PGSLLLTMAPDVQPPAAAPMPLLTDADVAEPALPPVS  716



>ref|XP_006401453.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
 gb|ESQ42906.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
Length=768

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  545  PGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            P  LL ++SP  LPPAEAP PV+TE+DV EPPLPPV 
Sbjct  689  PAGLLSIVSPTSLPPAEAPNPVITEADVTEPPLPPVT  725



>gb|KFK27133.1| hypothetical protein AALP_AA8G339300 [Arabis alpina]
Length=764

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V P  LL ++SP  LPPAEAP PV T++DV EPPLPPV
Sbjct  683  VQPAGLLTIVSPNSLPPAEAPNPVFTDADVTEPPLPPV  720



>ref|NP_200359.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
 sp|Q9FJ62.1|GPDL4_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL4; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
4; Short=ATGDPDL4; AltName: Full=Glycerophosphodiesterase-like 
1; AltName: Full=Protein SHV3-LIKE 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08565.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94382.1| At5g55480 [Arabidopsis thaliana]
 gb|AAV59273.1| At5g55480 [Arabidopsis thaliana]
 gb|AED96633.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
Length=766

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V P  LL ++SP  LPPAEAP PV T++DV EPPLPPV+
Sbjct  685  VQPAGLLTIVSPASLPPAEAPSPVFTDADVTEPPLPPVS  723



>ref|XP_002864395.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40654.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=757

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V P  LL ++SP  LPPAEAP PV+T++DV EPPLPPV 
Sbjct  676  VQPAGLLTIVSPASLPPAEAPNPVITDADVTEPPLPPVT  714



>ref|XP_007142366.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
 gb|ESW14360.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
Length=758

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  429
            V PG L  L++P +LPP EAP P LTES+V EP LPPV KI
Sbjct  678  VQPGGLFGLITPGFLPPTEAPLPPLTESEVAEPALPPVVKI  718



>gb|AAO42211.1| unknown protein [Arabidopsis thaliana]
Length=729

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  542  GSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  444
            G L+   +P  LPPAEAPYP L +SDV EPPLP
Sbjct  659  GELITFANPMLLPPAEAPYPALLDSDVTEPPLP  691



>ref|NP_188688.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
 sp|F4JEQ1.1|GPDL5_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL5; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
5; Short=ATGDPDL5; AltName: Full=Glycerophosphodiesterase-like 
4; AltName: Full=Protein SHV3-LIKE 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76390.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
Length=729

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  542  GSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  444
            G L+   +P  LPPAEAPYP L +SDV EPPLP
Sbjct  659  GELITFANPMLLPPAEAPYPALLDSDVTEPPLP  691



>ref|XP_010433459.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=225

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  435
            V PG LL L+S   LPPA+AP  V T++DV+EPPLPPV 
Sbjct  144  VQPGELLTLVSSTSLPPAQAPTQVFTDADVIEPPLPPVT  182



>ref|XP_009361078.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            + P SL+Q+++  YLPPAEAP P L ESDV+EPPLP V
Sbjct  671  IQPASLIQVVTSAYLPPAEAPNPPLRESDVIEPPLPSV  708



>ref|XP_006297062.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
 gb|EOA29960.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
Length=729

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            VG G L+   +P +  PA+APYP L +SDV EPPLP V
Sbjct  656  VGTGELITFGNPMFFGPAKAPYPFLNDSDVTEPPLPEV  693



>ref|XP_009348463.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            + P SL+Q+++  YLPPAEAP P L ESDV+EPPLP V
Sbjct  671  IQPASLIQVVTSAYLPPAEAPNPPLRESDVIEPPLPSV  708



>ref|NP_001185333.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 gb|AEE34580.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=785

 Score = 48.9 bits (115),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -3

Query  551  VGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  438
            V PG LL +MSP  LPPA+AP     E+DV EPPL PV
Sbjct  707  VNPGGLLNVMSPLSLPPAQAPNQDFIEADVTEPPLSPV  744



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760