BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF043O07

Length=607
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD02268.1|  aspartate aminotransferase                             251   1e-80   Nicotiana tabacum [American tobacco]
ref|XP_009789886.1|  PREDICTED: aspartate aminotransferase, chlor...    254   9e-79   Nicotiana sylvestris
ref|XP_006345635.1|  PREDICTED: aspartate aminotransferase, chlor...    253   3e-78   Solanum tuberosum [potatoes]
ref|NP_001274906.1|  aspartate aminotransferase, chloroplastic-like     253   3e-78   Solanum tuberosum [potatoes]
ref|XP_010665799.1|  PREDICTED: aspartate aminotransferase, chlor...    250   4e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004244943.1|  PREDICTED: aspartate aminotransferase, chlor...    250   4e-77   Solanum lycopersicum
ref|XP_011082202.1|  PREDICTED: aspartate aminotransferase, chlor...    249   7e-77   
gb|AFK46621.1|  unknown                                                 241   2e-76   Lotus japonicus
ref|XP_010245533.1|  PREDICTED: aspartate aminotransferase, chlor...    248   5e-76   Nelumbo nucifera [Indian lotus]
gb|KDO46792.1|  hypothetical protein CISIN_1g012238mg                   245   9e-76   Citrus sinensis [apfelsine]
ref|XP_002324896.1|  aspartate aminotransferase 2 family protein        246   1e-75   Populus trichocarpa [western balsam poplar]
ref|XP_006450331.1|  hypothetical protein CICLE_v10008224mg             246   1e-75   Citrus clementina [clementine]
gb|KDO46791.1|  hypothetical protein CISIN_1g012238mg                   246   1e-75   Citrus sinensis [apfelsine]
emb|CDP18792.1|  unnamed protein product                                248   3e-75   Coffea canephora [robusta coffee]
dbj|BAD94538.1|  aspartate aminotransferase                             236   4e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002309659.2|  aspartate aminotransferase 2 family protein        245   4e-75   
gb|KDP33541.1|  hypothetical protein JCGZ_07112                         244   8e-75   Jatropha curcas
ref|XP_011039608.1|  PREDICTED: aspartate aminotransferase, chlor...    244   1e-74   Populus euphratica
ref|XP_008220703.1|  PREDICTED: aspartate aminotransferase, chlor...    243   3e-74   Prunus mume [ume]
gb|AAC12674.1|  aspartate aminotransferase                              243   3e-74   Lotus corniculatus
ref|XP_011036642.1|  PREDICTED: aspartate aminotransferase, chlor...    243   3e-74   Populus euphratica
ref|XP_008377672.1|  PREDICTED: aspartate aminotransferase, chlor...    242   4e-74   Malus domestica [apple tree]
ref|XP_007223036.1|  hypothetical protein PRUPE_ppa005369mg             242   4e-74   Prunus persica
gb|ACN40845.1|  unknown                                                 241   6e-74   Picea sitchensis
gb|ABK24563.1|  unknown                                                 242   6e-74   Picea sitchensis
gb|AAB46611.1|  aspartate aminotransferase                              241   1e-73   Medicago sativa [alfalfa]
prf||1908424A  Asp aminotransferase                                     241   1e-73
gb|KEH39860.1|  aspartate aminotransferase                              241   2e-73   Medicago truncatula
ref|XP_010942149.1|  PREDICTED: aspartate aminotransferase, chlor...    240   2e-73   Elaeis guineensis
ref|XP_006283713.1|  hypothetical protein CARUB_v10004783mg             240   2e-73   Capsella rubella
ref|XP_010942150.1|  PREDICTED: aspartate aminotransferase, chlor...    240   2e-73   
ref|XP_007161154.1|  hypothetical protein PHAVU_001G0470000g            234   2e-73   Phaseolus vulgaris [French bean]
ref|XP_002515455.1|  aspartate aminotransferase, putative               240   3e-73   Ricinus communis
ref|NP_001237987.1|  aspartate aminotransferase                         240   3e-73   
ref|XP_006600243.1|  PREDICTED: aspartate aminotransferase isofor...    240   3e-73   Glycine max [soybeans]
ref|XP_010089944.1|  Aspartate aminotransferase                         240   5e-73   
ref|XP_004498776.1|  PREDICTED: aspartate aminotransferase P2, mi...    239   5e-73   Cicer arietinum [garbanzo]
gb|ABR16448.1|  unknown                                                 237   1e-72   Picea sitchensis
ref|XP_003544600.1|  PREDICTED: aspartate aminotransferase P2, mi...    238   1e-72   Glycine max [soybeans]
ref|XP_006412529.1|  hypothetical protein EUTSA_v10025142mg             238   2e-72   
ref|XP_008445250.1|  PREDICTED: aspartate aminotransferase, chlor...    236   2e-72   Cucumis melo [Oriental melon]
emb|CAN76227.1|  hypothetical protein VITISV_000267                     238   3e-72   Vitis vinifera
ref|XP_002285385.1|  PREDICTED: aspartate aminotransferase, chlor...    238   3e-72   Vitis vinifera
gb|AAB26677.2|  aspartate aminotransferase isozyme 5                    238   3e-72   Glycine max [soybeans]
dbj|BAA08106.1|  plastidic aspartate aminotransferase                   237   4e-72   Panicum miliaceum [broom millet]
ref|XP_004954233.1|  PREDICTED: aspartate aminotransferase, chlor...    237   4e-72   Setaria italica
ref|XP_010432789.1|  PREDICTED: aspartate aminotransferase, chlor...    237   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010447459.1|  PREDICTED: aspartate aminotransferase, chlor...    237   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_002867266.1|  hypothetical protein ARALYDRAFT_491537             237   5e-72   
gb|AAO23563.1|  aspartate aminotransferase                              236   5e-72   Oryza sativa [red rice]
ref|XP_008445249.1|  PREDICTED: aspartate aminotransferase, chlor...    237   5e-72   Cucumis melo [Oriental melon]
ref|XP_009138057.1|  PREDICTED: aspartate aminotransferase, chlor...    236   6e-72   Brassica rapa
ref|XP_004138711.1|  PREDICTED: aspartate aminotransferase, chlor...    237   6e-72   Cucumis sativus [cucumbers]
ref|XP_006648055.1|  PREDICTED: aspartate aminotransferase, chlor...    236   6e-72   
ref|NP_001149005.1|  aspartate aminotransferase                         236   7e-72   
gb|ACR34530.1|  unknown                                                 236   8e-72   Zea mays [maize]
prf||2009357A  Asp aminotransferase                                     236   8e-72
ref|XP_010432788.1|  PREDICTED: aspartate aminotransferase, chlor...    237   9e-72   Camelina sativa [gold-of-pleasure]
gb|AAN76499.1|AF315376_1  aspartate aminotransferase                    236   1e-71   Phaseolus vulgaris [French bean]
ref|NP_001048397.1|  Os02g0797500                                       236   1e-71   
gb|ACU24502.1|  unknown                                                 236   1e-71   Glycine max [soybeans]
emb|CDJ26231.1|  putative aspartate aminotransferase                    235   2e-71   Brassica oleracea
gb|EYU20219.1|  hypothetical protein MIMGU_mgv1a005965mg                235   2e-71   Erythranthe guttata [common monkey flower]
ref|XP_010048915.1|  PREDICTED: aspartate aminotransferase, chlor...    235   2e-71   Eucalyptus grandis [rose gum]
ref|XP_010437971.1|  PREDICTED: aspartate aminotransferase, chlor...    235   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006848765.1|  hypothetical protein AMTR_s00026p00065580          236   2e-71   Amborella trichopoda
gb|EYU20220.1|  hypothetical protein MIMGU_mgv1a005965mg                235   2e-71   Erythranthe guttata [common monkey flower]
ref|XP_007011759.1|  Aspartate aminotransferase                         235   2e-71   
ref|NP_194927.1|  aspartate aminotransferase                            235   3e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CAA56932.1|  aspartate aminotransferase                             235   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190885.1|  aspartate aminotransferase                         234   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008784801.1|  PREDICTED: aspartate aminotransferase, chlor...    234   3e-71   Phoenix dactylifera
ref|XP_006412530.1|  hypothetical protein EUTSA_v10025142mg             234   7e-71   
ref|XP_011459596.1|  PREDICTED: aspartate aminotransferase, chlor...    233   8e-71   Fragaria vesca subsp. vesca
ref|XP_009126483.1|  PREDICTED: aspartate aminotransferase, chlor...    234   9e-71   Brassica rapa
emb|CDX75211.1|  BnaA01g04910D                                          234   9e-71   
ref|XP_009407084.1|  PREDICTED: aspartate aminotransferase, chlor...    233   9e-71   
ref|XP_001785888.1|  predicted protein                                  233   1e-70   
sp|P26563.1|AATM_LUPAN  RecName: Full=Aspartate aminotransferase ...    233   2e-70   Lupinus angustifolius
dbj|BAJ97030.1|  predicted protein                                      229   2e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY13467.1|  BnaA03g51850D                                          233   2e-70   Brassica napus [oilseed rape]
emb|CDX68807.1|  BnaC01g06460D                                          234   2e-70   
gb|AAB68396.1|  aspartate aminotransferase 2 precursor                  233   3e-70   Canavalia lineata
gb|KJB65890.1|  hypothetical protein B456_010G117400                    232   3e-70   Gossypium raimondii
gb|KJB65891.1|  hypothetical protein B456_010G117400                    232   3e-70   Gossypium raimondii
gb|AAM67272.1|  aspartate aminotransferase                              231   7e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003570308.1|  PREDICTED: aspartate aminotransferase P2, mi...    231   7e-70   Brachypodium distachyon [annual false brome]
ref|NP_001031767.1|  aspartate aminotransferase                         231   1e-69   Arabidopsis thaliana [mouse-ear cress]
gb|KJB55008.1|  hypothetical protein B456_009G060500                    228   2e-69   Gossypium raimondii
dbj|BAJ92741.1|  predicted protein                                      230   2e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB55006.1|  hypothetical protein B456_009G060500                    229   4e-69   Gossypium raimondii
gb|EMS51671.1|  Aspartate aminotransferase, chloroplastic               229   4e-69   Triticum urartu
gb|KJB55007.1|  hypothetical protein B456_009G060500                    229   4e-69   Gossypium raimondii
gb|KHG15177.1|  Aspartate aminotransferase, chloroplastic -like p...    229   6e-69   Gossypium arboreum [tree cotton]
gb|EPS71467.1|  aspartate aminotransferase                              218   8e-69   Genlisea aurea
gb|EMT29046.1|  Aspartate aminotransferase, chloroplastic               229   8e-69   
emb|CDX72339.1|  BnaC07g43610D                                          228   9e-69   
dbj|BAJ96638.1|  predicted protein                                      228   1e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB55009.1|  hypothetical protein B456_009G060500                    229   1e-68   Gossypium raimondii
gb|KCW81335.1|  hypothetical protein EUGRSUZ_C02721                     228   2e-68   Eucalyptus grandis [rose gum]
ref|XP_010042868.1|  PREDICTED: aspartate aminotransferase P2, mi...    216   2e-68   Eucalyptus grandis [rose gum]
ref|XP_002972976.1|  hypothetical protein SELMODRAFT_173087             226   3e-68   
ref|XP_002993397.1|  hypothetical protein SELMODRAFT_236735             225   4e-68   
emb|CAA04697.1|  aspartate aminotransferase 2                           226   7e-68   Canavalia lineata
gb|ACG59771.1|  chloroplast aspartate aminotransferase                  219   3e-66   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011084852.1|  PREDICTED: aspartate aminotransferase, chlor...    204   4e-60   
ref|XP_008784799.1|  PREDICTED: aspartate aminotransferase, chlor...    202   6e-59   Phoenix dactylifera
gb|KHN22516.1|  Aspartate aminotransferase P2, mitochondrial            201   3e-58   Glycine soja [wild soybean]
ref|XP_005851216.1|  hypothetical protein CHLNCDRAFT_137913             184   4e-52   Chlorella variabilis
ref|XP_008784800.1|  PREDICTED: aspartate aminotransferase, chlor...    182   9e-52   
ref|XP_008784798.1|  PREDICTED: aspartate aminotransferase, chlor...    182   5e-51   
ref|XP_005642879.1|  aspartate aminotransferase                         175   2e-48   Coccomyxa subellipsoidea C-169
ref|XP_011399285.1|  Aspartate aminotransferase P2, mitochondrial       169   8e-47   Auxenochlorella protothecoides
ref|XP_009619135.1|  PREDICTED: aspartate aminotransferase, chlor...    166   4e-45   Nicotiana tomentosiformis
ref|XP_002501168.1|  aspartate aminotransferase                         164   9e-45   Micromonas commoda
ref|XP_001700039.1|  aspartate aminotransferase                         164   2e-44   Chlamydomonas reinhardtii
ref|XP_002950644.1|  aspartate aminotransferase                         160   7e-43   Volvox carteri f. nagariensis
gb|KIZ05915.1|  aspartate aminotransferase                              157   2e-42   Monoraphidium neglectum
ref|XP_003064597.1|  aspartate amino transferase                        157   7e-42   Micromonas pusilla CCMP1545
ref|XP_010527116.1|  PREDICTED: aspartate aminotransferase, chlor...    155   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_001695040.1|  aspartate aminotransferase                         155   3e-41   Chlamydomonas reinhardtii
ref|XP_002954714.1|  aspartate aminotransferase                         155   3e-41   Volvox carteri f. nagariensis
ref|XP_005843806.1|  hypothetical protein CHLNCDRAFT_59799              152   3e-40   Chlorella variabilis
gb|AAM91546.1|  aspartate aminotransferase Asp2                         143   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519716.1|  PREDICTED: aspartate aminotransferase, cytop...    147   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_005643912.1|  aspartate aminotransferase                         148   1e-38   Coccomyxa subellipsoidea C-169
ref|XP_002514283.1|  aspartate aminotransferase, putative               147   2e-38   
ref|XP_010519717.1|  PREDICTED: aspartate aminotransferase, cytop...    147   2e-38   Tarenaya hassleriana [spider flower]
tpg|DAA57534.1|  TPA: hypothetical protein ZEAMMB73_000065              140   4e-38   
ref|XP_002990136.1|  hypothetical protein SELMODRAFT_235954             146   4e-38   
ref|XP_002989786.1|  hypothetical protein SELMODRAFT_184818             146   4e-38   
ref|XP_006833326.1|  hypothetical protein AMTR_s00109p00068640          147   4e-38   Amborella trichopoda
gb|KDP33689.1|  hypothetical protein JCGZ_07260                         146   4e-38   Jatropha curcas
ref|XP_011043495.1|  PREDICTED: aspartate aminotransferase, cytop...    146   7e-38   Populus euphratica
ref|XP_011048396.1|  PREDICTED: aspartate aminotransferase, cytop...    146   7e-38   Populus euphratica
ref|XP_001771002.1|  predicted protein                                  146   7e-38   
tpg|DAA57533.1|  TPA: hypothetical protein ZEAMMB73_000065              141   7e-38   
ref|XP_007013138.1|  Aspartate aminotransferase, cytoplasmic            145   9e-38   
ref|XP_006450636.1|  hypothetical protein CICLE_v10008274mg             145   1e-37   Citrus clementina [clementine]
emb|CBI20886.3|  unnamed protein product                                145   2e-37   Vitis vinifera
ref|XP_006476088.1|  PREDICTED: aspartate aminotransferase 3, chl...    145   2e-37   Citrus sinensis [apfelsine]
ref|XP_008466236.1|  PREDICTED: aspartate aminotransferase, cytop...    145   2e-37   Cucumis melo [Oriental melon]
ref|XP_004136291.1|  PREDICTED: aspartate aminotransferase, chlor...    145   2e-37   Cucumis sativus [cucumbers]
ref|XP_010420761.1|  PREDICTED: aspartate aminotransferase, cytop...    144   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010493028.1|  PREDICTED: aspartate aminotransferase, cytop...    144   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002284136.1|  PREDICTED: aspartate aminotransferase, cytop...    145   2e-37   Vitis vinifera
ref|XP_007137184.1|  hypothetical protein PHAVU_009G106800g             144   2e-37   Phaseolus vulgaris [French bean]
ref|XP_002324997.1|  aspartate aminotransferase family protein          144   3e-37   Populus trichocarpa [western balsam poplar]
ref|XP_010454237.1|  PREDICTED: aspartate aminotransferase, cytop...    144   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006287876.1|  hypothetical protein CARUB_v10001103mg             144   3e-37   Capsella rubella
gb|AFK44136.1|  unknown                                                 138   3e-37   Medicago truncatula
emb|CDX70399.1|  BnaC03g04830D                                          144   4e-37   
ref|XP_009131210.1|  PREDICTED: aspartate aminotransferase 3, chl...    144   4e-37   Brassica rapa
sp|P37833.1|AATC_ORYSJ  RecName: Full=Aspartate aminotransferase,...    144   4e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644742.1|  PREDICTED: aspartate aminotransferase, cytop...    144   4e-37   Oryza brachyantha
gb|KHG23914.1|  Aspartate aminotransferase, chloroplastic -like p...    144   5e-37   Gossypium arboreum [tree cotton]
ref|XP_002871893.1|  hypothetical protein ARALYDRAFT_909992             144   5e-37   Arabidopsis lyrata subsp. lyrata
gb|AAL09704.1|AF419301_1  aspartate aminotransferase                    142   5e-37   Securigera parviflora
gb|KJB07521.1|  hypothetical protein B456_001G028100                    144   5e-37   Gossypium raimondii
ref|NP_001044317.1|  Os01g0760600                                       144   6e-37   
emb|CAN70394.1|  hypothetical protein VITISV_020521                     143   1e-36   Vitis vinifera
gb|KHG24168.1|  Aspartate aminotransferase, cytoplasmic                 142   1e-36   Gossypium arboreum [tree cotton]
gb|ABY58643.1|  aspartate aminotransferase                              142   1e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008789337.1|  PREDICTED: aspartate aminotransferase, cytop...    143   1e-36   Phoenix dactylifera
ref|XP_004291203.1|  PREDICTED: aspartate aminotransferase, cytop...    143   1e-36   Fragaria vesca subsp. vesca
emb|CDM84293.1|  unnamed protein product                                143   1e-36   Triticum aestivum [Canadian hard winter wheat]
gb|AAA79370.1|  aspartate aminotransferase                              142   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197456.1|  aspartate aminotransferase                            142   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AEX09182.1|  putative aspartate aminotransferase 1                   142   1e-36   Gossypium hirsutum [American cotton]
gb|KJB64944.1|  hypothetical protein B456_010G072900                    142   1e-36   Gossypium raimondii
ref|XP_004970037.1|  PREDICTED: aspartate aminotransferase, cytop...    143   2e-36   Setaria italica
ref|XP_002284313.1|  PREDICTED: aspartate aminotransferase, cytop...    142   2e-36   Vitis vinifera
ref|XP_011078312.1|  PREDICTED: aspartate aminotransferase, cytop...    142   2e-36   Sesamum indicum [beniseed]
ref|XP_010250350.1|  PREDICTED: aspartate aminotransferase, cytop...    143   2e-36   
gb|AEX09183.1|  putative aspartate aminotransferase 2                   142   2e-36   Gossypium hirsutum [American cotton]
ref|XP_007012061.1|  Aspartate aminotransferase 3                       142   2e-36   
emb|CDP03316.1|  unnamed protein product                                142   2e-36   Coffea canephora [robusta coffee]
gb|KCW81535.1|  hypothetical protein EUGRSUZ_C02894                     142   2e-36   Eucalyptus grandis [rose gum]
ref|XP_010254083.1|  PREDICTED: aspartate aminotransferase, cytop...    142   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_006352160.1|  PREDICTED: aspartate aminotransferase, cytop...    142   3e-36   Solanum tuberosum [potatoes]
ref|XP_009762342.1|  PREDICTED: aspartate aminotransferase, cytop...    142   3e-36   Nicotiana sylvestris
ref|XP_009617506.1|  PREDICTED: aspartate aminotransferase, cytop...    142   3e-36   Nicotiana tomentosiformis
ref|XP_010100270.1|  Aspartate aminotransferase                         142   3e-36   Morus notabilis
sp|P28734.1|AATC_DAUCA  RecName: Full=Aspartate aminotransferase,...    141   3e-36   Daucus carota [carrots]
ref|XP_011019648.1|  PREDICTED: aspartate aminotransferase, cytop...    142   3e-36   Populus euphratica
ref|XP_002308618.1|  aspartate transaminase family protein              142   4e-36   Populus trichocarpa [western balsam poplar]
ref|XP_010693429.1|  PREDICTED: aspartate aminotransferase, cytop...    142   4e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010920378.1|  PREDICTED: aspartate aminotransferase, cytop...    142   4e-36   Elaeis guineensis
ref|XP_009395718.1|  PREDICTED: aspartate aminotransferase, cytop...    141   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004245266.1|  PREDICTED: aspartate aminotransferase, cytop...    141   4e-36   Solanum lycopersicum
ref|XP_002873517.1|  hypothetical protein ARALYDRAFT_487989             141   6e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_006476087.1|  PREDICTED: aspartate aminotransferase 3, chl...    141   6e-36   Citrus sinensis [apfelsine]
ref|XP_006289742.1|  hypothetical protein CARUB_v10003310mg             141   6e-36   Capsella rubella
ref|XP_002516566.1|  aspartate aminotransferase, putative               141   6e-36   Ricinus communis
ref|XP_010419724.1|  PREDICTED: aspartate aminotransferase 3, chl...    141   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010453196.1|  PREDICTED: aspartate aminotransferase 3, chl...    141   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_004501184.1|  PREDICTED: aspartate aminotransferase 1-like       141   6e-36   Cicer arietinum [garbanzo]
ref|NP_196713.1|  aspartate aminotransferase 3                          141   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008361035.1|  PREDICTED: aspartate aminotransferase, cytop...    141   7e-36   
ref|XP_008352022.1|  PREDICTED: aspartate aminotransferase, cytop...    141   7e-36   
ref|XP_010491885.1|  PREDICTED: aspartate aminotransferase 3, chl...    141   7e-36   Camelina sativa [gold-of-pleasure]
gb|KDP34208.1|  hypothetical protein JCGZ_07779                         141   7e-36   Jatropha curcas
gb|KIL70778.1|  hypothetical protein M378DRAFT_183367                   140   8e-36   Amanita muscaria Koide BX008
ref|XP_007222958.1|  hypothetical protein PRUPE_ppa005315mg             141   8e-36   Prunus persica
ref|XP_008378104.1|  PREDICTED: aspartate aminotransferase, cytop...    140   8e-36   Malus domestica [apple tree]
emb|CDY44925.1|  BnaA02g04300D                                          140   8e-36   Brassica napus [oilseed rape]
gb|AAA50160.1|  aspartate aminotransferase P1                           140   8e-36   Lupinus angustifolius
ref|XP_008220042.1|  PREDICTED: aspartate aminotransferase, cytop...    141   8e-36   Prunus mume [ume]
gb|AAA33408.1|  aspartate aminotransferase P1                           140   8e-36   Lupinus angustifolius
gb|KFK25414.1|  aspartate aminotransferase                              140   8e-36   Arabis alpina [alpine rockcress]
ref|XP_003569862.1|  PREDICTED: aspartate aminotransferase, cytop...    141   8e-36   Brachypodium distachyon [annual false brome]
emb|CDP16161.1|  unnamed protein product                                140   9e-36   Coffea canephora [robusta coffee]
ref|XP_009410920.1|  PREDICTED: aspartate aminotransferase, cytop...    140   9e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT25743.1|  Aspartate aminotransferase, cytoplasmic                 140   9e-36   
ref|NP_001141224.1|  uncharacterized protein LOC100273311               140   1e-35   Zea mays [maize]
ref|XP_010049084.1|  PREDICTED: aspartate aminotransferase, cytop...    141   1e-35   
ref|XP_010688229.1|  PREDICTED: aspartate aminotransferase, cytop...    140   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006451184.1|  hypothetical protein CICLE_v10008489mg             140   1e-35   Citrus clementina [clementine]
emb|CDX92520.1|  BnaA10g15590D                                          140   1e-35   
gb|ACU21245.1|  unknown                                                 139   1e-35   Glycine max [soybeans]
ref|XP_010532471.1|  PREDICTED: aspartate aminotransferase 3, chl...    140   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_009120876.1|  PREDICTED: aspartate aminotransferase, cytop...    140   1e-35   Brassica rapa
emb|CDY65959.1|  BnaC09g54080D                                          140   1e-35   Brassica napus [oilseed rape]
gb|AAC50015.1|  aspartate aminotransferase cytosolic isozyme AAT2       140   1e-35   Glycine max [soybeans]
ref|XP_004243159.1|  PREDICTED: aspartate aminotransferase, cytop...    139   2e-35   
emb|CAA63894.1|  aspartate aminotransferase                             139   2e-35   Lotus japonicus
ref|XP_006400515.1|  hypothetical protein EUTSA_v10013703mg             139   2e-35   Eutrema salsugineum [saltwater cress]
ref|XP_009367911.1|  PREDICTED: aspartate aminotransferase, cytop...    140   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_009595013.1|  PREDICTED: aspartate aminotransferase, cytop...    139   2e-35   Nicotiana tomentosiformis
ref|NP_001237541.1|  aspartate aminotransferase glyoxysomal isozy...    139   2e-35   Glycine max [soybeans]
gb|KHN10226.1|  Aspartate aminotransferase 1                            139   3e-35   Glycine soja [wild soybean]
ref|XP_011090162.1|  PREDICTED: aspartate aminotransferase, cytop...    139   3e-35   Sesamum indicum [beniseed]
ref|XP_006399658.1|  hypothetical protein EUTSA_v10013515mg             139   3e-35   Eutrema salsugineum [saltwater cress]
gb|KDQ20317.1|  hypothetical protein BOTBODRAFT_27738                   139   3e-35   Botryobasidium botryosum FD-172 SS1
ref|XP_009367910.1|  PREDICTED: aspartate aminotransferase, cytop...    139   3e-35   Pyrus x bretschneideri [bai li]
ref|XP_006366212.1|  PREDICTED: aspartate aminotransferase, chlor...    139   3e-35   Solanum tuberosum [potatoes]
ref|XP_009782665.1|  PREDICTED: aspartate aminotransferase, cytop...    139   4e-35   Nicotiana sylvestris
ref|XP_010048107.1|  PREDICTED: aspartate aminotransferase, cytop...    138   4e-35   Eucalyptus grandis [rose gum]
ref|XP_009126373.1|  PREDICTED: aspartate aminotransferase, cytop...    138   5e-35   Brassica rapa
emb|CDY42276.1|  BnaC02g08820D                                          138   6e-35   Brassica napus [oilseed rape]
gb|KFK26196.1|  hypothetical protein AALP_AA8G215200                    137   7e-35   Arabis alpina [alpine rockcress]
gb|EYU29270.1|  hypothetical protein MIMGU_mgv1a006139mg                138   8e-35   Erythranthe guttata [common monkey flower]
gb|AFK40370.1|  unknown                                                 137   1e-34   Medicago truncatula
ref|XP_009541187.1|  hypothetical protein HETIRDRAFT_437828             137   1e-34   Heterobasidion irregulare TC 32-1
gb|KEH36022.1|  aspartate aminotransferase                              137   1e-34   Medicago truncatula
ref|XP_007298245.1|  hypothetical protein STEHIDRAFT_88821              137   1e-34   Stereum hirsutum FP-91666 SS1
gb|KDN41452.1|  hypothetical protein RSAG8_07402                        131   1e-34   Rhizoctonia solani AG-8 WAC10335
emb|CAA43779.1|  aspartate aminotransferase                             137   1e-34   Medicago sativa [alfalfa]
gb|KEH36020.1|  aspartate aminotransferase                              137   2e-34   Medicago truncatula
emb|CEL53865.1|  aspartate aminotransferase                             137   2e-34   Rhizoctonia solani AG-1 IB
emb|CDY71396.1|  BnaCnng72730D                                          133   2e-34   Brassica napus [oilseed rape]
gb|KDQ30745.1|  hypothetical protein PLEOSDRAFT_1088517                 137   2e-34   Pleurotus ostreatus PC15
emb|CAA45023.1|  aspartate aminotransferase                             136   2e-34   Panicum miliaceum [broom millet]
gb|ABR16105.1|  unknown                                                 136   3e-34   Picea sitchensis
gb|ACN40894.1|  unknown                                                 136   4e-34   Picea sitchensis
gb|KJB64945.1|  hypothetical protein B456_010G072900                    135   5e-34   Gossypium raimondii
gb|KIJ27386.1|  hypothetical protein M422DRAFT_37801                    135   5e-34   Sphaerobolus stellatus SS14
ref|XP_002308617.2|  hypothetical protein POPTR_0006s25820g             136   6e-34   
ref|XP_007378607.1|  hypothetical protein PUNSTDRAFT_109873             135   6e-34   Punctularia strigosozonata HHB-11173 SS5
gb|AFR98265.1|  aspartate aminotransferase                              135   6e-34   Cryptococcus neoformans var. grubii H99
gb|KIR97164.1|  aspartate aminotransferase                              135   7e-34   Cryptococcus gattii VGII 2001/935-1
gb|KIR78943.1|  aspartate aminotransferase                              135   7e-34   Cryptococcus gattii EJB2
ref|XP_003886076.1|  Contig An16c0190, complete genome. (Precurso...    135   9e-34   Neospora caninum Liverpool
emb|CDH50946.1|  aspartate aminotransferase                             135   9e-34   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS12997.1|  Putative Aspartate aminotransferase                    135   1e-33   Lichtheimia ramosa
sp|P28011.2|AAT1_MEDSA  RecName: Full=Aspartate aminotransferase ...    134   1e-33   Medicago sativa [alfalfa]
ref|XP_007339747.1|  hypothetical protein AURDEDRAFT_111475             134   1e-33   
gb|KJB07520.1|  hypothetical protein B456_001G028000                    133   1e-33   Gossypium raimondii
gb|KIR44346.1|  aspartate aminotransferase                              134   2e-33   Cryptococcus gattii CA1280
ref|XP_003197192.1|  aspartate transaminase                             134   2e-33   Cryptococcus gattii WM276
gb|KIR82897.1|  aspartate aminotransferase                              134   2e-33   Cryptococcus gattii VGIV IND107
gb|KIR50768.1|  aspartate aminotransferase                              134   2e-33   Cryptococcus gattii Ru294
gb|KDR10996.1|  Aspartate aminotransferase, mitochondrial               134   2e-33   Zootermopsis nevadensis
ref|XP_010048111.1|  PREDICTED: aspartate aminotransferase, cytop...    133   2e-33   
gb|AIT70256.1|  aspartate aminotransferase                              134   2e-33   Eucheuma denticulatum
gb|KFH12158.1|  aspartate aminotransferase                              133   2e-33   Toxoplasma gondii VAND
ref|XP_568366.1|  aspartate transaminase                                134   2e-33   Cryptococcus neoformans var. neoformans JEC21
gb|EPT04274.1|  hypothetical protein FOMPIDRAFT_1021952                 134   2e-33   Fomitopsis pinicola FP-58527 SS1
gb|KGB78925.1|  aspartate transaminase                                  134   2e-33   Cryptococcus gattii VGII R265
gb|AIT70257.1|  aspartate aminotransferase                              133   3e-33   
ref|XP_007860389.1|  hypothetical protein GLOTRDRAFT_53242              133   3e-33   
gb|KFG54125.1|  aspartate aminotransferase                              133   3e-33   
ref|XP_010048110.1|  PREDICTED: aspartate aminotransferase, cytop...    133   3e-33   
gb|AIT70254.1|  aspartate aminotransferase                              133   3e-33   
ref|XP_007004780.1|  hypothetical protein TREMEDRAFT_68635              133   3e-33   
gb|KJB07518.1|  hypothetical protein B456_001G028000                    133   4e-33   
ref|XP_007265164.1|  glutamic oxaloacetic transaminase AAT1             133   4e-33   
dbj|BAE99790.1|  aspartate aminotransferase                             129   4e-33   
gb|KIO08228.1|  hypothetical protein M404DRAFT_997154                   133   4e-33   
gb|AIT70250.1|  aspartate aminotransferase                              133   5e-33   
ref|XP_009112705.1|  PREDICTED: aspartate aminotransferase, cytop...    132   5e-33   
ref|XP_007318932.1|  hypothetical protein SERLADRAFT_449644             133   5e-33   
gb|KFH15985.1|  aspartate aminotransferase                              132   5e-33   
ref|XP_009401092.1|  PREDICTED: aspartate aminotransferase, chlor...    130   6e-33   
gb|KFH62511.1|  aspartate aminotransferase                              132   6e-33   
ref|XP_008883875.1|  aspartate aminotransferase                         132   6e-33   
ref|XP_011019649.1|  PREDICTED: aspartate aminotransferase, cytop...    132   7e-33   
ref|XP_005842469.1|  hypothetical protein GUITHDRAFT_83779              132   7e-33   
gb|KFG46516.1|  aspartate aminotransferase                              133   7e-33   
gb|KFG64384.1|  aspartate aminotransferase                              132   7e-33   
gb|AIT70267.1|  aspartate aminotransferase                              132   7e-33   
gb|EPR63537.1|  aspartate aminotransferase                              133   8e-33   
ref|XP_002168444.2|  PREDICTED: aspartate aminotransferase, mitoc...    132   1e-32   
gb|AIT70258.1|  aspartate aminotransferase                              132   1e-32   
gb|KII93192.1|  hypothetical protein PLICRDRAFT_35377                   132   1e-32   
gb|EMD41819.1|  hypothetical protein CERSUDRAFT_128978                  132   1e-32   
ref|XP_008033064.1|  hypothetical protein TRAVEDRAFT_109115             132   1e-32   
gb|KIK94907.1|  hypothetical protein PAXRUDRAFT_827518                  132   1e-32   
gb|KHG23915.1|  Aspartate aminotransferase, cytoplasmic                 132   1e-32   
ref|XP_002367206.1|  aspartate aminotransferase, putative               132   1e-32   
ref|XP_007012062.1|  Aspartate aminotransferase 3, putative             132   1e-32   
gb|EJT99836.1|  aspartate aminotransferase                              131   1e-32   
gb|KFG48451.1|  aspartate aminotransferase                              132   1e-32   
gb|KDQ63696.1|  hypothetical protein JAAARDRAFT_29716                   131   2e-32   
ref|XP_002680594.1|  aspartate aminotransferase                         132   2e-32   
ref|XP_002391771.1|  hypothetical protein MPER_08751                    127   2e-32   
gb|KGB35954.1|  Aspartate aminotransferase, mitochondrial               131   2e-32   
gb|EFA86317.1|  aspartate aminotransferase                              131   2e-32   
gb|KIK43563.1|  hypothetical protein CY34DRAFT_803728                   131   2e-32   
dbj|BAK02685.1|  predicted protein                                      131   2e-32   
gb|EPT25025.1|  aspartate aminotransferase                              132   2e-32   
gb|KFK40563.1|  hypothetical protein AALP_AA2G012200                    124   2e-32   
gb|AIT70252.1|  aspartate aminotransferase                              131   3e-32   
ref|XP_009058471.1|  hypothetical protein LOTGIDRAFT_217673             130   3e-32   
ref|XP_001828762.2|  aspartate Aminotransferase                         130   3e-32   
ref|XP_004356181.1|  aspartate aminotransferase                         130   3e-32   
emb|CDY34689.1|  BnaC04g19940D                                          130   4e-32   
gb|KIY47045.1|  hypothetical protein FISHEDRAFT_46081                   130   4e-32   
gb|KCW80240.1|  hypothetical protein EUGRSUZ_C01585                     130   4e-32   
gb|KJA29187.1|  hypothetical protein HYPSUDRAFT_32564                   130   4e-32   
gb|KIM66148.1|  hypothetical protein SCLCIDRAFT_1211371                 130   4e-32   
gb|KIJ21699.1|  aspartate transaminase                                  130   6e-32   
ref|XP_004339901.1|  aspartate aminotransferase, putative               130   6e-32   
ref|XP_003706300.1|  PREDICTED: aspartate aminotransferase, mitoc...    129   7e-32   
ref|XP_005705870.1|  aspartate aminotransferase                         129   8e-32   
gb|KIK71059.1|  hypothetical protein GYMLUDRAFT_33186                   129   9e-32   
ref|XP_004340638.1|  aspartate aminotransferase, cytoplasmic, put...    129   9e-32   
gb|AAA79372.1|  aspartate aminotransferase                              129   9e-32   
emb|CDO75262.1|  hypothetical protein BN946_scf184967.g15               129   9e-32   
gb|KIK06942.1|  hypothetical protein K443DRAFT_673835                   129   9e-32   
ref|NP_564803.1|  aspartate aminotransferase 4                          129   9e-32   
ref|NP_849838.1|  aspartate aminotransferase 4                          129   9e-32   
ref|XP_005822486.1|  hypothetical protein GUITHDRAFT_97799              129   1e-31   
ref|XP_001873821.1|  glutamic oxaloacetic transaminase AAT1             129   1e-31   
gb|AID18683.1|  aspartate aminotransferase                              129   1e-31   
gb|AIT70262.1|  aspartate aminotransferase                              129   1e-31   
ref|XP_011401594.1|  Aspartate aminotransferase 1                       129   1e-31   
gb|KIJ68385.1|  hypothetical protein HYDPIDRAFT_173129                  129   1e-31   
ref|XP_001655159.1|  AAEL002399-PA                                      129   1e-31   
gb|EKD02362.1|  aspartate aminotransferase                              129   1e-31   
dbj|GAN02936.1|  aspartate aminotransferase                             129   2e-31   
gb|EPB81442.1|  aspartate aminotransferase                              129   2e-31   
emb|CDJ46758.1|  aspartate aminotransferase, putative                   125   2e-31   
ref|XP_003038704.1|  hypothetical protein SCHCODRAFT_42521              128   2e-31   
ref|XP_007338662.1|  aspartate aminotransferase                         128   2e-31   
gb|KIM24154.1|  hypothetical protein M408DRAFT_76285                    128   2e-31   
ref|XP_002765977.1|  aspartate aminotransferase, cytoplasmic isoz...    125   2e-31   
ref|XP_772230.1|  hypothetical protein CNBM0360                         128   2e-31   
ref|XP_002764661.1|  aspartate aminotransferase, cytoplasmic, put...    128   2e-31   
emb|CBK20182.2|  unnamed protein product                                128   2e-31   
gb|EIE83310.1|  aspartate aminotransferase                              128   2e-31   
ref|XP_002886453.1|  hypothetical protein ARALYDRAFT_475071             128   2e-31   
emb|CEG72748.1|  Putative Aspartate aminotransferase                    128   3e-31   
gb|AIT70259.1|  aspartate aminotransferase                              128   3e-31   
gb|KEP52891.1|  aspartate aminotransferase                              128   3e-31   
emb|CEI89409.1|  Putative Aspartate aminotransferase                    128   3e-31   
ref|XP_640082.1|  aspartate aminotransferase                            128   3e-31   
gb|KIJ34684.1|  hypothetical protein M422DRAFT_213094                   128   3e-31   
ref|XP_009123404.1|  PREDICTED: aspartate aminotransferase, cytop...    127   3e-31   
ref|XP_007762781.1|  hypothetical protein CONPUDRAFT_78940              127   3e-31   
ref|XP_010473503.1|  PREDICTED: aspartate aminotransferase, cytop...    127   4e-31   
emb|CDY20276.1|  BnaC04g36800D                                          127   4e-31   
emb|CEP19900.1|  hypothetical protein                                   127   4e-31   
ref|XP_002428654.1|  aspartate aminotransferase, putative               127   4e-31   
ref|NP_998544.1|  aspartate aminotransferase 2a                         127   4e-31   
gb|EMD38441.1|  hypothetical protein CERSUDRAFT_82693                   127   4e-31   
gb|AIT70255.1|  aspartate aminotransferase                              127   4e-31   
gb|EFZ21338.1|  hypothetical protein SINV_02306                         127   4e-31   
gb|EUC63953.1|  aspartate aminotransferase                              127   5e-31   
ref|XP_011175557.1|  PREDICTED: aspartate aminotransferase, mitoc...    127   5e-31   
gb|AIT70270.1|  aspartate aminotransferase                              127   5e-31   
ref|XP_008220045.1|  PREDICTED: aspartate aminotransferase, cytop...    127   5e-31   
emb|CDY31847.1|  BnaC09g13020D                                          127   6e-31   
gb|AGR65730.1|  aspartate aminotransferase                              127   6e-31   
ref|XP_011348908.1|  PREDICTED: aspartate aminotransferase, mitoc...    127   6e-31   
ref|XP_002516565.1|  aspartate aminotransferase, putative               127   6e-31   
ref|XP_007359882.1|  PLP-dependent transferase                          127   6e-31   
gb|KDR85045.1|  hypothetical protein GALMADRAFT_218131                  127   6e-31   
gb|KIM48153.1|  hypothetical protein M413DRAFT_439876                   127   6e-31   
gb|EPZ32806.1|  Aspartate aminotransferase, mitochondrial               126   8e-31   
ref|XP_318743.3|  AGAP009685-PA                                         127   9e-31   
ref|XP_009113043.1|  PREDICTED: aspartate aminotransferase, cytop...    126   9e-31   
emb|CDY39814.1|  BnaA09g10660D                                          126   9e-31   
ref|XP_001605831.2|  PREDICTED: aspartate aminotransferase, mitoc...    127   9e-31   
gb|AFJ23640.1|  plasma membrane fatty acid binding protein              122   1e-30   
emb|CDY32206.1|  BnaA03g54610D                                          126   1e-30   
emb|CAX69569.1|  glutamate oxaloacetate transaminase 2                  126   1e-30   
ref|XP_007670159.1|  PREDICTED: aspartate aminotransferase, mitoc...    126   1e-30   
ref|XP_006454385.1|  glutamic oxaloacetic transaminase AAT1             126   1e-30   
gb|AAW26878.1|  SJCHGC06163 protein                                     126   1e-30   
gb|AFR98315.2|  aspartate aminotransferase, mitchondrial                126   1e-30   
ref|XP_011054104.1|  PREDICTED: aspartate aminotransferase, mitoc...    126   1e-30   
ref|XP_568414.1|  aspartate aminotransferase mitochondrial precursor    126   1e-30   
ref|XP_007852807.1|  aspartate aminotransferase                         126   1e-30   
ref|XP_007407231.1|  hypothetical protein MELLADRAFT_42605              126   1e-30   
gb|ESA16716.1|  hypothetical protein GLOINDRAFT_345424                  126   1e-30   
ref|XP_008347631.1|  PREDICTED: aspartate aminotransferase, cytop...    126   1e-30   
ref|XP_646849.1|  aspartate aminotransferase                            126   1e-30   
ref|XP_001848088.1|  aspartate aminotransferase                         126   1e-30   
ref|XP_006410201.1|  hypothetical protein EUTSA_v10017723mg             125   1e-30   
gb|ESA01319.1|  hypothetical protein GLOINDRAFT_338037                  126   2e-30   
ref|XP_004350746.1|  aspartate aminotransferase                         125   2e-30   
dbj|BAD93907.1|  aspartate aminotransferase                             121   2e-30   
gb|KIY72818.1|  hypothetical protein CYLTODRAFT_417594                  125   2e-30   
ref|XP_004365869.1|  aspartate aminotransferase P1                      125   2e-30   
gb|KIO33848.1|  hypothetical protein M407DRAFT_178303                   125   2e-30   
ref|XP_003331101.1|  aspartate aminotransferase, mitochondrial          125   2e-30   
gb|EGT43131.1|  hypothetical protein CAEBREN_15107                      120   2e-30   
gb|EJT48226.1|  aspartate transaminase                                  125   2e-30   
gb|AIT70268.1|  aspartate aminotransferase                              125   2e-30   
gb|KFM62856.1|  Aspartate aminotransferase, mitochondrial               121   3e-30   
gb|AIT70269.1|  aspartate aminotransferase                              125   3e-30   
ref|XP_007875099.1|  hypothetical protein PNEG_03044                    125   3e-30   
ref|XP_004337429.1|  mitochondrial aspartate aminotransferase           125   3e-30   
gb|ADP03185.1|  aspartate transaminase                                  124   3e-30   
gb|ADP03197.1|  aspartate transaminase                                  124   3e-30   
gb|ADP03191.1|  aspartate transaminase                                  124   3e-30   
gb|ADP03202.1|  aspartate transaminase                                  124   3e-30   
gb|KDE07915.1|  aspartate aminotransferase                              125   4e-30   
ref|XP_003743821.1|  PREDICTED: aspartate aminotransferase, mitoc...    125   4e-30   
ref|XP_006391820.1|  hypothetical protein EUTSA_v10023500mg             124   4e-30   
ref|XP_003402856.1|  PREDICTED: aspartate aminotransferase, mitoc...    125   4e-30   
emb|CDY46924.1|  BnaA09g12700D                                          124   4e-30   
ref|XP_006476085.1|  PREDICTED: aspartate aminotransferase, cytop...    124   4e-30   
emb|CDY10765.1|  BnaA05g11710D                                          124   5e-30   
ref|XP_002764660.1|  aspartate aminotransferase, cytoplasmic, put...    124   5e-30   
ref|XP_506013.1|  YALI0F29337p                                          124   5e-30   
gb|KGB78963.1|  aspartate aminotransferase                              124   5e-30   
gb|KIR35408.1|  aspartate aminotransferase, mitochondrial               124   6e-30   
ref|XP_005535358.1|  aspartate aminotransferase                         124   6e-30   
gb|KIR84694.1|  aspartate aminotransferase, mitochondrial               124   6e-30   
ref|XP_003197284.1|  aspartate aminotransferase, mitochondrial pr...    124   6e-30   
gb|KIR78862.1|  aspartate aminotransferase, mitochondrial               124   6e-30   
gb|KIR52756.1|  aspartate aminotransferase, mitochondrial               124   6e-30   
ref|XP_007945864.1|  PREDICTED: aspartate aminotransferase, mitoc...    124   7e-30   
gb|KFK31746.1|  hypothetical protein AALP_AA6G153700                    124   7e-30   
ref|XP_001639378.1|  predicted protein                                  124   7e-30   
gb|KIK28496.1|  hypothetical protein PISMIDRAFT_673506                  124   7e-30   
ref|XP_008464260.1|  PREDICTED: aspartate aminotransferase, mitoc...    124   7e-30   
ref|XP_008378103.1|  PREDICTED: aspartate aminotransferase, cytop...    125   7e-30   
ref|XP_008464259.1|  PREDICTED: aspartate aminotransferase, mitoc...    124   7e-30   
ref|XP_007945851.1|  PREDICTED: aspartate aminotransferase, mitoc...    124   7e-30   
ref|XP_002780423.1|  aspartate aminotransferase, putative               124   8e-30   
ref|XP_011301390.1|  PREDICTED: probable aspartate aminotransfera...    124   8e-30   
ref|XP_007132827.1|  hypothetical protein PHAVU_011G127800g             124   8e-30   
ref|XP_006410200.1|  hypothetical protein EUTSA_v10016690mg             124   8e-30   
ref|XP_001744723.1|  hypothetical protein                               124   9e-30   
ref|XP_002780422.1|  aspartate aminotransferase, putative               124   9e-30   
ref|XP_006410202.1|  hypothetical protein EUTSA_v10016910mg             122   9e-30   
gb|KIM85250.1|  hypothetical protein PILCRDRAFT_5589                    124   1e-29   
gb|KIP12008.1|  hypothetical protein PHLGIDRAFT_27620                   124   1e-29   
ref|XP_004483033.1|  PREDICTED: aspartate aminotransferase, mitoc...    124   1e-29   
gb|KIR45953.1|  aspartate aminotransferase, mitochondrial               124   1e-29   
ref|XP_006476084.1|  PREDICTED: aspartate aminotransferase, cytop...    123   1e-29   
gb|KIR59017.1|  aspartate aminotransferase, mitochondrial               124   1e-29   
gb|ADP03187.1|  aspartate transaminase                                  122   1e-29   
ref|XP_003486130.1|  PREDICTED: aspartate aminotransferase, mitoc...    123   1e-29   
ref|XP_007390433.1|  hypothetical protein PHACADRAFT_134034             123   1e-29   
gb|KIP08181.1|  hypothetical protein PHLGIDRAFT_29717                   123   1e-29   
ref|XP_003390732.1|  PREDICTED: aspartate aminotransferase, cytop...    122   1e-29   
ref|XP_010430356.1|  PREDICTED: aspartate aminotransferase, cytop...    123   1e-29   
gb|EJY78538.1|  hypothetical protein OXYTRI_24304                       123   1e-29   
ref|XP_003695956.1|  PREDICTED: probable aspartate aminotransfera...    123   1e-29   
ref|XP_011258211.1|  PREDICTED: aspartate aminotransferase, mitoc...    123   1e-29   
gb|EFA04122.1|  hypothetical protein TcasGA2_TC014364                   123   1e-29   
ref|XP_006410208.1|  hypothetical protein EUTSA_v100176310mg            121   2e-29   
ref|XP_002962134.1|  hypothetical protein SELMODRAFT_403682             123   2e-29   
ref|XP_002965036.1|  hypothetical protein SELMODRAFT_83150              123   2e-29   
gb|ETN59536.1|  aspartate aminotransferase                              123   2e-29   
gb|EPS28777.1|  hypothetical protein PDE_03723                          123   2e-29   
ref|XP_006302336.1|  hypothetical protein CARUB_v10020394mg             122   2e-29   
ref|XP_003293126.1|  aspartate aminotransferase                         123   2e-29   
ref|XP_002711597.1|  PREDICTED: aspartate aminotransferase, mitoc...    122   2e-29   
ref|XP_006609206.1|  PREDICTED: probable aspartate aminotransfera...    122   2e-29   
ref|XP_003699638.1|  PREDICTED: probable aspartate aminotransfera...    122   2e-29   
ref|XP_007395810.1|  hypothetical protein PHACADRAFT_256136             122   2e-29   
ref|XP_006005346.1|  PREDICTED: aspartate aminotransferase, mitoc...    122   2e-29   
ref|XP_011504531.1|  PREDICTED: aspartate aminotransferase, mitoc...    122   3e-29   
ref|XP_003527337.1|  PREDICTED: aspartate aminotransferase, mitoc...    122   3e-29   
ref|XP_001833338.2|  aspartate aminotransferase                         122   3e-29   
ref|XP_010246457.1|  PREDICTED: aspartate aminotransferase, mitoc...    122   3e-29   
dbj|BAO48147.2|  mitochondrial aspartate aminotransferase               121   3e-29   
ref|XP_010522086.1|  PREDICTED: aspartate aminotransferase, mitoc...    122   3e-29   
gb|KDB13308.1|  aspartate aminotransferase                              122   3e-29   
ref|XP_005899977.1|  PREDICTED: aspartate aminotransferase, mitoc...    122   3e-29   
ref|XP_002126101.1|  PREDICTED: aspartate aminotransferase, mitoc...    122   3e-29   
emb|CDM87357.1|  mitochondrial aspartate aminotransferase               121   3e-29   
ref|XP_003758636.1|  PREDICTED: aspartate aminotransferase, mitoc...    122   3e-29   
ref|XP_003493676.1|  PREDICTED: probable aspartate aminotransfera...    122   3e-29   
ref|XP_003401530.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...    122   3e-29   



>dbj|BAD02268.1| aspartate aminotransferase [Nicotiana tabacum]
Length=227

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGARIVANVVG PE F+EWKQEMEMMAGRIKSVRQKLYDSLS KDKS
Sbjct  102  KRLARPMYSNPPIHGARIVANVVGIPEFFDEWKQEMEMMAGRIKSVRQKLYDSLSAKDKS  161

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW +ILKQIGMFSFTGLNKAQSENM+NKWH+YMTKDGRISLAGLSAAKCEYLADAIID
Sbjct  162  GKDWPYILKQIGMFSFTGLNKAQSENMTNKWHVYMTKDGRISLAGLSAAKCEYLADAIID  221

Query  246  SYYNVS  229
            SYYNVS
Sbjct  222  SYYNVS  227



>ref|XP_009789886.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789887.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789888.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
Length=462

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGARIVANVVG PE F+EWKQEMEMMAGRIKSVRQKLYDSLS KDKS
Sbjct  337  KRLARPMYSNPPIHGARIVANVVGIPEFFDEWKQEMEMMAGRIKSVRQKLYDSLSTKDKS  396

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW++ILKQIGMFSFTGLNKAQSENM+NKWH+YMTKDGRISLAGLSAAKCEYLADAIID
Sbjct  397  GKDWSYILKQIGMFSFTGLNKAQSENMTNKWHVYMTKDGRISLAGLSAAKCEYLADAIID  456

Query  246  SYYNVS  229
            SYYNVS
Sbjct  457  SYYNVS  462



>ref|XP_006345635.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=469

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGA+IVANVVG PELF+EWK+EMEMMAGRIKSVRQKLYDSLS KDKS
Sbjct  344  KRLARPMYSNPPIHGAKIVANVVGTPELFSEWKEEMEMMAGRIKSVRQKLYDSLSAKDKS  403

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQSENM++KWH+YMTKDGRISLAGLSAAKCEYLADAIID
Sbjct  404  GKDWSFILKQIGMFSFTGLNKAQSENMADKWHVYMTKDGRISLAGLSAAKCEYLADAIID  463

Query  246  SYYNVS  229
            SYYNVS
Sbjct  464  SYYNVS  469



>ref|NP_001274906.1| aspartate aminotransferase, chloroplastic-like [Solanum tuberosum]
 gb|ABB55364.1| aspartate aminotransferase-like [Solanum tuberosum]
Length=462

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGA+IVANVVG PELF+EWK+EMEMMAGRIKSVRQKLYDSLS KDKS
Sbjct  337  KRLARPMYSNPPIHGAKIVANVVGTPELFSEWKEEMEMMAGRIKSVRQKLYDSLSAKDKS  396

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQSENM++KWH+YMTKDGRISLAGLSAAKCEYLADAIID
Sbjct  397  GKDWSFILKQIGMFSFTGLNKAQSENMADKWHVYMTKDGRISLAGLSAAKCEYLADAIID  456

Query  246  SYYNVS  229
            SYYNVS
Sbjct  457  SYYNVS  462



>ref|XP_010665799.1| PREDICTED: aspartate aminotransferase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGA+IVANVVGNP+LFNEWK+EMEMMAGRIKSVRQKLYD+L  KDKS
Sbjct  334  KRLARPMYSNPPVHGAKIVANVVGNPDLFNEWKEEMEMMAGRIKSVRQKLYDNLISKDKS  393

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW++ILKQIGMFSFTGLNKAQS+NM+NKWHIYMTKDGRISLAGLSAAKCEYLADAIID
Sbjct  394  GKDWSYILKQIGMFSFTGLNKAQSDNMTNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  453

Query  246  SYYNVS  229
            SYYNVS
Sbjct  454  SYYNVS  459



>ref|XP_004244943.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
 ref|XP_010324870.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
Length=462

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGA+IVANVVG PELF+EWK+EMEMMAGRIKSVRQKLYDSLS KDKS
Sbjct  337  KRLARPMYSNPPIHGAKIVANVVGTPELFSEWKEEMEMMAGRIKSVRQKLYDSLSAKDKS  396

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GK+W+FILKQIGMFSFTGL++AQSENM+NKWH+YMTKDGRISLAGLSAAKCEYLADAIID
Sbjct  397  GKNWSFILKQIGMFSFTGLDRAQSENMANKWHVYMTKDGRISLAGLSAAKCEYLADAIID  456

Query  246  SYYNVS  229
            SYYNVS
Sbjct  457  SYYNVS  462



>ref|XP_011082202.1| PREDICTED: aspartate aminotransferase, chloroplastic [Sesamum 
indicum]
Length=451

 Score =   249 bits (636),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGARIVANVVGNPELFN+WK+EME+MAGRIKSVR+KLYDSLS KD S
Sbjct  326  KRLARPMYSNPPIHGARIVANVVGNPELFNDWKEEMELMAGRIKSVRKKLYDSLSAKDNS  385

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+LKQIGMFSFTGLN AQSENM+NKWH+YMTKDGRISLAGLS+AKCEYLADAIID
Sbjct  386  GKDWSFVLKQIGMFSFTGLNDAQSENMTNKWHVYMTKDGRISLAGLSSAKCEYLADAIID  445

Query  246  SYYNVS  229
            SYYN+S
Sbjct  446  SYYNIS  451



>gb|AFK46621.1| unknown [Lotus japonicus]
Length=241

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVA++VGNP+LFNEWK EMEMMAGRIK+VRQKLYDS+S KDKS
Sbjct  116  KRIARPMYSNPPVHGARIVADIVGNPDLFNEWKAEMEMMAGRIKNVRQKLYDSISSKDKS  175

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL+QIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  176  GKDWSFILEQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  235

Query  246  SYYNVS  229
            SY+NVS
Sbjct  236  SYHNVS  241



>ref|XP_010245533.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nelumbo 
nucifera]
Length=470

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVG+P LFNEW++EME+MAGRIK+VRQKL+DSLS KDKS
Sbjct  345  KRLARPMYSNPPVHGARIVANVVGDPALFNEWREEMELMAGRIKNVRQKLFDSLSAKDKS  404

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  405  GKDWSFILKQIGMFSFTGLNKAQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  464

Query  246  SYYNVS  229
            SY+NVS
Sbjct  465  SYHNVS  470



>gb|KDO46792.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=410

 Score =   245 bits (626),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVGNP LF+EWK EMEMMAGRIK+VRQKL+DSLS KDKS
Sbjct  285  KRLARPMYSNPPVHGARIVANVVGNPALFDEWKAEMEMMAGRIKNVRQKLFDSLSAKDKS  344

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL+QIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  345  GKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  404

Query  246  SYYNVS  229
            SY+NVS
Sbjct  405  SYHNVS  410



>ref|XP_002324896.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEF03461.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+P LFNEWK EMEMMAGRIK+VRQKL+DSLS KDKS
Sbjct  341  KRIARPMYSNPPVHGARIVANVVGDPALFNEWKAEMEMMAGRIKNVRQKLFDSLSAKDKS  400

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  401  GKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  460

Query  246  SYYNVS  229
            SY+NVS
Sbjct  461  SYHNVS  466



>ref|XP_006450331.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006450332.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006483438.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483439.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR63571.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|ESR63572.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|KDO46788.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46789.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46790.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=459

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVGNP LF+EWK EMEMMAGRIK+VRQKL+DSLS KDKS
Sbjct  334  KRLARPMYSNPPVHGARIVANVVGNPALFDEWKAEMEMMAGRIKNVRQKLFDSLSAKDKS  393

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL+QIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  394  GKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  453

Query  246  SYYNVS  229
            SY+NVS
Sbjct  454  SYHNVS  459



>gb|KDO46791.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=467

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVGNP LF+EWK EMEMMAGRIK+VRQKL+DSLS KDKS
Sbjct  342  KRLARPMYSNPPVHGARIVANVVGNPALFDEWKAEMEMMAGRIKNVRQKLFDSLSAKDKS  401

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL+QIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  402  GKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  461

Query  246  SYYNVS  229
            SY+NVS
Sbjct  462  SYHNVS  467



>emb|CDP18792.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVG+PELFNEWK+EME+MAGRIKSVRQKLYDSL  KDKS
Sbjct  424  KRLARPMYSNPPVHGARIVANVVGDPELFNEWKEEMEVMAGRIKSVRQKLYDSLRAKDKS  483

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL+QIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS+AKCEYLADAI D
Sbjct  484  GKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSSAKCEYLADAIFD  543

Query  246  SYYNVS  229
            SY+NVS
Sbjct  544  SYHNVS  549



>dbj|BAD94538.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=187

 Score =   236 bits (602),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  62   KRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDKS  121

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  122  GKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIID  181

Query  246  SYYNVS  229
            SY+NVS
Sbjct  182  SYHNVS  187



>ref|XP_002309659.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE93182.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+P LFNEWK+EMEM+AGRIK+VRQKL+DSLS KDKS
Sbjct  341  KRIARPMYSNPPVHGARIVANVVGDPILFNEWKEEMEMLAGRIKNVRQKLFDSLSAKDKS  400

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  401  GKDWSFILKQIGMFSFTGLNKTQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  460

Query  246  SYYNVS  229
            SY+NVS
Sbjct  461  SYHNVS  466



>gb|KDP33541.1| hypothetical protein JCGZ_07112 [Jatropha curcas]
Length=466

 Score =   244 bits (623),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVG+P LFNEWK EMEMMAGRIK VRQKL+DSLS KDKS
Sbjct  341  KRLARPMYSNPPVHGARIVANVVGDPTLFNEWKAEMEMMAGRIKGVRQKLFDSLSAKDKS  400

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  401  GKDWSFILKQIGMFSFTGLSKTQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  460

Query  246  SYYNVS  229
            SY+NVS
Sbjct  461  SYHNVS  466



>ref|XP_011039608.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011039610.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
Length=466

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+P LFNEWK+EMEM+AGRIK+VRQKL+DSLS KDKS
Sbjct  341  KRIARPMYSNPPVHGARIVANVVGDPTLFNEWKEEMEMLAGRIKNVRQKLFDSLSAKDKS  400

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGL K QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  401  GKDWSFILKQIGMFSFTGLTKTQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  460

Query  246  SYYNVS  229
            SY+NVS
Sbjct  461  SYHNVS  466



>ref|XP_008220703.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220704.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220705.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
Length=464

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+P LF+EWK EMEMMAGRIK+VRQKLYD+L+ KDKS
Sbjct  339  KRIARPMYSNPPVHGARIVANVVGDPTLFSEWKAEMEMMAGRIKNVRQKLYDNLTAKDKS  398

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQ+ENM+NKWH+YMTKDGRISLAGLS AKCEYL+DAIID
Sbjct  399  GKDWSFILKQIGMFSFTGLNKAQTENMTNKWHVYMTKDGRISLAGLSLAKCEYLSDAIID  458

Query  246  SYYNVS  229
            SY+NVS
Sbjct  459  SYHNVS  464



>gb|AAC12674.1| aspartate aminotransferase [Lotus corniculatus]
Length=457

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVA++VGNP+LFNEWK EMEMMAGRIK+VRQKLYDS+S KDKS
Sbjct  332  KRIARPMYSNPPVHGARIVADIVGNPDLFNEWKAEMEMMAGRIKNVRQKLYDSISSKDKS  391

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  392  GKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  451

Query  246  SYYNVS  229
            SY+NVS
Sbjct  452  SYHNVS  457



>ref|XP_011036642.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
 ref|XP_011036645.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
Length=466

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNP +HGARIVANVVG+P LFNEWK EMEMMAGRIK+VRQKL+DSLS KDKS
Sbjct  341  KRIARPMYSNPSVHGARIVANVVGDPALFNEWKAEMEMMAGRIKNVRQKLFDSLSAKDKS  400

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  401  GKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  460

Query  246  SYYNVS  229
            SY+NVS
Sbjct  461  SYHNVS  466



>ref|XP_008377672.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Malus 
domestica]
Length=464

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPPIHGARIVANVVG+P LFNEWK EMEMMAGRIK VRQKLYD+L+  DKS
Sbjct  339  KRIARPMYSNPPIHGARIVANVVGDPALFNEWKAEMEMMAGRIKGVRQKLYDNLTATDKS  398

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQ+ENM+NKWH+YMTKDGRISLAGLS AKCEYL+DAIID
Sbjct  399  GKDWSFILKQIGMFSFTGLNKAQTENMTNKWHVYMTKDGRISLAGLSLAKCEYLSDAIID  458

Query  246  SYYNVS  229
            SY+NVS
Sbjct  459  SYHNVS  464



>ref|XP_007223036.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
 gb|EMJ24235.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
Length=464

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+P LF EWK EMEMMAGRIK+VRQKLYD+L+ KDKS
Sbjct  339  KRIARPMYSNPPVHGARIVANVVGDPTLFGEWKAEMEMMAGRIKNVRQKLYDNLTAKDKS  398

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQ+ENM+NKWH+YMTKDGRISLAGLS AKCEYL+DAIID
Sbjct  399  GKDWSFILKQIGMFSFTGLNKAQTENMTNKWHVYMTKDGRISLAGLSLAKCEYLSDAIID  458

Query  246  SYYNVS  229
            SY+NVS
Sbjct  459  SYHNVS  464



>gb|ACN40845.1| unknown [Picea sitchensis]
Length=453

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGA+IVANVVGNP LF+EWK EME+M+GRIK VRQ+LYD+LS KDK+
Sbjct  328  KRLARPMYSNPPVHGAQIVANVVGNPTLFDEWKSEMELMSGRIKGVRQRLYDNLSAKDKT  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+L+QIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS +KCEYLADAI+D
Sbjct  388  GKDWSFVLRQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSLSKCEYLADAIVD  447

Query  246  SYYNVS  229
            SYYNVS
Sbjct  448  SYYNVS  453



>gb|ABK24563.1| unknown [Picea sitchensis]
Length=464

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGA+IVANVVGNP LF+EWK EME+M+GRIK VRQ+LYD+LS KDK+
Sbjct  339  KRLARPMYSNPPVHGAQIVANVVGNPTLFDEWKSEMELMSGRIKGVRQRLYDNLSAKDKT  398

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+L+QIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS +KCEYLADAI+D
Sbjct  399  GKDWSFVLRQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSLSKCEYLADAIVD  458

Query  246  SYYNVS  229
            SYYNVS
Sbjct  459  SYYNVS  464



>gb|AAB46611.1| aspartate aminotransferase [Medicago sativa]
Length=455

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KDKS
Sbjct  330  KRLARPMYSNPPVHGARIVANIVGTPALFDEWKAEMEMMAGRIKTVRQALYDSISSKDKS  389

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK+QS+NM+NKWHIYMTKDGRISLAGLS AKCEYLADAIID
Sbjct  390  GKDWSFILKQIGMFSFTGLNKSQSDNMTNKWHIYMTKDGRISLAGLSLAKCEYLADAIID  449

Query  246  SYYNVS  229
            SY+NVS
Sbjct  450  SYHNVS  455



>prf||1908424A Asp aminotransferase
Length=465

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KDKS
Sbjct  340  KRLARPMYSNPPVHGARIVANIVGTPALFDEWKAEMEMMAGRIKTVRQALYDSISSKDKS  399

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK+QS+NM+NKWHIYMTKDGRISLAGLS AKCEYLADAIID
Sbjct  400  GKDWSFILKQIGMFSFTGLNKSQSDNMTNKWHIYMTKDGRISLAGLSLAKCEYLADAIID  459

Query  246  SYYNVS  229
            SY+NVS
Sbjct  460  SYHNVS  465



>gb|KEH39860.1| aspartate aminotransferase [Medicago truncatula]
Length=465

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KDKS
Sbjct  340  KRLARPMYSNPPVHGARIVANIVGTPALFDEWKAEMEMMAGRIKTVRQALYDSISSKDKS  399

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK+QS+NM+NKWHIYMTKDGRISLAGLS AKCEYLADAIID
Sbjct  400  GKDWSFILKQIGMFSFTGLNKSQSDNMTNKWHIYMTKDGRISLAGLSLAKCEYLADAIID  459

Query  246  SYYNVS  229
            SY+NVS
Sbjct  460  SYHNVS  465



>ref|XP_010942149.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=454

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVG+P LFNEWKQEME+MAGRIK+VRQ+L+D LS KDKS
Sbjct  329  KRLARPMYSNPPVHGARIVANVVGDPTLFNEWKQEMELMAGRIKNVRQRLFDYLSRKDKS  388

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQSE+M+NKWH+YMTKDGRISLAGLS +KCEYLADAIID
Sbjct  389  GKDWSFILKQIGMFSFTGLNKAQSEHMTNKWHVYMTKDGRISLAGLSLSKCEYLADAIID  448

Query  246  SYYNVS  229
            S++NVS
Sbjct  449  SFHNVS  454



>ref|XP_006283713.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
 gb|EOA16611.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
Length=453

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+P +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDPTMFGEWKAEMEMMAGRIKTVRQELYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAIID  447

Query  246  SYYNVS  229
            SY+NVS
Sbjct  448  SYHNVS  453



>ref|XP_010942150.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=438

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVG+P LFNEWKQEME+MAGRIK+VRQ+L+D LS KDKS
Sbjct  313  KRLARPMYSNPPVHGARIVANVVGDPTLFNEWKQEMELMAGRIKNVRQRLFDYLSRKDKS  372

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQSE+M+NKWH+YMTKDGRISLAGLS +KCEYLADAIID
Sbjct  373  GKDWSFILKQIGMFSFTGLNKAQSEHMTNKWHVYMTKDGRISLAGLSLSKCEYLADAIID  432

Query  246  SYYNVS  229
            S++NVS
Sbjct  433  SFHNVS  438



>ref|XP_007161154.1| hypothetical protein PHAVU_001G0470000g, partial [Phaseolus vulgaris]
 gb|ESW33148.1| hypothetical protein PHAVU_001G0470000g, partial [Phaseolus vulgaris]
Length=261

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVA+VVGNP LFNEW+ EMEMMAGRIK+VRQ+LY+S++ KD S
Sbjct  136  KRLARPMYSNPPVHGARIVADVVGNPVLFNEWRAEMEMMAGRIKNVRQQLYNSITSKDNS  195

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK Q++NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  196  GKDWSFILKQIGMFSFTGLNKEQTDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  255

Query  246  SYYNVS  229
            SY+NVS
Sbjct  256  SYHNVS  261



>ref|XP_002515455.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF46904.1| aspartate aminotransferase, putative [Ricinus communis]
Length=464

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  LFNEWK EMEMMAGRIK VRQKLYDSLS KDKS
Sbjct  339  KRIARPMYSNPPVHGARIVANVVGDQSLFNEWKDEMEMMAGRIKGVRQKLYDSLSAKDKS  398

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFS+TGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  399  GKDWSFILKQIGMFSYTGLNKTQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  458

Query  246  SYYNVS  229
            SY+NVS
Sbjct  459  SYHNVS  464



>ref|NP_001237987.1| aspartate aminotransferase [Glycine max]
 gb|AAA33942.1| aspartate aminotransferase [Glycine max]
Length=463

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KDKS
Sbjct  338  KRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKDKS  397

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  398  GKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  457

Query  246  SYYNVS  229
            SY+NVS
Sbjct  458  SYHNVS  463



>ref|XP_006600243.1| PREDICTED: aspartate aminotransferase isoform X1 [Glycine max]
Length=463

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KDKS
Sbjct  338  KRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKDKS  397

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  398  GKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  457

Query  246  SYYNVS  229
            SY+NVS
Sbjct  458  SYHNVS  463



>ref|XP_010089944.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB38640.1| Aspartate aminotransferase [Morus notabilis]
Length=482

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGARIVANVVG+P LFNEWK EME+MAGRIK+VRQKLYDSL  KDKS
Sbjct  357  KRLARPMYSNPPIHGARIVANVVGDPVLFNEWKAEMELMAGRIKNVRQKLYDSLCAKDKS  416

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLN+AQS+ M+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  417  GKDWSFILKQIGMFSFTGLNEAQSDKMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  476

Query  246  SYYNVS  229
            S++NVS
Sbjct  477  SFHNVS  482



>ref|XP_004498776.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Cicer arietinum]
Length=467

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KDKS
Sbjct  342  KRLARPMYSNPPVHGARIVANIVGTPALFDEWKAEMEMMAGRIKNVRQALYDSISSKDKS  401

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK QS+NM+NKWHIYMTKDGRISLAGLS AKCEYLADAIID
Sbjct  402  GKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHIYMTKDGRISLAGLSLAKCEYLADAIID  461

Query  246  SYYNVS  229
            SY+NVS
Sbjct  462  SYHNVS  467



>gb|ABR16448.1| unknown [Picea sitchensis]
Length=410

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGA+IVANVVGNP LF+EWK EME+M+GRIK VRQ+LY +LS KDKS
Sbjct  285  KRLARPMYSNPPVHGAQIVANVVGNPVLFDEWKSEMELMSGRIKGVRQRLYANLSAKDKS  344

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+L+QIGMFSFTGLNKAQSENMS+KWHIYMTKDGRISLAGLS +KCEYLADAIID
Sbjct  345  GKDWSFVLRQIGMFSFTGLNKAQSENMSSKWHIYMTKDGRISLAGLSLSKCEYLADAIID  404

Query  246  SYYNVS  229
            SYYNVS
Sbjct  405  SYYNVS  410



>ref|XP_003544600.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006596081.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X2 [Glycine max]
 gb|KHN04158.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KDKS
Sbjct  338  KRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKDKS  397

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLN  QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  398  GKDWSFILKQIGMFSFTGLNTNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  457

Query  246  SYYNVS  229
            SY+NVS
Sbjct  458  SYHNVS  463



>ref|XP_006412529.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412531.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412532.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53982.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53984.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53985.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=453

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQKLYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDAAMFGEWKAEMEMMAGRIKTVRQKLYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  447

Query  246  SYYNVS  229
            SY+NVS
Sbjct  448  SYHNVS  453



>ref|XP_008445250.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Cucumis melo]
Length=410

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVAN+VG+P LFNEWK EMEMMAGRIK+VRQKLYDSL  KDKS
Sbjct  285  KRLARPMYSNPPVHGARIVANIVGDPALFNEWKAEMEMMAGRIKNVRQKLYDSLCAKDKS  344

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGL+K QS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  345  GKDWSFILKQIGMFSFTGLSKVQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIID  404

Query  246  SYYNV  232
            S++NV
Sbjct  405  SFHNV  409



>emb|CAN76227.1| hypothetical protein VITISV_000267 [Vitis vinifera]
Length=462

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPPIHGARIVANVVG+P LFNEWK+EME+MAGRIK+VRQKL+DSLS KDK 
Sbjct  337  KRIARPMYSNPPIHGARIVANVVGDPALFNEWKEEMELMAGRIKNVRQKLFDSLSAKDKC  396

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  397  GKDWSFILKQIGMFSFTGLSKVQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  456

Query  246  SYYNVS  229
            S++ VS
Sbjct  457  SFHCVS  462



>ref|XP_002285385.1| PREDICTED: aspartate aminotransferase, chloroplastic [Vitis vinifera]
 emb|CBI21095.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPPIHGARIVANVVG+P LFNEWK+EME+MAGRIK+VRQKL+DSLS KDK 
Sbjct  337  KRIARPMYSNPPIHGARIVANVVGDPALFNEWKEEMELMAGRIKNVRQKLFDSLSAKDKC  396

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  397  GKDWSFILKQIGMFSFTGLSKVQSENMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  456

Query  246  SYYNVS  229
            S++ VS
Sbjct  457  SFHCVS  462



>gb|AAB26677.2| aspartate aminotransferase isozyme 5 (chloroplast) [Glycine max]
Length=463

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KDKS
Sbjct  338  KRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKDKS  397

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRIS AGLS AKCEYLADAIID
Sbjct  398  GKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISSAGLSLAKCEYLADAIID  457

Query  246  SYYNVS  229
            SY+NVS
Sbjct  458  SYHNVS  463



>dbj|BAA08106.1| plastidic aspartate aminotransferase [Panicum miliaceum]
Length=457

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGARIVAN+VG+P +F EWKQEME MAGRIK+VRQKLYDSLS KDKS
Sbjct  332  KRLARPMYSNPPIHGARIVANIVGDPTMFGEWKQEMEQMAGRIKNVRQKLYDSLSAKDKS  391

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL+QIGMFS+TGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKC+YLADAIID
Sbjct  392  GKDWSFILRQIGMFSYTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCDYLADAIID  451

Query  246  SYYNVS  229
            S++NVS
Sbjct  452  SFHNVS  457



>ref|XP_004954233.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Setaria 
italica]
Length=458

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS+KDKS
Sbjct  333  KRLARPMYSNPPIHGARIVANVVGDPTMFGEWKQEMEQMAGRIKNVRQKLYDSLSVKDKS  392

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL+QIGMFS+TGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKC+YLADAIID
Sbjct  393  GKDWSFILRQIGMFSYTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCDYLADAIID  452

Query  246  SYYNVS  229
            S++NV+
Sbjct  453  SFHNVN  458



>ref|XP_010432789.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=453

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQELYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAIID  447

Query  246  SYYNVS  229
            SY+NVS
Sbjct  448  SYHNVS  453



>ref|XP_010447459.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Camelina 
sativa]
Length=453

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQELYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  447

Query  246  SYYNVS  229
            SY+NVS
Sbjct  448  SYHNVS  453



>ref|XP_002867266.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43525.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQKLYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDATMFSEWKAEMEMMAGRIKTVRQKLYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIID  447

Query  246  SYYNVS  229
            SY+NVS
Sbjct  448  SYHNVS  453



>gb|AAO23563.1| aspartate aminotransferase [Oryza sativa]
Length=414

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS KD S
Sbjct  289  KRLARPMYSNPPIHGARIVANVVGDPTMFGEWKQEMEEMAGRIKNVRQKLYDSLSAKDDS  348

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL+QIGMFS+TGLNK QS+NM++KWHIYMTKDGRISLAGLS AKCEYLADAIID
Sbjct  349  GKDWSFILRQIGMFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAGLSLAKCEYLADAIID  408

Query  246  SYYNVS  229
            S++NVS
Sbjct  409  SFHNVS  414



>ref|XP_008445249.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Cucumis melo]
Length=465

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVAN+VG+P LFNEWK EMEMMAGRIK+VRQKLYDSL  KDKS
Sbjct  340  KRLARPMYSNPPVHGARIVANIVGDPALFNEWKAEMEMMAGRIKNVRQKLYDSLCAKDKS  399

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGL+K QS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  400  GKDWSFILKQIGMFSFTGLSKVQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIID  459

Query  246  SYYNV  232
            S++NV
Sbjct  460  SFHNV  464



>ref|XP_009138057.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Brassica 
rapa]
Length=453

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQRLYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAIID  447

Query  246  SYYNVS  229
            SY+NVS
Sbjct  448  SYHNVS  453



>ref|XP_004138711.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004160763.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN62979.1| hypothetical protein Csa_2G382520 [Cucumis sativus]
Length=464

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVAN+VG+P LFNEWK EMEMMAGRIK+VRQKLYDSL  KDKS
Sbjct  339  KRLARPMYSNPPVHGARIVANIVGDPALFNEWKAEMEMMAGRIKNVRQKLYDSLCAKDKS  398

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGL+K QS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  399  GKDWSFILKQIGMFSFTGLSKVQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIID  458

Query  246  SYYNV  232
            S++NV
Sbjct  459  SFHNV  463



>ref|XP_006648055.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Oryza 
brachyantha]
Length=422

 Score =   236 bits (601),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS KD S
Sbjct  297  KRLARPMYSNPPIHGARIVANVVGDPTMFGEWKQEMEEMAGRIKNVRQKLYDSLSAKDNS  356

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL+QIGMFS+TGLNK QS+NM++KWHIYMTKDGRISLAGLS AKCEYLADAIID
Sbjct  357  GKDWSFILRQIGMFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAGLSLAKCEYLADAIID  416

Query  246  SYYNVS  229
            S++NVS
Sbjct  417  SFHNVS  422



>ref|NP_001149005.1| aspartate aminotransferase [Zea mays]
 gb|ACG33777.1| aspartate aminotransferase [Zea mays]
Length=459

 Score =   236 bits (603),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGA+IVANVVG+P +F EWKQEME+MAGRIK+VRQKLYDSLS KDKS
Sbjct  334  KRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKQEMELMAGRIKNVRQKLYDSLSAKDKS  393

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL+QIGMFS+TGLNKAQS+NM++KWHIYMTKDGRISLAGLS AKC+YLADAIID
Sbjct  394  GKDWSFILRQIGMFSYTGLNKAQSDNMTDKWHIYMTKDGRISLAGLSLAKCDYLADAIID  453

Query  246  SYYNVS  229
            S++NV+
Sbjct  454  SFHNVN  459



>gb|ACR34530.1| unknown [Zea mays]
 gb|AFW73875.1| glutamate-oxaloacetate transaminase2 [Zea mays]
Length=459

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGA+IVANVVG+P +F EWKQEME+MAGRIK+VRQKLYDSLS KDKS
Sbjct  334  KRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKQEMELMAGRIKNVRQKLYDSLSAKDKS  393

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL+QIGMFS+TGLNKAQS+NM++KWHIYMTKDGRISLAGLS AKC+YLADAIID
Sbjct  394  GKDWSFILRQIGMFSYTGLNKAQSDNMTDKWHIYMTKDGRISLAGLSLAKCDYLADAIID  453

Query  246  SYYNVS  229
            S++NV+
Sbjct  454  SFHNVN  459



>prf||2009357A Asp aminotransferase
Length=463

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 1/127 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+VRQ LYDS+S KDKS
Sbjct  337  KRLARPMYSNPPVHGARIVANIVGTPALFDEWKAEMEMMAGRIKTVRQALYDSISSKDKS  396

Query  426  GKDWTFILKQIGMFSFTGLNKAQSEN-MSNKWHIYMTKDGRISLAGLSAAKCEYLADAII  250
            GKDW+FILKQIGMFSFTGLNK+QS+N M+NKWHIYMTKDGRISLAGLS AKCEYLADAII
Sbjct  397  GKDWSFILKQIGMFSFTGLNKSQSDNMMTNKWHIYMTKDGRISLAGLSLAKCEYLADAII  456

Query  249  DSYYNVS  229
            DSY+NVS
Sbjct  457  DSYHNVS  463



>ref|XP_010432788.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=495

 Score =   237 bits (605),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  370  KRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQELYDSLVSKDKS  429

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  430  GKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAIID  489

Query  246  SYYNVS  229
            SY+NVS
Sbjct  490  SYHNVS  495



>gb|AAN76499.1|AF315376_1 aspartate aminotransferase [Phaseolus vulgaris]
Length=461

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVA+VVGNP LFNEW+ EMEMMAGRIK+VRQ+LY+S++ KD S
Sbjct  336  KRLARPMYSNPPVHGARIVADVVGNPVLFNEWRAEMEMMAGRIKNVRQQLYNSITSKDNS  395

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK Q++NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  396  GKDWSFILKQIGMFSFTGLNKEQTDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  455

Query  246  SYYNVS  229
            SY+NVS
Sbjct  456  SYHNVS  461



>ref|NP_001048397.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAD19094.1| putative aspartate transaminase [Oryza sativa Japonica Group]
 dbj|BAF10311.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAG97085.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74177.1| hypothetical protein OsI_09291 [Oryza sativa Indica Group]
 gb|EEE57981.1| hypothetical protein OsJ_08730 [Oryza sativa Japonica Group]
Length=458

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS KD S
Sbjct  333  KRLARPMYSNPPIHGARIVANVVGDPTMFGEWKQEMEEMAGRIKNVRQKLYDSLSAKDDS  392

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL+QIGMFS+TGLNK QS+NM++KWHIYMTKDGRISLAGLS AKCEYLADAIID
Sbjct  393  GKDWSFILRQIGMFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAGLSLAKCEYLADAIID  452

Query  246  SYYNVS  229
            S++NVS
Sbjct  453  SFHNVS  458



>gb|ACU24502.1| unknown [Glycine max]
Length=463

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KDKS
Sbjct  338  KRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKDKS  397

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFT LNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  398  GKDWSFILKQIGMFSFTSLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  457

Query  246  SYYNV  232
            SY+NV
Sbjct  458  SYHNV  462



>emb|CDJ26231.1| putative aspartate aminotransferase [Brassica oleracea]
Length=453

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +FNEWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDAAMFNEWKAEMEMMAGRIKTVRQQLYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAIID  447

Query  246  SYYNVS  229
            S++NVS
Sbjct  448  SHHNVS  453



>gb|EYU20219.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=463

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGARIVAN+VGN +LF+EWK+EM  MAGRIKSVR+KLYDSL  KD S
Sbjct  338  KRLARPMYSNPPIHGARIVANIVGNSDLFSEWKEEMASMAGRIKSVRKKLYDSLCAKDNS  397

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS+A CEYLADAIID
Sbjct  398  GKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSSANCEYLADAIID  457

Query  246  SYYNVS  229
            SY+NVS
Sbjct  458  SYHNVS  463



>ref|XP_010048915.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW81333.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
 gb|KCW81334.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
Length=462

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGA+IVAN+V +P LFNEWK EMEMMAGRIK+VRQKLYDSLS KDKS
Sbjct  337  KRLARPMYSNPPVHGAKIVANIVSDPALFNEWKAEMEMMAGRIKNVRQKLYDSLSAKDKS  396

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAGL+ AKCE LADAI+D
Sbjct  397  GKDWSFILKQIGMFSFTGLSKTQSENMTNKWHVYMTKDGRISLAGLNLAKCEDLADAIVD  456

Query  246  SYYNVS  229
            SY+NVS
Sbjct  457  SYHNVS  462



>ref|XP_010437971.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
 ref|XP_010437972.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
Length=453

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQELYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAIID  447

Query  246  SYYNVS  229
            SY+NVS
Sbjct  448  SYHNVS  453



>ref|XP_006848765.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
 gb|ERN10346.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
Length=469

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVG+P LF+EWK EME MAGRIKSVR++L+++LS KDKS
Sbjct  344  KRLARPMYSNPPVHGARIVANVVGDPALFSEWKSEMEFMAGRIKSVRKRLFENLSQKDKS  403

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS +KCEYLADAIID
Sbjct  404  GKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLSKCEYLADAIID  463

Query  246  SYYNVS  229
            SY+NV+
Sbjct  464  SYHNVN  469



>gb|EYU20220.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=462

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGARIVAN+VGN +LF+EWK+EM  MAGRIKSVR+KLYDSL  KD S
Sbjct  337  KRLARPMYSNPPIHGARIVANIVGNSDLFSEWKEEMASMAGRIKSVRKKLYDSLCAKDNS  396

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS+A CEYLADAIID
Sbjct  397  GKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSSANCEYLADAIID  456

Query  246  SYYNVS  229
            SY+NVS
Sbjct  457  SYHNVS  462



>ref|XP_007011759.1| Aspartate aminotransferase [Theobroma cacao]
 gb|EOY29378.1| Aspartate aminotransferase [Theobroma cacao]
Length=464

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+P LF EW  EMEMMAGRIK+VRQKL+DSLS KDKS
Sbjct  339  KRIARPMYSNPPVHGARIVANVVGDPALFKEWNVEMEMMAGRIKNVRQKLFDSLSSKDKS  398

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  399  GKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  458

Query  246  SYYNV  232
            SY+NV
Sbjct  459  SYHNV  463



>ref|NP_194927.1| aspartate aminotransferase [Arabidopsis thaliana]
 ref|NP_849483.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46248.2|AAT5_ARATH RecName: Full=Aspartate aminotransferase, chloroplastic; AltName: 
Full=Transaminase A; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16590.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB79917.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAK96851.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAM10068.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19775.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85987.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85988.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIID  447

Query  246  SYYNVS  229
            SY+NVS
Sbjct  448  SYHNVS  453



>emb|CAA56932.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAA62972.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIID  447

Query  246  SYYNVS  229
            SY+NVS
Sbjct  448  SYHNVS  453



>ref|NP_001190885.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85990.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=448

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  323  KRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDKS  382

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  383  GKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIID  442

Query  246  SYYNVS  229
            SY+NVS
Sbjct  443  SYHNVS  448



>ref|XP_008784801.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Phoenix 
dactylifera]
Length=454

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVG+P LFNEWKQEME+MAGRIK+VRQ+L+D LS KDKS
Sbjct  329  KRLARPMYSNPPVHGARIVANVVGDPTLFNEWKQEMELMAGRIKNVRQRLFDYLSQKDKS  388

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS++M+NKW +YMTKDGRISLAGLS +KCEYLADAI+D
Sbjct  389  GKDWSFILKQIGMFSFTGLNKAQSDHMTNKWRVYMTKDGRISLAGLSLSKCEYLADAIMD  448

Query  246  SYYNVS  229
            S++NVS
Sbjct  449  SFHNVS  454



>ref|XP_006412530.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53983.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=462

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQKLYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDAAMFGEWKAEMEMMAGRIKTVRQKLYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  447

Query  246  SYYN  235
            SY+N
Sbjct  448  SYHN  451



>ref|XP_011459596.1| PREDICTED: aspartate aminotransferase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   233 bits (595),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGA+IVAN+VG+P LF EWK EMEMMAGRIK+VRQKLYDSL  KDKS
Sbjct  328  KRLARPMYSNPPIHGAKIVANIVGDPTLFGEWKAEMEMMAGRIKNVRQKLYDSLCAKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLN  Q+ENM+ KWH++MTKDGRISLAGL+ AKCEYL+DAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNTTQTENMTKKWHVFMTKDGRISLAGLNLAKCEYLSDAIID  447

Query  246  SYYNVS  229
            SY+NVS
Sbjct  448  SYHNVS  453



>ref|XP_009126483.1| PREDICTED: aspartate aminotransferase, chloroplastic [Brassica 
rapa]
Length=462

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +FNEWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDAAMFNEWKAEMEMMAGRIKTVRQQLYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAIID  447

Query  246  SYYN  235
            SY+N
Sbjct  448  SYHN  451



>emb|CDX75211.1| BnaA01g04910D [Brassica napus]
Length=462

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +FNEWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDAAMFNEWKAEMEMMAGRIKTVRQQLYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAIID  447

Query  246  SYYN  235
            SY+N
Sbjct  448  SYHN  451



>ref|XP_009407084.1| PREDICTED: aspartate aminotransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   233 bits (593),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVG+P LFNEWKQEME+MAGRIK+VRQ+LY++LS KDKS
Sbjct  300  KRLARPMYSNPPVHGARIVANVVGDPNLFNEWKQEMELMAGRIKNVRQRLYENLSQKDKS  359

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+LKQIGMFS+TGL+KAQS++M++KWHIYMTKDGRISLAGLS +KCEYLADAIID
Sbjct  360  GKDWSFVLKQIGMFSYTGLHKAQSDHMTDKWHIYMTKDGRISLAGLSLSKCEYLADAIID  419

Query  246  SYYNV  232
            S++NV
Sbjct  420  SFHNV  424



>ref|XP_001785888.1| predicted protein [Physcomitrella patens]
 gb|EDQ49297.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG P +F+EW+ EM+MMAGRIK+VRQ+LYD LS KDKS
Sbjct  336  KRIARPMYSNPPVHGARIVANVVGEPTMFDEWRAEMQMMAGRIKTVRQRLYDELSTKDKS  395

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+LKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGL+ AKC YLADAIID
Sbjct  396  GKDWSFVLKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLNLAKCAYLADAIID  455

Query  246  SYYNV  232
            SYYN+
Sbjct  456  SYYNI  460



>sp|P26563.1|AATM_LUPAN RecName: Full=Aspartate aminotransferase P2, mitochondrial; AltName: 
Full=Transaminase A; Flags: Precursor, partial [Lupinus 
angustifolius]
 emb|CAA42430.1| aspartate aminotransferase [Lupinus angustifolius]
Length=454

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVA++VGNP LF+EWK EMEMMAGRIK+VRQ+LYDS+S KDKS
Sbjct  329  KRIARPMYSNPPVHGARIVADIVGNPALFDEWKVEMEMMAGRIKNVRQQLYDSISSKDKS  388

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFS+TGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  389  GKDWSFILKQIGMFSYTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  448

Query  246  SYYNVS  229
            S++ VS
Sbjct  449  SFHYVS  454



>dbj|BAJ97030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=345

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD+S
Sbjct  220  KRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQS  279

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAIID
Sbjct  280  GKDWSFILSQIGMFSFTGLNRTQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAIID  339

Query  246  SYYNVS  229
            S++NV+
Sbjct  340  SFHNVN  345



>emb|CDY13467.1| BnaA03g51850D [Brassica napus]
Length=454

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 119/127 (94%), Gaps = 1/127 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQRLYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKA-QSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAII  250
            GKDW+FILKQIGMFSFTGLNKA QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAII
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAII  447

Query  249  DSYYNVS  229
            DSY+NVS
Sbjct  448  DSYHNVS  454



>emb|CDX68807.1| BnaC01g06460D [Brassica napus]
Length=513

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +FNEWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  379  KRIARPMYSNPPVHGARIVANVVGDAAMFNEWKAEMEMMAGRIKTVRQQLYDSLVSKDKS  438

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  439  GKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSMAKCEYLADAIID  498

Query  246  SYYN  235
            SY+N
Sbjct  499  SYHN  502



>gb|AAB68396.1| aspartate aminotransferase 2 precursor [Canavalia lineata]
Length=465

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVA++VGNP LF EWK  MEMMAGRIK+VRQ LYDS+S KDKS
Sbjct  340  KRIARPMYSNPPVHGARIVADLVGNPLLFEEWKAFMEMMAGRIKNVRQLLYDSISSKDKS  399

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  400  GKDWSFILKQIGMFSFTGLNKEQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  459

Query  246  SYYNVS  229
            SY+NVS
Sbjct  460  SYHNVS  465



>gb|KJB65890.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KDKS
Sbjct  335  KRIARPMYSNPPVHGARIVANIVGDSALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKS  394

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  395  GKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  454

Query  246  SYYNVS  229
            SY+NVS
Sbjct  455  SYHNVS  460



>gb|KJB65891.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KDKS
Sbjct  335  KRIARPMYSNPPVHGARIVANIVGDSALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKS  394

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  395  GKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  454

Query  246  SYYNVS  229
            SY+NVS
Sbjct  455  SYHNVS  460



>gb|AAM67272.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   231 bits (589),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK+QS+NM++KWH+Y TKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKSQSDNMTDKWHVYXTKDGRISLAGLSLAKCEYLADAIID  447

Query  246  SYYNVS  229
            SY+NVS
Sbjct  448  SYHNVS  453



>ref|XP_003570308.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Brachypodium 
distachyon]
Length=455

 Score =   231 bits (589),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGARIVANVVG+P +F EWKQEME MAGRIK+VRQKLYDSLS KD+S
Sbjct  330  KRLARPMYSNPPIHGARIVANVVGDPTMFGEWKQEMEQMAGRIKNVRQKLYDSLSAKDQS  389

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL QIGMFS+TGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAIID
Sbjct  390  GKDWSFILSQIGMFSYTGLNRNQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAIID  449

Query  246  SYYNVS  229
            S++NV+
Sbjct  450  SFHNVN  455



>ref|NP_001031767.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19688.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85989.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=462

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIID  447

Query  246  SYYN  235
            SY+N
Sbjct  448  SYHN  451



>gb|KJB55008.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=396

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KDKS
Sbjct  271  KRIARPMYSNPPVHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKS  330

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  331  GKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  390

Query  246  SYYNVS  229
            SY+N S
Sbjct  391  SYHNGS  396



>dbj|BAJ92741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD+S
Sbjct  332  KRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQS  391

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAIID
Sbjct  392  GKDWSFILSQIGMFSFTGLNRTQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAIID  451

Query  246  SYYNVS  229
            S++NV+
Sbjct  452  SFHNVN  457



>gb|KJB55006.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=464

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KDKS
Sbjct  339  KRIARPMYSNPPVHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKS  398

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  399  GKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  458

Query  246  SYYNVS  229
            SY+N S
Sbjct  459  SYHNGS  464



>gb|EMS51671.1| Aspartate aminotransferase, chloroplastic [Triticum urartu]
Length=468

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD+S
Sbjct  343  KRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQS  402

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAIID
Sbjct  403  GKDWSFILSQIGMFSFTGLNRPQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAIID  462

Query  246  SYYNVS  229
            S++NV+
Sbjct  463  SFHNVN  468



>gb|KJB55007.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=468

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KDKS
Sbjct  343  KRIARPMYSNPPVHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKS  402

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  403  GKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  462

Query  246  SYYNVS  229
            SY+N S
Sbjct  463  SYHNGS  468



>gb|KHG15177.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=464

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS +DKS
Sbjct  339  KRIARPMYSNPPVHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRDKLFDSLSSEDKS  398

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+LKQIGMFSFTGLNKAQ +NM+ KWHIYMTKDGRISLAGLS AKCEYLADAIID
Sbjct  399  GKDWSFVLKQIGMFSFTGLNKAQCDNMTTKWHIYMTKDGRISLAGLSLAKCEYLADAIID  458

Query  246  SYYNVS  229
            SY+NVS
Sbjct  459  SYHNVS  464



>gb|EPS71467.1| aspartate aminotransferase, partial [Genlisea aurea]
Length=133

 Score =   218 bits (555),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVGNP+LF EWK EME+MAGRIKSVR+ LY+ LS  D +
Sbjct  10   KRIARPMYSNPPVHGARIVANVVGNPDLFKEWKDEMEVMAGRIKSVRKLLYEELSRSDGT  69

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL+QIGMFSFTGLNK QSE M+ KWH+YMTKDGRISLAGLS+AKC YLA AI+D
Sbjct  70   GKDWSFILRQIGMFSFTGLNKEQSEKMTGKWHVYMTKDGRISLAGLSSAKCSYLAGAIVD  129

Query  246  SYYN  235
            SY+N
Sbjct  130  SYHN  133



>gb|EMT29046.1| Aspartate aminotransferase, chloroplastic [Aegilops tauschii]
Length=483

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD+S
Sbjct  358  KRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTEKDQS  417

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAIID
Sbjct  418  GKDWSFILSQIGMFSFTGLNRPQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAIID  477

Query  246  SYYNVS  229
            S++NV+
Sbjct  478  SFHNVN  483



>emb|CDX72339.1| BnaC07g43610D [Brassica napus]
Length=461

 Score =   228 bits (582),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVANVVG+  +F EWK EMEMMAGRIK+VRQ+LYDSL  KDKS
Sbjct  328  KRIARPMYSNPPVHGARIVANVVGDATMFGEWKAEMEMMAGRIKTVRQRLYDSLVSKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKA-QSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAII  250
            GKDW+FILKQIGMFSFTGLNKA QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAII
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQQSDNMTNKWHVYMTKDGRISLAGLSMAKCEYLADAII  447

Query  249  DSYYN  235
            DSY+N
Sbjct  448  DSYHN  452



>dbj|BAJ96638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD+S
Sbjct  332  KRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQS  391

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLA+AIID
Sbjct  392  GKDWSFILSQIGMFSFTGLNRTQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLAEAIID  451

Query  246  SYYNVS  229
            S++NV+
Sbjct  452  SFHNVN  457



>gb|KJB55009.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=496

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVAN+VG+  LF EW  EMEMMAGRIK+VR KL+DSLS KDKS
Sbjct  371  KRIARPMYSNPPVHGARIVANIVGDAALFKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKS  430

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F+LKQIGMFSFTGLNKAQ +NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  431  GKDWSFVLKQIGMFSFTGLNKAQCDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  490

Query  246  SYYNVS  229
            SY+N S
Sbjct  491  SYHNGS  496



>gb|KCW81335.1| hypothetical protein EUGRSUZ_C02721 [Eucalyptus grandis]
Length=461

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K+LAR MYSNPP+HGA+IVAN+V +P LFN+WK EMEMMAGRIK+VRQKL DSLS KDKS
Sbjct  336  KQLARLMYSNPPVHGAKIVANIVSDPALFNDWKAEMEMMAGRIKNVRQKLNDSLSAKDKS  395

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAGL+ AKCEYLADAI+D
Sbjct  396  GKDWSFILKQIGMFSFTGLSKTQSENMTNKWHVYMTKDGRISLAGLNLAKCEYLADAIVD  455

Query  246  SYYNVS  229
            SY+NVS
Sbjct  456  SYHNVS  461



>ref|XP_010042868.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Eucalyptus grandis]
Length=120

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  588  MYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTF  409
            MY +PP+HGA+IVAN+V +P LFN+WK EMEMMAGRIK+VRQKL DSLS KDKSGKDW+F
Sbjct  1    MYCSPPVHGAKIVANIVSDPALFNDWKAEMEMMAGRIKNVRQKLNDSLSAKDKSGKDWSF  60

Query  408  ILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  229
            ILKQIGMFSFTGL+K QSENM+NKWH+YMTKDGRISLAGL+ AKCEYLADAI+DSY+NVS
Sbjct  61   ILKQIGMFSFTGLSKTQSENMTNKWHVYMTKDGRISLAGLNLAKCEYLADAIVDSYHNVS  120



>ref|XP_002972976.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
 gb|EFJ26197.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
Length=410

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVG+  LF+EW+ EM+MMAGRIK VRQKLY++L  KDKS
Sbjct  285  KRLARPMYSNPPVHGARIVANVVGDSVLFDEWRAEMQMMAGRIKGVRQKLYEALLSKDKS  344

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGL K+QS+NM++KWH+YMTKDGRISLAGL+ AKC+YLADAIID
Sbjct  345  GKDWSFILKQIGMFSFTGLTKSQSDNMTDKWHVYMTKDGRISLAGLNLAKCDYLADAIID  404

Query  246  SYYNV  232
            SYYNV
Sbjct  405  SYYNV  409



>ref|XP_002993397.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
 gb|EFJ05582.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
Length=410

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVG+  LF+EW+ EM+MMAGRIK VRQKLY++L  KDKS
Sbjct  285  KRLARPMYSNPPVHGARIVANVVGDSVLFDEWRAEMQMMAGRIKGVRQKLYEALLSKDKS  344

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGL K+QS+NM++KWH+YMTKDGRISLAGL+ AKC+YLADAIID
Sbjct  345  GKDWSFILKQIGMFSFTGLTKSQSDNMTDKWHVYMTKDGRISLAGLNLAKCDYLADAIID  404

Query  246  SYYNV  232
            SYYNV
Sbjct  405  SYYNV  409



>emb|CAA04697.1| aspartate aminotransferase 2 [Canavalia lineata]
Length=465

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVA++V  P+LF+EWK EMEMMAGRIK+VRQ LYD +S KDKS
Sbjct  340  KRIARPMYSNPPVHGARIVADLVSKPQLFDEWKAEMEMMAGRIKNVRQLLYDPISSKDKS  399

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+ MTKDGRIS AGLS AKCEYLADAIID
Sbjct  400  GKDWSFILKQIGMFSFTGLNKEQSDNMTNKWHVLMTKDGRISPAGLSLAKCEYLADAIID  459

Query  246  SYYNVS  229
            SY+NVS
Sbjct  460  SYHNVS  465



>gb|ACG59771.1| chloroplast aspartate aminotransferase [Triticum aestivum]
Length=368

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGA+IVANVVG+P +F EWK+EME MAGRIK+VRQKLYDSL+ KD+S
Sbjct  250  KRLARPMYSNPPIHGAKIVANVVGDPTMFGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQS  309

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAII  250
            GKDW+FIL QIGMFSFTGLN+ QS+NM++KWHIYMTKDGRISLAGL+ AKCEYLADAII
Sbjct  310  GKDWSFILSQIGMFSFTGLNRPQSDNMTDKWHIYMTKDGRISLAGLNLAKCEYLADAII  368



>ref|XP_011084852.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Sesamum 
indicum]
Length=406

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLAR M+SNPP+HGARIV NVVGN +LF+EW++E+ +MAGRIKSVR+KLYD LS KD S
Sbjct  281  KRLARAMHSNPPVHGARIVTNVVGNSDLFSEWEEELRLMAGRIKSVRKKLYDCLSAKDMS  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            GKDW+F +K IGM+S++GLN+AQ ENM NKWH+YMTKDGR++L G+S AKCEYLADA ID
Sbjct  341  GKDWSFFVKHIGMYSYSGLNEAQRENMRNKWHVYMTKDGRMALTGVSQAKCEYLADAFID  400

Query  246  SYYNV  232
            SY+ V
Sbjct  401  SYHYV  405



>ref|XP_008784799.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=453

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K L RP YSNPP+HGARIVANVVG+P LFNEWKQE+E+++ R+KS+RQ+L++SLS KD+S
Sbjct  328  KWLIRPEYSNPPLHGARIVANVVGDPALFNEWKQEVELISRRLKSLRQRLFESLSCKDRS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            G+DW+FI+K+ G+FSF GLNKAQ +NM NKWH+YM KDGR+SL GLS ++CEYLADAIID
Sbjct  388  GRDWSFIVKENGIFSFIGLNKAQIDNMRNKWHVYMIKDGRMSLGGLSLSQCEYLADAIID  447

Query  246  SYYNVS  229
            S++NVS
Sbjct  448  SFHNVS  453



>gb|KHN22516.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+VRQ+LYDS++ KDKS
Sbjct  338  KRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNVRQQLYDSITSKDKS  397

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            G+  +       +    GLNK QS+NM+NKWH+YMTKDGRISLAGLS AKCEYLADAIID
Sbjct  398  GQSASQYPDNCVLPFIPGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIID  457

Query  246  SYYNVS  229
            SY+NVS
Sbjct  458  SYHNVS  463



>ref|XP_005851216.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
 gb|EFN59114.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
Length=441

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+AR +YSNPP+HGARIVA VVG+ E+F EWK EMEMMAGRIK VRQ LYD+L ++   
Sbjct  318  KRIARAIYSNPPVHGARIVAEVVGSEEMFGEWKGEMEMMAGRIKGVRQDLYDAL-VEINP  376

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
             KDW+F+LKQIGMF+FTG+   Q +NM+NKWH+YMTKDGR+SLAGLS+AK  YLA AI D
Sbjct  377  DKDWSFVLKQIGMFTFTGMTPQQCDNMTNKWHVYMTKDGRLSLAGLSSAKAAYLARAIDD  436

Query  246  SYYN  235
            S  N
Sbjct  437  SVRN  440



>ref|XP_008784800.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
Length=386

 Score =   182 bits (462),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 113/165 (68%), Gaps = 39/165 (24%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K L RP YSNPP+HGARIVANVVG+P LFNEWKQE+E+++ R+KS+RQ+L++SLS KD+S
Sbjct  222  KWLIRPEYSNPPLHGARIVANVVGDPALFNEWKQEVELISRRLKSLRQRLFESLSCKDRS  281

Query  426  GKDWTFILKQIGMFSFTGLNKA--------------------------------------  361
            G+DW+FI+K+ G+FSF GLNKA                                      
Sbjct  282  GRDWSFIVKENGIFSFIGLNKAQISNPHGSAYQIAHALAVSVFLILHAFWYVLHCVFVRL  341

Query  360  -QSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  229
             Q +NM NKWH+YM KDGR+SL GLS ++CEYLADAIIDS++NVS
Sbjct  342  SQIDNMRNKWHVYMIKDGRMSLGGLSLSQCEYLADAIIDSFHNVS  386



>ref|XP_008784798.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=492

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 113/165 (68%), Gaps = 39/165 (24%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K L RP YSNPP+HGARIVANVVG+P LFNEWKQE+E+++ R+KS+RQ+L++SLS KD+S
Sbjct  328  KWLIRPEYSNPPLHGARIVANVVGDPALFNEWKQEVELISRRLKSLRQRLFESLSCKDRS  387

Query  426  GKDWTFILKQIGMFSFTGLNKA--------------------------------------  361
            G+DW+FI+K+ G+FSF GLNKA                                      
Sbjct  388  GRDWSFIVKENGIFSFIGLNKAQISNPHGSAYQIAHALAVSVFLILHAFWYVLHCVFVRL  447

Query  360  -QSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  229
             Q +NM NKWH+YM KDGR+SL GLS ++CEYLADAIIDS++NVS
Sbjct  448  SQIDNMRNKWHVYMIKDGRMSLGGLSLSQCEYLADAIIDSFHNVS  492



>ref|XP_005642879.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE18335.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=453

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+AR +YSNPP+HGARI + VV  PELF EW +EME M+GRIK VRQ L+D L+ K   
Sbjct  330  KRIARALYSNPPVHGARIASLVVSRPELFQEWNEEMEYMSGRIKDVRQVLHDELA-KLNG  388

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
             KDW+FIL+Q+GMFSFTGLN AQ +NM+NK HIYMTKDGRISLAGL ++K  YLA AI D
Sbjct  389  DKDWSFILRQLGMFSFTGLNPAQVDNMTNKHHIYMTKDGRISLAGLPSSKAAYLAAAIDD  448

Query  246  SYYN  235
            S+ N
Sbjct  449  SFRN  452



>ref|XP_011399285.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM26389.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
Length=386

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 5/124 (4%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+AR +YSNPP+HGARIVA VVG+  +F EW  EME MAGRIK+VRQ LYD L+ +   
Sbjct  267  KRIARAIYSNPPVHGARIVAEVVGDAAMFGEWNVEMEEMAGRIKTVRQDLYDHLT-RLLP  325

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
             KDW+FI    GMFSFTGL+  Q ENM+NKWH++MTKDGRISLAGL+ AK  YLA+AI+D
Sbjct  326  SKDWSFI----GMFSFTGLSPQQVENMTNKWHVFMTKDGRISLAGLNRAKAGYLAEAIVD  381

Query  246  SYYN  235
            S  N
Sbjct  382  SVQN  385



>ref|XP_009619135.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619136.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619137.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619138.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
Length=437

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPPIHGARIVANVVG PE F+EWKQEMEMMAGRIKSVRQKLYDSLS KDKS
Sbjct  337  KRLARPMYSNPPIHGARIVANVVGIPEFFDEWKQEMEMMAGRIKSVRQKLYDSLSAKDKS  396

Query  426  GKDWTFILKQIGMFSFTGLNKAQ  358
            GKDW++ILKQIGMFSFTGLNKAQ
Sbjct  397  GKDWSYILKQIGMFSFTGLNKAQ  419



>ref|XP_002501168.1| aspartate aminotransferase [Micromonas sp. RCC299]
 gb|ACO62426.1| aspartate aminotransferase [Micromonas sp. RCC299]
Length=410

 Score =   164 bits (416),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 94/121 (78%), Gaps = 1/121 (1%)
 Frame = -2

Query  603  RLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSG  424
            R+AR +YSNPP+HGARI A V+ +P LF  W +EM  MAGRIK+VR  LYD+L  K    
Sbjct  288  RIARAIYSNPPVHGARIAATVINDPALFARWNEEMGEMAGRIKTVRAMLYDNLC-KLNPD  346

Query  423  KDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDS  244
            KDW+F+ +QIGMFSFTGLN  Q ++M+ K  IYMT DGRISLAGLS AKCEYLA+AI+DS
Sbjct  347  KDWSFVTRQIGMFSFTGLNPNQVKHMTEKHAIYMTGDGRISLAGLSQAKCEYLANAIVDS  406

Query  243  Y  241
            +
Sbjct  407  F  407



>ref|XP_001700039.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP07735.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=428

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLAR +YSNPP HGARI A VV + ELF EWK EM  MAGRI+ VR +L  SL  K  S
Sbjct  305  KRLARALYSNPPTHGARIAAEVVNDKELFEEWKGEMRGMAGRIERVRGELQRSLESKYPS  364

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
             KDW+FI KQIGMFSFTGL  AQ +NM+NK  I+MT+DGRISLAGL++AK +YLA+AI+D
Sbjct  365  -KDWSFITKQIGMFSFTGLTPAQVDNMTNKHAIFMTRDGRISLAGLNSAKVDYLAEAIVD  423

Query  246  SYYN  235
            S  N
Sbjct  424  SVRN  427



>ref|XP_002950644.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ48390.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=438

 Score =   160 bits (404),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 95/125 (76%), Gaps = 1/125 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLAR +YSNPP HGARI A VV + ELF EWK EM  MAGRI+ VR +L  +L  K   
Sbjct  315  KRLARALYSNPPTHGARIAAEVVNDKELFEEWKGEMRGMAGRIERVRGELQRALEAK-YP  373

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
             KDW+FI KQIGMF+FTGL  AQ +NM+NK  ++MT+DGRISLAGL++AK EYLA+AI++
Sbjct  374  DKDWSFITKQIGMFTFTGLTPAQVDNMTNKHSVFMTRDGRISLAGLNSAKVEYLANAIVE  433

Query  246  SYYNV  232
            S  N 
Sbjct  434  SVRNC  438



>gb|KIZ05915.1| aspartate aminotransferase [Monoraphidium neglectum]
Length=345

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KR+AR ++SNPP HGARI A VVG+  +F EWK EM  MAGRI  VR +L  +L  K  +
Sbjct  222  KRIARALWSNPPTHGARIAAEVVGDAAMFEEWKGEMAGMAGRISKVRGELRAALE-KRMA  280

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
             KDW+F+ KQIGMFS+TG++  Q +NM+NK  +YMT+DGRISLAGLS+AK +YLADAI+D
Sbjct  281  DKDWSFVTKQIGMFSYTGMSPQQVDNMTNKHAVYMTRDGRISLAGLSSAKVDYLADAIVD  340

Query  246  SYYN  235
            S  N
Sbjct  341  SVRN  344



>ref|XP_003064597.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
 gb|EEH51502.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
Length=413

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 97/127 (76%), Gaps = 4/127 (3%)
 Frame = -2

Query  603  RLARPMYSNPPIHGARIVANVVGNPELF---NEWKQEMEMMAGRIKSVRQKLYDSLSLKD  433
            R+AR MYSNPP+HGARI A V+ +PELF   + W  EM  MAGRIK+VR++L++ L+ + 
Sbjct  288  RIARAMYSNPPVHGARIAATVINDPELFQARSRWNDEMGTMAGRIKTVRRELFEELT-RL  346

Query  432  KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
               KDW+F+ +QIGMFSFTGL+ AQ E M+    I+MTKDGRISLAGLS+AK +YLA+AI
Sbjct  347  NPDKDWSFVTRQIGMFSFTGLSPAQVERMTGTHKIFMTKDGRISLAGLSSAKVKYLANAI  406

Query  252  IDSYYNV  232
             DS+ N 
Sbjct  407  DDSFRNA  413



>ref|XP_010527116.1| PREDICTED: aspartate aminotransferase, chloroplastic, partial 
[Tarenaya hassleriana]
Length=431

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            KRLARPMYSNPP+HGARIVANVVG+P LF EWK EME+MAGRIK+VRQ LYD L+ KDKS
Sbjct  328  KRLARPMYSNPPVHGARIVANVVGDPTLFGEWKAEMELMAGRIKNVRQMLYDRLAEKDKS  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQ  358
            GKDW+FILKQIGMFSFTGLNKAQ
Sbjct  388  GKDWSFILKQIGMFSFTGLNKAQ  410



>ref|XP_001695040.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP02192.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=433

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA I A V+ +P L   WK+E+  MA RIK++RQ LY  L  +   
Sbjct  307  KLVIRPMYSNPPMHGAAIAARVMADPRLNALWKEELAGMAHRIKAMRQALYGQLVARQLP  366

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            G DW+F+LKQIGMFS+TGL+KAQ E ++ KWHI++T DGRIS+AGLSAA C YLA+AI D
Sbjct  367  G-DWSFVLKQIGMFSYTGLSKAQCEVLTRKWHIHLTMDGRISMAGLSAASCPYLAEAIAD  425

Query  246  SYYN  235
               N
Sbjct  426  VVTN  429



>ref|XP_002954714.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ44120.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=426

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA I A V+G+P+L   WK+E+  MA RIKS+RQ LYD L  ++  
Sbjct  303  KLVVRPMYSNPPMHGAAIAARVMGDPKLNALWKEELRGMAERIKSMRQVLYDQLVARNVP  362

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            G DW+F+LKQIGMFSFTG+ + Q E + +KWH+++T DGRIS+AGLSAA   YLA+AI D
Sbjct  363  G-DWSFVLKQIGMFSFTGMTRHQCEQLVSKWHVHLTLDGRISMAGLSAATAPYLAEAIAD  421

Query  246  SYYN  235
               N
Sbjct  422  VIQN  425



>ref|XP_005843806.1| hypothetical protein CHLNCDRAFT_59799 [Chlorella variabilis]
 gb|EFN51704.1| hypothetical protein CHLNCDRAFT_59799 [Chlorella variabilis]
Length=406

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K  AR MYSNPP HGA I   ++ +P+L+ +WK E++ MA RI ++RQ+LY +L      
Sbjct  283  KITARQMYSNPPRHGASIATRILADPQLYAQWKVELKGMADRILTMRQQLYQALQEVGAP  342

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            G DW  IL+QIGMFS+TGL KAQ ENM+NKWH+YMT DGRIS+AGLS++KC YLA A+ D
Sbjct  343  G-DWGHILRQIGMFSYTGLTKAQVENMTNKWHVYMTFDGRISMAGLSSSKCGYLAQAMKD  401

Query  246  SYYNV  232
            S  N 
Sbjct  402  SVENC  406



>gb|AAM91546.1| aspartate aminotransferase Asp2 [Arabidopsis thaliana]
Length=201

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L++++  +   
Sbjct  77   KLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARGTP  136

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  137  G-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  193



>ref|XP_010519716.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
isoform X1 [Tarenaya hassleriana]
Length=340

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ N E++NEW  E++ MA RI S+R +LYD+L  +   
Sbjct  216  KLVVRPMYSNPPIHGASIVATILKNSEMYNEWTIELKGMADRIISMRHQLYDALQARGTP  275

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  276  G-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  332



>ref|XP_005643912.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE19368.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=440

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K++ RPM+SNPP HGA IV  V+ +P L+ EW++E++ MAGRI  +RQ+L+ +L      
Sbjct  317  KQVIRPMFSNPPRHGAAIVVEVLSDPSLYAEWREELKGMAGRIMQMRQELFRALQQVGAP  376

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            G  W  IL QIGMFSFTGL K Q   M++KWH+YMT DGRIS+AGLS++KC YLA+AI D
Sbjct  377  G-SWNHILDQIGMFSFTGLTKEQVRVMTDKWHVYMTFDGRISMAGLSSSKCHYLAEAIND  435

Query  246  S  244
            +
Sbjct  436  A  436



>ref|XP_002514283.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF48237.1| aspartate aminotransferase, putative [Ricinus communis]
Length=404

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQKL+D+LS +   
Sbjct  280  KLVIRPMYSNPPIHGASIVATILKDRDMYNEWTVELKAMADRIISMRQKLFDALSARGTP  339

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  340  G-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTADGRISMAGLSSKTVPHLADAI  396



>ref|XP_010519717.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
isoform X2 [Tarenaya hassleriana]
Length=405

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ N E++NEW  E++ MA RI S+R +LYD+L  +   
Sbjct  281  KLVVRPMYSNPPIHGASIVATILKNSEMYNEWTIELKGMADRIISMRHQLYDALQARGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  341  G-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>tpg|DAA57534.1| TPA: hypothetical protein ZEAMMB73_000065 [Zea mays]
Length=171

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA IVA ++ + E+FNEW  E++ MA RI ++RQ+L+++L  +   
Sbjct  47   KLVIRPMYSNPPLHGASIVATILRDSEMFNEWTLELKAMADRIINMRQQLFNALKSRGTP  106

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  107  G-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSMRTVPHLADAI  163



>ref|XP_002990136.1| hypothetical protein SELMODRAFT_235954 [Selaginella moellendorffii]
 gb|EFJ08853.1| hypothetical protein SELMODRAFT_235954 [Selaginella moellendorffii]
Length=414

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA V+G+ +LF+EW  E++ MA RI S+R KLYD+L  +   
Sbjct  289  KLVIRPMYSNPPIHGASIVALVLGDGDLFSEWTVELKGMADRIISMRHKLYDALRARGTP  348

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DWT ILKQIGMFSFTGLNK Q + M+ ++ IYMT DGRIS+AGLS      LADAI
Sbjct  349  G-DWTHILKQIGMFSFTGLNKEQVQFMTREYRIYMTLDGRISMAGLSLKTVPLLADAI  405



>ref|XP_002989786.1| hypothetical protein SELMODRAFT_184818 [Selaginella moellendorffii]
 gb|EFJ09053.1| hypothetical protein SELMODRAFT_184818 [Selaginella moellendorffii]
Length=413

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA V+G+ +LF+EW  E++ MA RI S+R KLYD+L  +   
Sbjct  288  KLVIRPMYSNPPIHGASIVALVLGDGDLFSEWTVELKGMADRIISMRHKLYDALRARGTP  347

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DWT ILKQIGMFSFTGLNK Q + M+ ++ IYMT DGRIS+AGLS      LADAI
Sbjct  348  G-DWTHILKQIGMFSFTGLNKEQVQFMTREYRIYMTLDGRISMAGLSLKTVPLLADAI  404



>ref|XP_006833326.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
 gb|ERM98604.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
Length=452

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA IVA ++G+  LFNEW  E++ MA RI S+R++LYD+L  +   
Sbjct  328  KLVIRPMYSNPPLHGASIVAKILGDRNLFNEWTVELKAMADRIISMRKQLYDALCSRGTP  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  388  G-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  444



>gb|KDP33689.1| hypothetical protein JCGZ_07260 [Jatropha curcas]
Length=407

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ N +L+NEW  E++ MA RI S+R +L+D+L+ +   
Sbjct  283  KLVIRPMYSNPPIHGASIVATILKNSDLYNEWTIELKAMADRIISMRHQLFDALTARGTP  342

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  343  G-DWSHIMKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  399



>ref|XP_011043495.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
 ref|XP_011014875.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
Length=407

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQKL+D+LS +   
Sbjct  283  KLVIRPMYSNPPIHGASIVATILKDRDMYNEWTVELKAMADRIISMRQKLFDALSARGTP  342

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  343  G-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPLLADAI  399



>ref|XP_011048396.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Populus 
euphratica]
Length=407

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQKL+D+LS +   
Sbjct  283  KLVIRPMYSNPPIHGASIVATILKDRDMYNEWTVELKAMADRIISMRQKLFDALSARGTP  342

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  343  G-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPLLADAI  399



>ref|XP_001771002.1| predicted protein [Physcomitrella patens]
 gb|EDQ64157.1| predicted protein [Physcomitrella patens]
Length=409

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PP HGA I A ++ +  LF EW  E++ MA RI S+RQ+LYD+L  +   
Sbjct  282  KLVIRPMYSSPPAHGAAIAATILADGRLFQEWTVELKGMADRIISMRQQLYDALQARGTP  341

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DWT +LKQIGMF+FTGLNK+Q E M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  342  G-DWTHVLKQIGMFTFTGLNKSQVEFMTRQYHIYMTSDGRISMAGLSSKTVPHLADAI  398



>tpg|DAA57533.1| TPA: hypothetical protein ZEAMMB73_000065 [Zea mays]
Length=201

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA IVA ++ + E+FNEW  E++ MA RI ++RQ+L+++L  +   
Sbjct  77   KLVIRPMYSNPPLHGASIVATILRDSEMFNEWTLELKAMADRIINMRQQLFNALKSRGTP  136

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  137  G-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSMRTVPHLADAI  193



>ref|XP_007013138.1| Aspartate aminotransferase, cytoplasmic [Theobroma cacao]
 gb|EOY30757.1| Aspartate aminotransferase, cytoplasmic [Theobroma cacao]
Length=405

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA I A ++ N +++NEWK E++ MA RI S+R++L+D+LS +   
Sbjct  281  KLVIRPMYSNPPIHGASIAATILKNSDMYNEWKIELKAMAERIISMRKQLFDALSARGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  341  G-DWSHIIKQIGMFTFTGLNSDQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>ref|XP_006450636.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
 gb|ESR63876.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
Length=449

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+RQKL+D+L  +   
Sbjct  325  KLVIRPMYSNPPIHGASIVAAILRDRDLFNEWTFELKAMADRIISMRQKLFDALRARGTP  384

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+  +HIYMT DGRIS+AGLS+    +LADAI
Sbjct  385  G-DWSHIIKQIGMFTFTGLNPQQVAFMTKDYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>emb|CBI20886.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPM+SNPPIHGA IVA ++ N +++NEW  E++ MA RI S+RQ+L+D+L  +   
Sbjct  298  KLVIRPMFSNPPIHGASIVAIILKNRDMYNEWTVELKAMADRIISMRQQLFDALRARGTP  357

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW  ILKQIGMF+FTGLN AQ   M+ ++H+YMT DGRIS+AGLS+    +LADAI
Sbjct  358  G-DWNHILKQIGMFTFTGLNTAQVAFMTKEYHVYMTSDGRISMAGLSSKTVPHLADAI  414



>ref|XP_006476088.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=449

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+RQKL+D+L  +   
Sbjct  325  KLVIRPMYSNPPIHGASIVAAILRDRDLFNEWTFELKAMADRIISMRQKLFDALRARGTP  384

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I KQIGMF+FTGLN  Q   M+  +HIYMT DGRIS+AGLS+    +LADAI
Sbjct  385  G-DWSHIFKQIGMFTFTGLNPQQVAFMTKDYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>ref|XP_008466236.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Cucumis melo]
Length=460

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA V+ + +LFNEW  E++ MA RI S+RQ+L+++L  +   
Sbjct  336  KLVIRPMYSNPPIHGASIVATVLKDRDLFNEWTVELKAMADRIISMRQQLFEALRARGTP  395

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  396  G-DWSHIIKQIGMFTFTGLNSEQVSFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  452



>ref|XP_004136291.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004168053.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN60208.1| hypothetical protein Csa_3G889160 [Cucumis sativus]
Length=464

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA V+ + +LFNEW  E++ MA RI S+RQ+L+D+L  +   
Sbjct  340  KLVIRPMYSSPPIHGASIVATVLKDRDLFNEWTVELKAMADRIISMRQQLFDALRARGTP  399

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  400  G-DWSHIIKQIGMFTFTGLNSEQVSFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  456



>ref|XP_010420761.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
[Camelina sativa]
Length=405

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L+D++  +   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNNWTVELKEMADRIKSMRQQLFDAIQARGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  341  G-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_010493028.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Camelina sativa]
Length=405

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L+D++  +   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNNWTVELKEMADRIKSMRQQLFDAIQARGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  341  G-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_002284136.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
Length=450

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPM+SNPPIHGA IVA ++ N +++NEW  E++ MA RI S+RQ+L+D+L  +   
Sbjct  326  KLVIRPMFSNPPIHGASIVAIILKNRDMYNEWTVELKAMADRIISMRQQLFDALRARGTP  385

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW  ILKQIGMF+FTGLN AQ   M+ ++H+YMT DGRIS+AGLS+    +LADAI
Sbjct  386  G-DWNHILKQIGMFTFTGLNTAQVAFMTKEYHVYMTSDGRISMAGLSSKTVPHLADAI  442



>ref|XP_007137184.1| hypothetical protein PHAVU_009G106800g [Phaseolus vulgaris]
 gb|ESW09178.1| hypothetical protein PHAVU_009G106800g [Phaseolus vulgaris]
Length=410

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +LFNEW  E++ MA RI S+RQ+L+D+L  +   
Sbjct  286  KLVIRPMYSSPPIHGASIVAAILKDSDLFNEWTIELKGMADRIISMRQQLFDALRSRGTP  345

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+N++HIYMT DGRIS+AGLS+     LADAI
Sbjct  346  G-DWSHIIKQIGMFTFTGLNSKQVSFMTNEYHIYMTSDGRISMAGLSSKTVPLLADAI  402



>ref|XP_002324997.1| aspartate aminotransferase family protein [Populus trichocarpa]
 gb|ABK95824.1| unknown [Populus trichocarpa]
 gb|EEF03562.1| aspartate aminotransferase family protein [Populus trichocarpa]
Length=407

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQ+L+D+LS +   
Sbjct  283  KLVIRPMYSNPPIHGASIVATILKDRDMYNEWTVELKAMADRIISMRQQLFDALSARGTP  342

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  343  G-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTDAI  399



>ref|XP_010454237.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Camelina sativa]
Length=405

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L+D++  +   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFDAIQARGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  341  G-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_006287876.1| hypothetical protein CARUB_v10001103mg [Capsella rubella]
 gb|EOA20774.1| hypothetical protein CARUB_v10001103mg [Capsella rubella]
Length=405

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L+D++  +   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFDAIQARGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  341  G-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>gb|AFK44136.1| unknown [Medicago truncatula]
Length=153

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  +   
Sbjct  29   KLVIRPMYSSPPIHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARGTP  88

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  89   G-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  145



>emb|CDX70399.1| BnaC03g04830D [Brassica napus]
Length=450

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   
Sbjct  326  KLVIRPMYSNPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARGTP  385

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DWT I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  386  G-DWTHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  442



>ref|XP_009131210.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Brassica 
rapa]
 emb|CDX78428.1| BnaA03g03400D [Brassica napus]
Length=452

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   
Sbjct  328  KLVIRPMYSNPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARGTP  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DWT I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  388  G-DWTHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>sp|P37833.1|AATC_ORYSJ RecName: Full=Aspartate aminotransferase, cytoplasmic; AltName: 
Full=Transaminase A [Oryza sativa Japonica Group]
 dbj|BAA03504.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAB61211.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC78585.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|ABL74572.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|EAY75902.1| hypothetical protein OsI_03821 [Oryza sativa Indica Group]
 gb|EAZ13614.1| hypothetical protein OsJ_03530 [Oryza sativa Japonica Group]
Length=407

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+RQ+L+D+L  ++  
Sbjct  283  KLVIRPMYSNPPIHGASIVATILKDSAMFNEWTVELKGMADRIISMRQQLFDALKTRETP  342

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  343  G-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSGRTIPHLADAI  399



>ref|XP_006644742.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Oryza 
brachyantha]
Length=458

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+RQ+L+D+L  ++  
Sbjct  334  KLVIRPMYSNPPIHGASIVATILKDSVMFNEWTVELKAMADRIISMRQQLFDALKTRETP  393

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  394  G-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSGRTIPHLADAI  450



>gb|KHG23914.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=452

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPM+SNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+R++L+D+L  +   
Sbjct  328  KLVIRPMFSNPPIHGASIVATILKDSNMFNEWTIELKAMADRIISMRKQLFDALRARGTP  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q E M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  388  G-DWSHIIKQIGMFTFTGLNSKQVEFMTREYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_002871893.1| hypothetical protein ARALYDRAFT_909992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48152.1| hypothetical protein ARALYDRAFT_909992 [Arabidopsis lyrata subsp. 
lyrata]
Length=405

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L++++  +   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DWT I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  341  G-DWTHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>gb|AAL09704.1|AF419301_1 aspartate aminotransferase [Securigera parviflora]
Length=341

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA IVA ++ +  L+NEW  E++ MA RI S+RQ+L+D+L  K   
Sbjct  217  KLVIRPMYSNPPLHGASIVATILKDRNLYNEWTIELKAMADRIISMRQQLFDALRAKGTP  276

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  277  G-DWSHIIKQIGMFTFTGLNPEQVSFMTKEYHIYLTSDGRISMAGLSSKTVSHLADAI  333



>gb|KJB07521.1| hypothetical protein B456_001G028100 [Gossypium raimondii]
Length=452

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPM+SNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+R++L+D+L  +   
Sbjct  328  KLVIRPMFSNPPIHGASIVATILKDSNMFNEWTIELKAMADRIISMRKQLFDALRARGTP  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q E M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  388  G-DWSHIIKQIGMFTFTGLNSKQVEFMTREYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|NP_001044317.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAD87343.1| putative aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF06231.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAG96155.1| unnamed protein product [Oryza sativa Japonica Group]
Length=460

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+RQ+L+D+L  ++  
Sbjct  336  KLVIRPMYSNPPIHGASIVATILKDSAMFNEWTVELKGMADRIISMRQQLFDALKTRETP  395

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  396  G-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSGRTIPHLADAI  452



>emb|CAN70394.1| hypothetical protein VITISV_020521 [Vitis vinifera]
Length=411

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQ L+D+L  +   
Sbjct  287  KLVIRPMYSNPPIHGASIVATILKDSDMYNEWTXELKAMADRIISMRQLLFDTLRDRGTP  346

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  347  G-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  403



>gb|KHG24168.1| Aspartate aminotransferase, cytoplasmic [Gossypium arboreum]
Length=405

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA I   ++ N +++NEWK E++ MA RI S+R++L+D+LS K   
Sbjct  281  KLVIRPMYSNPPIHGASIAMTILKNSDMYNEWKIELKAMADRIISMRKQLFDALSAKGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGL+  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  341  G-DWSHIIKQIGMFTFTGLDSDQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>gb|ABY58643.1| aspartate aminotransferase [Triticum aestivum]
Length=380

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA IVA ++ +  +F+EW  E++ MA RI S+R++L+D+L +++  
Sbjct  262  KLVIRPMYSNPPLHGASIVATILKDSAMFDEWTVELKAMADRIISMREQLFDALKIRETP  321

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  322  G-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSSRTVPHLADAI  378



>ref|XP_008789337.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Phoenix dactylifera]
Length=463

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  LF+EW  E++ MA RI S+RQ L+D+L  +   
Sbjct  339  KLVIRPMYSNPPIHGASIVATILKDRALFHEWTIELKAMADRIISMRQLLFDALHARGTP  398

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN+ Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  399  G-DWSHIIKQIGMFTFTGLNREQVAFMTQEYHIYMTSDGRISMAGLSSKTVPHLADAI  455



>ref|XP_004291203.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Fragaria 
vesca subsp. vesca]
Length=459

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+R +L+DSL  K   
Sbjct  335  KLVIRPMYSNPPIHGASIVATILKDKDLFNEWTIELKAMADRIISMRHQLFDSLRAKGTP  394

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  395  G-DWSHIIKQIGMFTFTGLNPEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  451



>emb|CDM84293.1| unnamed protein product [Triticum aestivum]
Length=454

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA IVA ++ +  +F+EW  E++ MA RI S+R++L+D+L +++  
Sbjct  330  KLVIRPMYSNPPLHGASIVATILKDSAMFDEWTVELKAMADRIISMREQLFDALKIRETP  389

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  390  G-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSSRTVPHLADAI  446



>gb|AAA79370.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=405

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L++++  +   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  341  G-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|NP_197456.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46645.2|AAT2_ARATH RecName: Full=Aspartate aminotransferase, cytoplasmic isozyme 
1; AltName: Full=Transaminase A [Arabidopsis thaliana]
 gb|ABG25061.1| At5g19550 [Arabidopsis thaliana]
 gb|AED92724.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=405

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+RQ+L++++  +   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  341  G-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>gb|AEX09182.1| putative aspartate aminotransferase 1 [Gossypium hirsutum]
Length=405

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K L RPMYSNPPIHGA I   ++ N +++NEWK E++ MA RI S+R++L+D+LS K   
Sbjct  281  KLLIRPMYSNPPIHGASIAMTILKNSDMYNEWKIELKAMADRIISMRKQLFDALSAKGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGL+  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  341  G-DWSHIIKQIGMFTFTGLDSDQVAFMIKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>gb|KJB64944.1| hypothetical protein B456_010G072900 [Gossypium raimondii]
Length=405

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA I   ++ N +++NEWK E++ MA RI S+R++L+D+LS K   
Sbjct  281  KLVIRPMYSNPPIHGASIAMTILKNSDMYNEWKIELKAMADRIISMRKQLFDALSAKGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G +W+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  341  G-NWSHIIKQIGMFTFTGLNSDQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>ref|XP_004970037.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Setaria 
italica]
Length=460

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HG  IVA ++ + E+FNEW  E++ MA RI S+RQ+L+D+L  +   
Sbjct  336  KLVIRPMYSNPPLHGPSIVATILKDSEMFNEWTLELKAMADRIISMRQQLFDALKSRGTP  395

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  396  G-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSTRTVPHLADAI  452



>ref|XP_002284313.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
 emb|CBI28052.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQ L+D+L  +   
Sbjct  287  KLVIRPMYSNPPIHGASIVATILKDSDMYNEWTLELKAMADRIISMRQLLFDTLRDRGTP  346

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  347  G-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  403



>ref|XP_011078312.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Sesamum indicum]
Length=406

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPM+SNPPIHGA IVA ++ + +++ EW  E++ MA RI S+RQ+LYD+L  +   
Sbjct  282  KLVIRPMFSNPPIHGASIVATILKDGDMYTEWSVELKAMADRIISMRQQLYDALCARGTP  341

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  342  G-DWSHIIKQIGMFTFTGLNTNQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  398



>ref|XP_010250350.1| PREDICTED: aspartate aminotransferase, cytoplasmic, partial [Nelumbo 
nucifera]
Length=458

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +++NEW  E++ MA RI S+RQ+L+D+L  +   
Sbjct  334  KLVIRPMYSNPPIHGASIVATILKDRDMYNEWTIELKAMADRIISMRQQLFDALRDRGTP  393

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  394  G-DWSHIIKQIGMFTFTGLNTEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  450



>gb|AEX09183.1| putative aspartate aminotransferase 2 [Gossypium hirsutum]
Length=452

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPM+SNPPIHGA IV  ++ +  +FNEW  E++ MA RI S+R++L+D+L  +   
Sbjct  328  KLVIRPMFSNPPIHGASIVVTILKDSNMFNEWTIELKAMADRIISMRKQLFDALRARGTP  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q E M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  388  G-DWSHIIKQIGMFTFTGLNSKQVEFMTREYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_007012061.1| Aspartate aminotransferase 3 [Theobroma cacao]
 gb|EOY29680.1| Aspartate aminotransferase 3 [Theobroma cacao]
Length=450

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPM+SNPPIHGA IVA V+ +  ++NEW  E++ MA RI S+RQ+L+D+L  +   
Sbjct  327  KLVIRPMFSNPPIHGASIVATVLKDRNMYNEWTIELKAMADRIISMRQQLFDALRARGTP  386

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  387  G-DWSHIIKQIGMFTFTGLNSEQVAFMTREYHIYMTSDGRISMAGLSSKTVPHLADAI  443



>emb|CDP03316.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  +++EW  E++ MA RI S+RQKL+D+L  +   
Sbjct  286  KLVIRPMYSNPPIHGASIVAAILKDSHMYHEWTVELKAMADRIISMRQKLFDALQARGTP  345

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  346  G-DWSHIIKQIGMFTFTGLNAQQVAFMTKEYHIYMTSDGRISMAGLSSQTVPLLADAI  402



>gb|KCW81535.1| hypothetical protein EUGRSUZ_C02894 [Eucalyptus grandis]
Length=452

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + E++NEW  E++ MA RI S+R +L+D+L  +   
Sbjct  328  KLVIRPMYSNPPIHGASIVAAILRDREMYNEWTIELKAMADRIISMRHQLFDALRARGTP  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  388  G-DWSHIIKQIGMFTFTGLNSQQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_010254083.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Nelumbo 
nucifera]
Length=461

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA +  + +++ EW  E++ MA RI S+RQ+L+D+L  +   
Sbjct  337  KLVIRPMYSNPPIHGASIVATIFKDRDMYTEWTIELKAMADRIISMRQQLFDALRARGTP  396

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q  +M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  397  G-DWSHIVKQIGMFTFTGLNTEQVASMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  453



>ref|XP_006352160.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Solanum 
tuberosum]
Length=406

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + ++++EW  E++ MA RI S+RQ+LYD++  +   
Sbjct  282  KMVIRPMYSNPPIHGASIVATILKDRQMYDEWTVELKAMADRIISMRQQLYDAMQARGTP  341

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  342  G-DWSHIIKQIGMFTFTGLNVEQVSFMTREYHIYMTSDGRISMAGLSSRTVPHLADAM  398



>ref|XP_009762342.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
sylvestris]
Length=409

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + ++++EW  E++ MA RI S+RQ+L+D+L  +  +
Sbjct  285  KLVIRPMYSNPPIHGASIVATILKDRQMYDEWTIELKAMADRIISMRQQLFDALQARGTT  344

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ + HIYMT DGRIS+AGLS+    +LADAI
Sbjct  345  G-DWSHIIKQIGMFTFTGLNTEQVSFMTREHHIYMTSDGRISMAGLSSRTIPHLADAI  401



>ref|XP_009617506.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
tomentosiformis]
Length=409

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + ++++EW  E++ MA RI S+RQ+L+D+L  +  +
Sbjct  285  KLVIRPMYSNPPIHGASIVATILKDRQMYDEWTIELKAMADRIISMRQQLFDALQARGTA  344

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ + HIYMT DGRIS+AGLS+    +LADAI
Sbjct  345  G-DWSHIIKQIGMFTFTGLNTEQVSFMTREHHIYMTSDGRISMAGLSSRTIPHLADAI  401



>ref|XP_010100270.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB82277.1| Aspartate aminotransferase [Morus notabilis]
Length=463

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +L+NEW  E++ MA RI S+RQ+L+D+L  +   
Sbjct  339  KLVIRPMYSNPPIHGASIVAIILKDRDLYNEWTIELKAMADRIISMRQQLFDALRARGTP  398

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  399  G-DWSHIIKQIGMFTFTGLNAEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLVDAI  455



>sp|P28734.1|AATC_DAUCA RecName: Full=Aspartate aminotransferase, cytoplasmic; AltName: 
Full=Transaminase A [Daucus carota]
 gb|AAA33134.1| aspartate aminotransferase [Daucus carota]
 prf||1909339A Asp aminotransferase
Length=405

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PP+HGA IVA ++ + +L+NEW  E++ MA RI S+RQ+L+++L  K   
Sbjct  281  KLVIRPMYSSPPLHGASIVAAILKDGDLYNEWTLELKAMADRIISMRQELFNALQAKGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+N++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  341  G-DWSHIVKQIGMFTFTGLNSEQVTFMTNEYHIYLTSDGRISMAGLSSRTVPHLADAI  397



>ref|XP_011019648.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
Length=449

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +L+NEW  E++ MA RI S+RQKL+++L  +   
Sbjct  325  KLVIRPMYSNPPIHGASIVAAILKDRDLYNEWTIELKAMADRIISMRQKLFEALRARGTP  384

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  385  G-DWSHIVKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAM  441



>ref|XP_002308618.1| aspartate transaminase family protein [Populus trichocarpa]
 gb|EEE92141.1| aspartate transaminase family protein [Populus trichocarpa]
Length=449

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +L+NEW  E++ MA RI S+RQKL+++L  +   
Sbjct  325  KLVIRPMYSNPPIHGASIVAAILKDRDLYNEWTIELKAMADRIISMRQKLFEALHARGTP  384

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  385  G-DWSHIVKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAM  441



>ref|XP_010693429.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=451

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPM+SNPPIHGA IVA ++ +  +++EW  E++ MA RI S+RQKL+D+L  +   
Sbjct  327  KLVTRPMFSNPPIHGASIVATILRDRNMYDEWTVELKAMAERIISMRQKLFDALQTRGTP  386

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  387  G-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSSKTIPHLADAM  443



>ref|XP_010920378.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Elaeis guineensis]
Length=464

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  LF+EW  E++ MA RI S+RQ L+D+L  +   
Sbjct  340  KLVIRPMYSNPPIHGASIVAAILKDRALFHEWTVELKAMADRIISMRQMLFDALRARGTP  399

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  400  G-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  456



>ref|XP_009395718.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + EL++EW  E++ MA RI ++RQ+L+D+L  +   
Sbjct  297  KLVIRPMYSNPPIHGASIVATILKDRELYHEWTIELKAMADRIINMRQQLFDALRARGTP  356

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  357  G-DWSHIIKQIGMFTFTGLNTEQVTFMTKEYHIYMTSDGRISMAGLSSKTVPHLVDAI  413



>ref|XP_004245266.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Solanum lycopersicum]
Length=452

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  L++EW  E++ MA RI  +RQ+L+D+L  K   
Sbjct  328  KLVIRPMYSNPPIHGASIVATILKDRNLYHEWTLELKAMADRIIRMRQQLFDALRAKGTP  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  388  G-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTDAI  444



>ref|XP_002873517.1| hypothetical protein ARALYDRAFT_487989 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49776.1| hypothetical protein ARALYDRAFT_487989 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   
Sbjct  325  KLVIRPMYSSPPIHGASIVAVILRDKNLFNEWTLELKAMADRIISMRKQLFEALRTRGTP  384

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  385  G-DWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>ref|XP_006476087.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=455

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 88/123 (72%), Gaps = 5/123 (4%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKD--  433
            K + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+RQKL+D+L  ++  
Sbjct  325  KLVIRPMYSNPPIHGASIVAAILRDRDLFNEWTFELKAMADRIISMRQKLFDALRAREIW  384

Query  432  ---KSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLA  262
                +  DW+ I KQIGMF+FTGLN  Q   M+  +HIYMT DGRIS+AGLS+    +LA
Sbjct  385  YIAGTPGDWSHIFKQIGMFTFTGLNPQQVAFMTKDYHIYMTSDGRISMAGLSSKTVPHLA  444

Query  261  DAI  253
            DAI
Sbjct  445  DAI  447



>ref|XP_006289742.1| hypothetical protein CARUB_v10003310mg [Capsella rubella]
 gb|EOA22640.1| hypothetical protein CARUB_v10003310mg [Capsella rubella]
Length=452

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   
Sbjct  328  KLVIRPMYSSPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRTRGTP  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  388  G-DWSHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_002516566.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF45907.1| aspartate aminotransferase, putative [Ricinus communis]
Length=440

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  L++EW  E++ MA RI S+RQ+L+D+L  +   
Sbjct  316  KLVIRPMYSNPPIHGASIVAFILKDRNLYSEWTIELKAMADRIISMRQQLFDALRARGTP  375

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  376  G-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  432



>ref|XP_010419724.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like [Camelina 
sativa]
Length=454

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   
Sbjct  330  KLVIRPMYSSPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARGTP  389

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  390  G-DWSHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  446



>ref|XP_010453196.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Camelina 
sativa]
Length=455

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   
Sbjct  331  KLVIRPMYSSPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARGTP  390

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  391  G-DWSHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  447



>ref|XP_004501184.1| PREDICTED: aspartate aminotransferase 1-like [Cicer arietinum]
Length=458

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +L+NEW  E++ MA RI ++RQ+L+D+L  +   
Sbjct  334  KLVIRPMYSSPPIHGASIVAAILKDRDLYNEWTIELKAMADRIINMRQQLFDALRARGTP  393

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  394  G-DWSHIIKQIGMFTFTGLNPEQVSFMTKEYHIYMTSDGRISMAGLSSRTVSHLADAI  450



>ref|NP_196713.1| aspartate aminotransferase 3 [Arabidopsis thaliana]
 sp|P46644.1|AAT3_ARATH RecName: Full=Aspartate aminotransferase 3, chloroplastic; AltName: 
Full=Protein YELLOW-LEAF-SPECIFIC GENE 4; AltName: Full=Transaminase 
A; Flags: Precursor [Arabidopsis thaliana]
 gb|AAA79371.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB87712.1| aspartate aminotransferase (Asp3) [Arabidopsis thaliana]
 gb|AAK92700.1| putative aspartate aminotransferase Asp3 [Arabidopsis thaliana]
 gb|AAL85041.1| putative aspartate aminotransferase ASP3 [Arabidopsis thaliana]
 gb|AED91691.1| aspartate aminotransferase 3 [Arabidopsis thaliana]
Length=449

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   
Sbjct  325  KLVIRPMYSSPPIHGASIVAVILRDKNLFNEWTLELKAMADRIISMRKQLFEALRTRGTP  384

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  385  G-DWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>ref|XP_008361035.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Malus domestica]
Length=461

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K   
Sbjct  337  KLVIRPMYSNPPIHGASIVATILKDRDLFNEWTIELKAMADRIISMRHQLFESLRAKGTP  396

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  397  G-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  453



>ref|XP_008352022.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Malus domestica]
Length=461

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K   
Sbjct  337  KLVIRPMYSNPPIHGASIVATILKDRDLFNEWTIELKAMADRIISMRHQLFESLRAKGTP  396

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  397  G-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  453



>ref|XP_010491885.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like [Camelina 
sativa]
Length=451

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   
Sbjct  327  KLVIRPMYSSPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARGTP  386

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  387  G-DWSHIIKQIGMFTFTGLNPAQVSYMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  443



>gb|KDP34208.1| hypothetical protein JCGZ_07779 [Jatropha curcas]
Length=454

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  L+NEW  E++ MA RI  +RQ+L+D+L  +   
Sbjct  330  KLVIRPMYSNPPIHGASIVAFILKDRNLYNEWTIELKAMADRIICMRQQLFDALHARGTP  389

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  390  G-DWSHIIKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  446



>gb|KIL70778.1| hypothetical protein M378DRAFT_183367 [Amanita muscaria Koide 
BX008]
Length=424

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGARI + V+G+P L+ EW++E++ MA RI ++R++LYD+L+   ++
Sbjct  299  KIIIRPMYSNPPIHGARIASTVLGDPALYTEWEKEVKGMADRIINMRERLYDTLTNSLRT  358

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
              +W  I  QIGMFSFTGL   Q++ ++ K HIYMT DGRIS+AGL++   EY A+++
Sbjct  359  PGEWGHIKSQIGMFSFTGLTPPQTKALAEKAHIYMTSDGRISMAGLNSGNIEYFAESV  416



>ref|XP_007222958.1| hypothetical protein PRUPE_ppa005315mg [Prunus persica]
 gb|AGF95095.1| aspartate aminotransferase [Prunus persica]
 gb|EMJ24157.1| hypothetical protein PRUPE_ppa005315mg [Prunus persica]
Length=467

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K   
Sbjct  343  KLVIRPMYSNPPIHGASIVATILKDRDLFNEWTIELKAMADRIISMRHQLFESLRAKGTP  402

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  403  G-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  459



>ref|XP_008378104.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Malus domestica]
Length=421

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K   
Sbjct  297  KLVIRPMYSNPPIHGASIVATILKDRDLFNEWTIELKEMADRIISMRHQLFESLRAKGTP  356

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  357  G-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  413



>emb|CDY44925.1| BnaA02g04300D [Brassica napus]
Length=405

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MAGRI S+RQ L+++L  K   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKGMAGRIISMRQHLFEALQAKGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  341  G-DWSHIIKQIGMFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAGLSSKTVPHLVEAI  397



>gb|AAA50160.1| aspartate aminotransferase P1 [Lupinus angustifolius]
Length=420

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +L+NEW  E++ MA RI  +RQ+L+D+L  +   
Sbjct  296  KLVVRPMYSNPPIHGASIVAAILRDRDLYNEWTIELKAMADRIIKMRQQLFDALQSRGTP  355

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  356  G-DWSHIIKQIGMFTFTGLNAEQVSFLTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  412



>ref|XP_008220042.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Prunus mume]
Length=463

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +LFNEW  E++ MA RI S+R +L++SL  K   
Sbjct  339  KLVIRPMYSNPPIHGASIVATILKDRDLFNEWTIELKAMADRIISMRHQLFESLRAKGTP  398

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  399  G-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  455



>gb|AAA33408.1| aspartate aminotransferase P1 [Lupinus angustifolius]
Length=420

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +L+NEW  E++ MA RI  +RQ+L+D+L  +   
Sbjct  296  KLVVRPMYSNPPIHGASIVAAILRDRDLYNEWHIELKAMADRIIKMRQQLFDALQSRGTP  355

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  356  G-DWSHIIKQIGMFTFTGLNAEQVSFLTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  412



>gb|KFK25414.1| aspartate aminotransferase [Arabis alpina]
Length=449

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ +  LF+EW  E++ MA RI S+R++L+++L  +   
Sbjct  325  KLVIRPMYSSPPIHGASIVAVILRDKNLFHEWTLELKAMADRIISMRKQLFEALRARGTP  384

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DWT I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  385  G-DWTHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>ref|XP_003569862.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Brachypodium 
distachyon]
Length=464

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA IVA ++ N ++F EW  E++ MA RI S+RQ+L+++L+++   
Sbjct  340  KLVIRPMYSNPPLHGATIVATILNNRDMFEEWTIELKGMANRIISMRQQLFNALNIRGTP  399

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+   ++LA+AI
Sbjct  400  G-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSSRTVDHLANAI  456



>emb|CDP16161.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  +F+EW  E++ MA RI S+RQ+L+D+L  +   
Sbjct  296  KLVIRPMYSNPPIHGASIVATILKDRNMFHEWTLELKAMADRIISMRQQLFDALRARGTP  355

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  356  G-DWSHIIKQIGMFTFTGLNSEQVTFMRKEYHIYMTSDGRISMAGLSSRTVPHLTDAI  412



>ref|XP_009410920.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + E+++EW  E++ MA RI  +RQ+L+D+L  +   
Sbjct  335  KLVIRPMYSNPPIHGASIVATILKDREMYHEWTIELKAMADRIIRMRQQLFDALRTRGTP  394

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN+ Q  +M+ ++HIYMT DGRIS+AGLS+    +LA AI
Sbjct  395  G-DWSHIVKQIGMFTFTGLNREQVTSMTKEYHIYMTSDGRISMAGLSSKTVPHLAGAI  451



>gb|EMT25743.1| Aspartate aminotransferase, cytoplasmic [Aegilops tauschii]
Length=407

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA IVA ++ +  +F+EW  E++ MA RI S+R++L+++L +++  
Sbjct  283  KLVIRPMYSNPPLHGASIVATILKDSAMFDEWTLELKAMADRIISMREQLFNALKIRETP  342

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  343  G-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSSRTVPHLADAI  399



>ref|NP_001141224.1| uncharacterized protein LOC100273311 [Zea mays]
 gb|ACF85765.1| unknown [Zea mays]
 tpg|DAA57530.1| TPA: aspartate aminotransferase [Zea mays]
Length=459

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA IVA ++ + E+FNEW  E++ MA RI ++RQ+L+++L  +   
Sbjct  335  KLVIRPMYSNPPLHGASIVATILRDSEMFNEWTLELKAMADRIINMRQQLFNALKSRGTP  394

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  395  G-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSMRTVPHLADAI  451



>ref|XP_010049084.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Eucalyptus 
grandis]
Length=594

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + E++NEW  E++ MA RI S+R +L+D+L  +   
Sbjct  470  KLVIRPMYSNPPIHGASIVAAILRDREMYNEWTIELKAMADRIISMRHQLFDALRARGTP  529

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  530  G-DWSHIIKQIGMFTFTGLNSQQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI  586



>ref|XP_010688229.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Beta 
vulgaris subsp. vulgaris]
Length=405

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA IVA+++ +  L++EW  E++ MA RI S+RQ+L+D+L+ +   
Sbjct  281  KLVVRPMYSNPPLHGASIVASILKDKSLYDEWTIELKEMADRIISMRQQLFDALNARGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  341  G-DWSHIIKQIGMFTFTGLNADQVTFMRAEYHIYMTSDGRISMAGLSSRTVPHLADAI  397



>ref|XP_006451184.1| hypothetical protein CICLE_v10008489mg [Citrus clementina]
 ref|XP_006475645.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Citrus 
sinensis]
 gb|ESR64424.1| hypothetical protein CICLE_v10008489mg [Citrus clementina]
 gb|KDO48875.1| hypothetical protein CISIN_1g015435mg [Citrus sinensis]
Length=407

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ +  ++ EW  E++ MA RI S+RQ+L+D+LS +   
Sbjct  283  KLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTP  342

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  343  G-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAI  399



>emb|CDX92520.1| BnaA10g15590D [Brassica napus]
Length=405

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS     +L DAI
Sbjct  341  G-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSTKTVPHLVDAI  397



>gb|ACU21245.1| unknown [Glycine max]
Length=344

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +LFN+W  E++ MA RI ++RQ+L+D+L  +   
Sbjct  220  KLVIRPMYSSPPIHGASIVAAILKDRDLFNDWTIELKAMADRIINMRQELFDALRSRGTP  279

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  280  G-DWSHIIKQIGMFTFTGLNAEQVSFMTKEYHIYMTSDGRISMAGLSSKTVPLLADAI  336



>ref|XP_010532471.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Tarenaya 
hassleriana]
Length=451

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+R++L+D+L  +   
Sbjct  327  KLVIRPMYSNPPIHGASIVAAILRDRNMFNEWTLELKAMADRIISMRKQLFDALRARGTP  386

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  387  G-DWSHIVKQIGMFTFTGLNTAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLTEAI  443



>ref|XP_009120876.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Brassica rapa]
Length=405

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS     +L DAI
Sbjct  341  G-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSTKTVPHLVDAI  397



>emb|CDY65959.1| BnaC09g54080D [Brassica napus]
Length=405

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS     +L DAI
Sbjct  341  G-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSTKTVPHLVDAI  397



>gb|AAC50015.1| aspartate aminotransferase cytosolic isozyme AAT2 [Glycine max]
Length=419

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ +  LFN+W  E++ MA RI S+RQ+L+D+L  +   
Sbjct  295  KLVIRPMYSSPPIHGASIVAAILKDRNLFNDWTIELKAMADRIISMRQELFDALCSRGTP  354

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  355  G-DWSHIIKQIGMFTFTGLNAEQVSFMTKEFHIYMTSDGRISMAGLSSKTVPLLADAI  411



>ref|XP_004243159.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Solanum lycopersicum]
Length=406

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + ++++EW  E++ MA RI S+RQ+LY ++  +   
Sbjct  282  KMVIRPMYSNPPIHGASIVATILKDRQMYDEWTVELKAMADRIISMRQQLYAAMQARGTP  341

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M++++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  342  G-DWSHIIKQIGMFTFTGLNAEQVSFMTSEYHIYMTSDGRISMAGLSSRTVPHLADAM  398



>emb|CAA63894.1| aspartate aminotransferase [Lotus japonicus]
Length=418

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA IVA ++ + +L+NEW  E++ MA RI S+RQ+L+D+L  +   
Sbjct  294  KLVIRPMYSNPPLHGASIVATILKDRDLYNEWTIELKGMADRIISMRQQLFDALRSRGTP  353

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+K IGMF+FTGLN  Q   M+ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  354  G-DWSHIIKSIGMFTFTGLNPEQVSFMTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  410



>ref|XP_006400515.1| hypothetical protein EUTSA_v10013703mg [Eutrema salsugineum]
 gb|ESQ41968.1| hypothetical protein EUTSA_v10013703mg [Eutrema salsugineum]
Length=405

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + E++N+W  E++ MA RI S+R++L+++L  K   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSEMYNDWTIELKGMADRIISMRKQLFEALQAKGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  341  G-DWSHIIKQIGMFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAGLSSKTVPHLVDAI  397



>ref|XP_009367911.1| PREDICTED: aspartate aminotransferase, cytoplasmic isoform X2 
[Pyrus x bretschneideri]
Length=452

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +LF+EW  E++ MA RI S+R +L++SL  K   
Sbjct  328  KLVIRPMYSNPPIHGASIVATILKDRDLFSEWTVELKAMADRIISMRHQLFESLRAKGTP  387

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  388  G-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  444



>ref|XP_009595013.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
tomentosiformis]
Length=448

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  +++EW  E++ MA RI  +RQ+L+D+L  +   
Sbjct  324  KLVIRPMYSNPPIHGASIVATILKDRNMYHEWTLELKAMADRIIRMRQQLFDALRARGTP  383

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  384  G-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  440



>ref|NP_001237541.1| aspartate aminotransferase glyoxysomal isozyme AAT1 precursor 
[Glycine max]
 gb|AAC50014.1| aspartate aminotransferase glyoxysomal isozyme AAT1 precursor 
[Glycine max]
 gb|KHN18198.1| Aspartate aminotransferase 1 [Glycine soja]
Length=456

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ +  LFN+W  E++ MA RI S+RQ+L+D+L  +   
Sbjct  332  KLVIRPMYSSPPIHGASIVAAILKDRNLFNDWTIELKAMADRIISMRQELFDALCSRGTP  391

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  392  G-DWSHIIKQIGMFTFTGLNAEQVSFMTKEFHIYMTSDGRISMAGLSSKTVPLLADAI  448



>gb|KHN10226.1| Aspartate aminotransferase 1 [Glycine soja]
Length=416

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +LFN+W  E++ MA RI ++RQ+L+D+L  +   
Sbjct  292  KLVIRPMYSSPPIHGASIVAAILKDRDLFNDWTIELKAMADRIINMRQELFDALRSRGTP  351

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  352  G-DWSHIIKQIGMFTFTGLNAEQVSFMTKEYHIYMTSDGRISMAGLSSKTVPLLADAI  408



>ref|XP_011090162.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Sesamum indicum]
Length=460

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  ++ EW  E++ MA RI S+RQ+L+D+L  +   
Sbjct  336  KLVIRPMYSNPPIHGASIVATILKDRSMYQEWTIELKAMAERIISMRQQLFDALRSRGTP  395

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  396  G-DWSHIIKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  452



>ref|XP_006399658.1| hypothetical protein EUTSA_v10013515mg [Eutrema salsugineum]
 dbj|BAJ33906.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41111.1| hypothetical protein EUTSA_v10013515mg [Eutrema salsugineum]
Length=453

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R++L+++L  +   
Sbjct  329  KLVIRPMYSSPPIHGASIVAVILRDRNLFNEWTLELKAMADRIISMRKQLFEALRARGTP  388

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS+    +LAD+I
Sbjct  389  G-DWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADSI  445



>gb|KDQ20317.1| hypothetical protein BOTBODRAFT_27738 [Botryobasidium botryosum 
FD-172 SS1]
Length=420

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGARI   ++G+PEL+ +W+ E+  MA RI S+R KLYD+L+   K+
Sbjct  295  KIIVRPMYSNPPIHGARIAGTILGSPELYTQWESEVAGMANRIISMRDKLYDTLTHDLKT  354

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
              +W  I  QIGMFSFTGL   Q++ ++ K HIYMT DGRIS+AGL+     Y A+ +
Sbjct  355  PGEWRHIKSQIGMFSFTGLTPPQTKALAEKAHIYMTGDGRISMAGLNGGNIVYFAEGV  412



>ref|XP_009367910.1| PREDICTED: aspartate aminotransferase, cytoplasmic isoform X1 
[Pyrus x bretschneideri]
Length=460

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ + +LF+EW  E++ MA RI S+R +L++SL  K   
Sbjct  336  KLVIRPMYSNPPIHGASIVATILKDRDLFSEWTVELKAMADRIISMRHQLFESLRAKGTP  395

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  396  G-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAI  452



>ref|XP_006366212.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Solanum 
tuberosum]
Length=453

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ +  L++EW  E++ MA RI  +RQ+L+D+L  K   
Sbjct  329  KLVIRPMYSSPPIHGASIVATILKDRNLYHEWTLELKAMADRIIRMRQQLFDALRAKGTP  388

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  389  G-DWSHIIKQIGMFTFTGLNKEQVAFMTKEYHIYMTSDGRISMAGLSSRTIPHLTDAI  445



>ref|XP_009782665.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
sylvestris]
Length=450

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA ++ +  ++ EW  E++ MA RI  +RQ+L+D+L  +   
Sbjct  326  KLVIRPMYSNPPIHGASIVATILKDRNMYREWTLELKAMADRIIRMRQQLFDALRARGTP  385

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  386  G-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  442



>ref|XP_010048107.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Eucalyptus 
grandis]
 gb|KCW80239.1| hypothetical protein EUGRSUZ_C01585 [Eucalyptus grandis]
Length=406

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA IVA ++ + +++NEW  E++ MA RI S+R +L+++L  +   
Sbjct  282  KLVIRPMYSNPPLHGASIVATILRDKDMYNEWTIELKAMADRIISMRHQLFEALKTRGTP  341

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  342  G-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLSSRTVPHLADAI  398



>ref|XP_009126373.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
[Brassica rapa]
Length=405

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  341  G-DWSHIIKQIGMFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAGLSSKTVPHLVEAI  397



>emb|CDY42276.1| BnaC02g08820D [Brassica napus]
Length=405

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MA RI S+RQ+L+++L  K   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKGMADRIISMRQQLFEALQAKGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLNK Q   M+ ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  341  G-DWSHIIKQIGMFTFTGLNKEQVAFMTKEFHIYMTSDGRISMAGLSSKTVPHLVEAI  397



>gb|KFK26196.1| hypothetical protein AALP_AA8G215200 [Arabis alpina]
Length=405

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +++N+W  E++ MA RI S+R++L+++L  +   
Sbjct  281  KLVVRPMYSSPPIHGASIVATILKSSDMYNDWTIELKAMADRIISMRKQLFEALQTRGTP  340

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIID  247
            G DW+ I+KQIGMF+FTGLN  Q   M+ + HIYMT DGRIS+AGLS+    +LADAI D
Sbjct  341  G-DWSHIIKQIGMFTFTGLNTEQVAFMTKEHHIYMTSDGRISMAGLSSKTVPHLADAIHD  399

Query  246  S  244
            +
Sbjct  400  A  400



>gb|EYU29270.1| hypothetical protein MIMGU_mgv1a006139mg [Erythranthe guttata]
Length=455

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGA IVA V+ +  +F EW  E++ MA RI ++R +L+D+L  +   
Sbjct  331  KLVIRPMYSNPPIHGASIVATVLKDRNMFQEWTVELKAMADRIINMRTQLFDALRSRGTP  390

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  391  G-DWSHIIKQIGMFTFTGLNSKQVAFMTKEYHIYMTSDGRISMAGLSSRTVPHLADAI  447



>gb|AFK40370.1| unknown [Medicago truncatula]
Length=418

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  +   
Sbjct  294  KLVIRPMYSSPPIHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARGTP  353

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  354  G-DWSHIIKQIGMFTFTGLNSEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  410



>ref|XP_009541187.1| hypothetical protein HETIRDRAFT_437828 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW87264.1| hypothetical protein HETIRDRAFT_437828 [Heterobasidion irregulare 
TC 32-1]
Length=425

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGARI   ++  PEL+ EW+ E++ MA RI S+R +LYD+L+   K+
Sbjct  300  KIVIRPMYSNPPLHGARIANTILSKPELYTEWESEVKGMADRIISMRARLYDALTHTHKT  359

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
              +W  I  QIGMFSFTGL+  Q++ ++ K HIYMT DGRIS+AGL+A   +Y A+++
Sbjct  360  PGEWGHIKSQIGMFSFTGLSPPQTKALAEKAHIYMTADGRISMAGLNANNIDYFAESV  417



>gb|KEH36022.1| aspartate aminotransferase [Medicago truncatula]
Length=418

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  +   
Sbjct  294  KLVIRPMYSSPPIHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARGTP  353

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  354  G-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  410



>ref|XP_007298245.1| hypothetical protein STEHIDRAFT_88821 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM92100.1| hypothetical protein STEHIDRAFT_88821 [Stereum hirsutum FP-91666 
SS1]
Length=427

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPP+HGA I   ++  PEL+ EW+ E++ MA RI S+R KLYDSL+   K+
Sbjct  302  KIIVRPMYSNPPLHGALIANTILSKPELYGEWEGEVKGMAERIISMRDKLYDSLTHTHKT  361

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
              +W  I  QIGMFSFTGL   Q++ ++ K HIYMT DGRIS+AGL+A   EY A+++
Sbjct  362  PGEWGHIKSQIGMFSFTGLTPPQTKALAEKAHIYMTADGRISMAGLNANNIEYFAESV  419



>gb|KDN41452.1| hypothetical protein RSAG8_07402, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=153

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGARI   ++ +P L+ +W+ E++ MA RI S+R  LY+SL      
Sbjct  29   KIIVRPMYSNPPIHGARIAGTILADPALYTQWEGEVKGMADRIISMRDTLYNSLKSAGTP  88

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G +W  I  QIGMFSFTGL + Q+  ++ K HIYMT DGRIS+AGL+    EY A+++
Sbjct  89   G-EWGHIKSQIGMFSFTGLTQPQTRALAEKAHIYMTADGRISMAGLNGKNIEYFAESV  145



>emb|CAA43779.1| aspartate aminotransferase [Medicago sativa]
Length=417

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  +   
Sbjct  293  KLVIRPMYSSPPIHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARGTP  352

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  353  G-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  409



>gb|KEH36020.1| aspartate aminotransferase [Medicago truncatula]
Length=458

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYS+PPIHGA IVA ++ + +L+N+W  E++ MA RI ++RQ+L+D+L  +   
Sbjct  334  KLVIRPMYSSPPIHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARGTP  393

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  394  G-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLADAI  450



>emb|CEL53865.1| aspartate aminotransferase [Rhizoctonia solani AG-1 IB]
Length=426

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = -2

Query  606  KRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKS  427
            K + RPMYSNPPIHGARI   ++ +P L+ +W+ E++ MA RI S+R+KLYDSL      
Sbjct  302  KIIVRPMYSNPPIHGARIAGTILADPALYKQWEGEVKGMAERIISMREKLYDSLKGAGTP  361

Query  426  GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  253
            G +W  I  QIGMFSFTGL + Q+  ++ K HIYMT DGRIS+AGL+A   EY A+++
Sbjct  362  G-EWGHIKSQIGMFSFTGLTQPQTRALAEKAHIYMTADGRISMAGLNAGNIEYFAESV  418



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800