BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF043I24

Length=576
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011094205.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.1    3e-20   Sesamum indicum [beniseed]
ref|XP_004228680.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.3    5e-20   Solanum lycopersicum
ref|XP_011077777.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    5e-19   Sesamum indicum [beniseed]
gb|EYU18152.1|  hypothetical protein MIMGU_mgv1a003573mg              94.7    5e-19   Erythranthe guttata [common monkey flower]
ref|XP_007163001.1|  hypothetical protein PHAVU_001G197900g           92.0    2e-18   Phaseolus vulgaris [French bean]
ref|XP_006348432.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.7    3e-18   Solanum tuberosum [potatoes]
ref|XP_006339181.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.7    3e-18   Solanum tuberosum [potatoes]
ref|XP_008387142.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.9    6e-18   Malus domestica [apple tree]
ref|XP_009595093.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.5    8e-18   Nicotiana tomentosiformis
emb|CBI39118.3|  unnamed protein product                              87.0    1e-17   Vitis vinifera
ref|XP_004249393.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.0    2e-17   
emb|CBI39116.3|  unnamed protein product                              85.9    3e-17   Vitis vinifera
ref|XP_003527510.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.8    6e-17   Glycine max [soybeans]
gb|KEH24284.1|  fasciclin-like arabinogalactan protein 16 precursor   87.8    7e-17   Medicago truncatula
ref|XP_002270606.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.7    2e-16   Vitis vinifera
emb|CDP10566.1|  unnamed protein product                              86.7    2e-16   Coffea canephora [robusta coffee]
gb|KFK36481.1|  hypothetical protein AALP_AA4G130300                  86.7    2e-16   Arabis alpina [alpine rockcress]
ref|XP_010426853.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.3    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010503981.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.9    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008450315.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.9    3e-16   Cucumis melo [Oriental melon]
ref|XP_002876139.1|  beta-Ig-H3 domain-containing protein             85.5    4e-16   
ref|XP_006291159.1|  hypothetical protein CARUB_v10017276mg           85.1    5e-16   Capsella rubella
ref|XP_009139464.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.1    6e-16   Brassica rapa
emb|CDX95333.1|  BnaC04g28250D                                        84.7    7e-16   
emb|CDY23209.1|  BnaA04g05500D                                        84.7    7e-16   Brassica napus [oilseed rape]
ref|XP_004154697.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.3    7e-16   
ref|XP_010685475.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    8e-16   
ref|XP_008442961.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    8e-16   Cucumis melo [Oriental melon]
ref|XP_002270321.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.3    1e-15   Vitis vinifera
ref|XP_004139069.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.3    1e-15   
ref|XP_010685474.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.3    1e-15   
ref|XP_004494272.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.3    1e-15   
ref|XP_010515698.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.0    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006592365.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.0    1e-15   Glycine max [soybeans]
ref|XP_002524094.1|  conserved hypothetical protein                   83.6    2e-15   Ricinus communis
ref|XP_010110455.1|  hypothetical protein L484_006448                 83.2    3e-15   Morus notabilis
dbj|BAH20344.1|  AT3G52370                                            79.3    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007204352.1|  hypothetical protein PRUPE_ppa005721mg           82.8    3e-15   
ref|XP_010938934.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...  82.8    4e-15   
gb|KEH29726.1|  fasciclin-like arabinogalactan protein 16 precursor   82.8    4e-15   Medicago truncatula
ref|XP_006403811.1|  hypothetical protein EUTSA_v10010381mg           82.4    4e-15   Eutrema salsugineum [saltwater cress]
ref|XP_010509549.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.0    8e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010543842.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.0    8e-15   Tarenaya hassleriana [spider flower]
ref|XP_004136532.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.0    9e-15   Cucumis sativus [cucumbers]
ref|XP_004167872.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.6    9e-15   
ref|XP_006430020.1|  hypothetical protein CICLE_v10011703mg           81.6    1e-14   Citrus clementina [clementine]
ref|XP_006481636.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.6    1e-14   Citrus sinensis [apfelsine]
ref|XP_006487827.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.6    1e-14   
ref|NP_850253.1|  fasciclin-like arabinogalactan protein 16           80.9    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34484.1|  hypothetical protein AALP_AA5G151600                  80.9    2e-14   Arabis alpina [alpine rockcress]
ref|XP_006294220.1|  hypothetical protein CARUB_v10023217mg           80.9    2e-14   Capsella rubella
ref|NP_190805.1|  fasciclin-like arabinogalactan protein 15           80.9    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516793.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.5    2e-14   Camelina sativa [gold-of-pleasure]
emb|CDX84594.1|  BnaA03g16360D                                        80.5    2e-14   
ref|XP_009133050.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.5    2e-14   Brassica rapa
ref|XP_007132513.1|  hypothetical protein PHAVU_011G100600g           80.5    2e-14   Phaseolus vulgaris [French bean]
ref|XP_002879581.1|  predicted protein                                80.5    2e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_004303393.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.5    2e-14   Fragaria vesca subsp. vesca
emb|CDX79631.1|  BnaC03g19670D                                        80.1    3e-14   
ref|XP_007028043.1|  FASCICLIN-like arabinogalactan protein 17 pr...  79.7    5e-14   
ref|XP_008241098.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.7    5e-14   Prunus mume [ume]
gb|KDP42957.1|  hypothetical protein JCGZ_23899                       79.3    6e-14   Jatropha curcas
ref|XP_006445815.1|  hypothetical protein CICLE_v10015097mg           79.3    7e-14   Citrus clementina [clementine]
gb|EPS67882.1|  hypothetical protein M569_06891                       79.3    7e-14   Genlisea aurea
ref|XP_006424052.1|  hypothetical protein CICLE_v10030024mg           79.0    8e-14   
emb|CDY01050.1|  BnaC05g41500D                                        79.0    8e-14   
ref|XP_010495088.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.5    9e-14   
emb|CDY40429.1|  BnaA04g20880D                                        78.6    9e-14   Brassica napus [oilseed rape]
ref|XP_010505110.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.6    1e-13   Camelina sativa [gold-of-pleasure]
emb|CDY32082.1|  BnaC04g44840D                                        78.6    1e-13   Brassica napus [oilseed rape]
ref|NP_196257.2|  fasciclin-like arabinogalactan protein 17 precu...  78.6    1e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08502.1|  BnaA05g27380D                                        78.2    1e-13   Brassica napus [oilseed rape]
gb|KHN36515.1|  Fasciclin-like arabinogalactan protein 16             77.4    2e-13   Glycine soja [wild soybean]
ref|XP_006410756.1|  hypothetical protein EUTSA_v10016656mg           78.2    2e-13   Eutrema salsugineum [saltwater cress]
ref|XP_009141525.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.2    2e-13   Brassica rapa
ref|XP_009348615.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.2    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_006407421.1|  hypothetical protein EUTSA_v10020679mg           78.2    2e-13   Eutrema salsugineum [saltwater cress]
ref|XP_009362660.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.2    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_009146690.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.2    2e-13   Brassica rapa
ref|XP_003540278.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.8    2e-13   Glycine max [soybeans]
ref|XP_008392004.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.8    2e-13   
ref|XP_003521503.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.8    2e-13   Glycine max [soybeans]
ref|XP_006297639.1|  hypothetical protein CARUB_v10013670mg           77.8    2e-13   Capsella rubella
ref|XP_010452564.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.4    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_004296276.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.4    2e-13   Fragaria vesca subsp. vesca
ref|XP_010917919.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.8    2e-13   Elaeis guineensis
ref|XP_010423345.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.4    3e-13   Camelina sativa [gold-of-pleasure]
gb|KDP36078.1|  hypothetical protein JCGZ_08722                       77.4    3e-13   Jatropha curcas
ref|XP_006487826.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.0    3e-13   Citrus sinensis [apfelsine]
emb|CDY47922.1|  BnaAnng09540D                                        74.7    4e-13   Brassica napus [oilseed rape]
ref|XP_003543398.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.0    4e-13   Glycine max [soybeans]
ref|XP_010045160.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.0    4e-13   Eucalyptus grandis [rose gum]
ref|XP_002515862.1|  conserved hypothetical protein                   76.6    5e-13   Ricinus communis
gb|EYU38707.1|  hypothetical protein MIMGU_mgv1a006053mg              76.6    5e-13   Erythranthe guttata [common monkey flower]
ref|XP_010525828.1|  PREDICTED: fasciclin-like arabinogalactan pr...  76.3    6e-13   Tarenaya hassleriana [spider flower]
dbj|BAE71191.1|  hypothetical protein                                 76.3    7e-13   Trifolium pratense [peavine clover]
ref|XP_010248022.1|  PREDICTED: fasciclin-like arabinogalactan pr...  76.3    7e-13   Nelumbo nucifera [Indian lotus]
ref|XP_007150000.1|  hypothetical protein PHAVU_005G117500g           76.3    8e-13   Phaseolus vulgaris [French bean]
ref|XP_008798695.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.9    8e-13   Phoenix dactylifera
ref|XP_008803482.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...  75.9    9e-13   Phoenix dactylifera
ref|XP_011032963.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.9    9e-13   Populus euphratica
ref|XP_004506247.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.9    9e-13   
ref|XP_007010508.1|  FASCICLIN-like arabinogalactan protein 16 pr...  75.9    1e-12   
ref|XP_010491197.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.5    1e-12   Camelina sativa [gold-of-pleasure]
gb|ABV27485.1|  fasciclin-like arabinogalactan protein 14             75.5    1e-12   Gossypium hirsutum [American cotton]
ref|XP_010557991.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.1    2e-12   Tarenaya hassleriana [spider flower]
gb|KHG03559.1|  Fasciclin-like arabinogalactan protein 17             74.3    3e-12   Gossypium arboreum [tree cotton]
ref|XP_009121226.1|  PREDICTED: fasciclin-like arabinogalactan pr...  74.3    3e-12   Brassica rapa
ref|XP_003554480.1|  PREDICTED: fasciclin-like arabinogalactan pr...  74.3    4e-12   Glycine max [soybeans]
ref|XP_006287712.1|  hypothetical protein CARUB_v10000921mg           73.9    4e-12   
ref|XP_010553413.1|  PREDICTED: fasciclin-like arabinogalactan pr...  73.6    5e-12   Tarenaya hassleriana [spider flower]
ref|XP_010677585.1|  PREDICTED: fasciclin-like arabinogalactan pr...  73.2    8e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010908912.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.4    1e-11   Elaeis guineensis
ref|XP_011047143.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.4    1e-11   Populus euphratica
ref|XP_002309262.1|  hypothetical protein POPTR_0006s21460g           72.4    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010534382.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.4    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_003596932.1|  Fasciclin-like arabinogalactan protein           72.0    2e-11   Medicago truncatula
gb|AGN92422.1|  putative fasciclin-like arabinogalactan protein 2     72.0    2e-11   Centaurium erythraea
ref|XP_002322769.2|  hypothetical protein POPTR_0016s06680g           72.0    2e-11   Populus trichocarpa [western balsam poplar]
ref|NP_566398.1|  FASCICLIN-like arabinogalactan protein 18 precu...  71.6    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KJB36230.1|  hypothetical protein B456_006G147500                  71.6    2e-11   Gossypium raimondii
ref|XP_009587619.1|  PREDICTED: fasciclin-like arabinogalactan pr...  71.6    3e-11   Nicotiana tomentosiformis
ref|XP_009794483.1|  PREDICTED: fasciclin-like arabinogalactan pr...  71.2    3e-11   Nicotiana sylvestris
ref|XP_010497995.1|  PREDICTED: fasciclin-like arabinogalactan pr...  71.6    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010464900.1|  PREDICTED: fasciclin-like arabinogalactan pr...  71.2    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010486838.1|  PREDICTED: fasciclin-like arabinogalactan pr...  71.2    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_002882744.1|  beta-Ig-H3 domain-containing protein             71.2    3e-11   
gb|KJB73326.1|  hypothetical protein B456_011G228300                  71.6    3e-11   Gossypium raimondii
gb|KJB73327.1|  hypothetical protein B456_011G228300                  71.2    3e-11   Gossypium raimondii
ref|XP_002871217.1|  beta-Ig-H3 domain-containing protein             71.2    4e-11   
ref|XP_011076879.1|  PREDICTED: fasciclin-like arabinogalactan pr...  70.5    6e-11   Sesamum indicum [beniseed]
gb|KJB78512.1|  hypothetical protein B456_013G003200                  70.5    6e-11   Gossypium raimondii
gb|KHN41248.1|  Fasciclin-like arabinogalactan protein 16             67.8    1e-10   Glycine soja [wild soybean]
ref|XP_006826417.1|  hypothetical protein AMTR_s00004p00159330        69.3    1e-10   Amborella trichopoda
ref|XP_011024125.1|  PREDICTED: fasciclin-like arabinogalactan pr...  69.3    1e-10   Populus euphratica
gb|ABV27487.1|  fasciclin-like arabinogalactan protein 16             69.3    1e-10   Gossypium hirsutum [American cotton]
ref|XP_009783700.1|  PREDICTED: fasciclin-like arabinogalactan pr...  69.3    1e-10   Nicotiana sylvestris
ref|XP_006399111.1|  hypothetical protein EUTSA_v10013481mg           69.3    1e-10   Eutrema salsugineum [saltwater cress]
ref|XP_004487436.1|  PREDICTED: fasciclin-like arabinogalactan pr...  68.9    2e-10   Cicer arietinum [garbanzo]
ref|XP_009388984.1|  PREDICTED: fasciclin-like arabinogalactan pr...  68.9    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011042549.1|  PREDICTED: fasciclin-like arabinogalactan pr...  68.2    3e-10   Populus euphratica
gb|ABV27486.1|  fasciclin-like arabinogalactan protein 15             68.2    4e-10   Gossypium hirsutum [American cotton]
gb|KCW90413.1|  hypothetical protein EUGRSUZ_A02551                   67.8    5e-10   Eucalyptus grandis [rose gum]
gb|KHN21208.1|  Fasciclin-like arabinogalactan protein 18             65.5    6e-10   Glycine soja [wild soybean]
tpg|DAA51811.1|  TPA: hypothetical protein ZEAMMB73_870378            63.9    6e-10   
ref|XP_008790162.1|  PREDICTED: fasciclin-like arabinogalactan pr...  67.8    6e-10   Phoenix dactylifera
ref|XP_010090522.1|  hypothetical protein L484_017146                 67.4    6e-10   
ref|XP_009387789.1|  PREDICTED: fasciclin-like arabinogalactan pr...  67.0    8e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB36232.1|  hypothetical protein B456_006G147500                  67.0    8e-10   Gossypium raimondii
gb|ABI95416.1|  fasciclin-like protein FLA26                          67.0    9e-10   Triticum aestivum [Canadian hard winter wheat]
emb|CDY55758.1|  BnaA03g55350D                                        67.0    1e-09   Brassica napus [oilseed rape]
gb|ACF84712.1|  unknown                                               63.9    1e-09   Zea mays [maize]
emb|CDX81004.1|  BnaC03g02580D                                        65.9    2e-09   
ref|XP_004981498.1|  PREDICTED: fasciclin-like arabinogalactan pr...  65.5    3e-09   Setaria italica
ref|XP_009399002.1|  PREDICTED: fasciclin-like arabinogalactan pr...  65.5    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006651890.1|  PREDICTED: fasciclin-like arabinogalactan pr...  65.1    3e-09   Oryza brachyantha
ref|XP_002461483.1|  hypothetical protein SORBIDRAFT_02g003410        65.5    3e-09   Sorghum bicolor [broomcorn]
gb|ABI95415.1|  fasciclin-like protein FLA25                          65.1    4e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009130939.1|  PREDICTED: fasciclin-like arabinogalactan pr...  64.7    5e-09   
ref|XP_006658293.1|  PREDICTED: fasciclin-like arabinogalactan pr...  63.9    9e-09   
ref|NP_001130335.1|  uncharacterized protein LOC100191430 precursor   63.5    1e-08   Zea mays [maize]
tpg|DAA51813.1|  TPA: LOW QUALITY PROTEIN: fasciclin domain protein   63.5    1e-08   
gb|ACG39696.1|  fasciclin domain                                      63.5    1e-08   Zea mays [maize]
emb|CDX98919.1|  BnaC09g49160D                                        63.5    1e-08   
ref|XP_002463768.1|  hypothetical protein SORBIDRAFT_01g005770        63.2    1e-08   Sorghum bicolor [broomcorn]
ref|XP_010263095.1|  PREDICTED: fasciclin-like arabinogalactan pr...  63.2    2e-08   Nelumbo nucifera [Indian lotus]
gb|ABI95417.1|  fasciclin-like protein FLA27                          63.2    2e-08   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001051504.1|  Os03g0788600                                     63.2    2e-08   
gb|AAD21471.1|  unknown protein                                       62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122246.1|  PREDICTED: fasciclin-like arabinogalactan pr...  62.8    2e-08   Brassica rapa
emb|CDY57989.1|  BnaA10g30360D                                        62.4    3e-08   Brassica napus [oilseed rape]
ref|NP_001159324.1|  uncharacterized protein LOC100304417 precursor   61.6    5e-08   Zea mays [maize]
ref|NP_001051505.1|  Os03g0788700                                     61.6    6e-08   
dbj|BAJ87361.1|  predicted protein                                    61.6    6e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001058941.1|  Os07g0160600                                     61.2    7e-08   
ref|XP_004494271.1|  PREDICTED: fasciclin-like arabinogalactan pr...  61.2    7e-08   
ref|XP_003559349.1|  PREDICTED: fasciclin-like arabinogalactan pr...  60.5    1e-07   Brachypodium distachyon [annual false brome]
dbj|BAB08961.1|  unnamed protein product                              58.9    4e-07   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ97817.1|  predicted protein                                    58.5    5e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98684.1|  predicted protein                                    58.5    5e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO48671.1|  hypothetical protein CISIN_1g013434mg                 57.8    1e-06   Citrus sinensis [apfelsine]
ref|XP_004955500.1|  PREDICTED: fasciclin-like arabinogalactan pr...  57.4    1e-06   Setaria italica
gb|EMT18986.1|  hypothetical protein F775_43653                       52.8    3e-06   
ref|XP_006651891.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...  55.8    4e-06   
gb|KHN17997.1|  Fasciclin-like arabinogalactan protein 16             53.5    5e-06   Glycine soja [wild soybean]
ref|XP_006379436.1|  hypothetical protein POPTR_0008s013101g          55.1    8e-06   
ref|XP_006379435.1|  hypothetical protein POPTR_0008s013101g          55.1    8e-06   
gb|KHG00930.1|  Fasciclin-like arabinogalactan protein 17             54.3    1e-05   Gossypium arboreum [tree cotton]
ref|XP_003557575.1|  PREDICTED: fasciclin-like arabinogalactan pr...  54.3    1e-05   Brachypodium distachyon [annual false brome]
gb|EYU19863.1|  hypothetical protein MIMGU_mgv1a006599mg              54.3    1e-05   Erythranthe guttata [common monkey flower]
gb|KCW90412.1|  hypothetical protein EUGRSUZ_A02551                   53.9    2e-05   Eucalyptus grandis [rose gum]
ref|XP_010058812.1|  PREDICTED: fasciclin-like arabinogalactan pr...  53.9    2e-05   Eucalyptus grandis [rose gum]
gb|KHG10334.1|  Fasciclin-like arabinogalactan protein 17             53.1    3e-05   Gossypium arboreum [tree cotton]
gb|AAF02137.1|AC009918_9  unknown protein                             52.4    5e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EMS51573.1|  hypothetical protein TRIUR3_27345                     50.4    6e-05   Triticum urartu
gb|KDO48944.1|  hypothetical protein CISIN_1g043668mg                 50.8    2e-04   Citrus sinensis [apfelsine]
gb|ABK25995.1|  unknown                                               49.3    3e-04   Picea sitchensis
gb|ABK25415.1|  unknown                                               49.7    5e-04   Picea sitchensis
gb|KHN43596.1|  Fasciclin-like arabinogalactan protein 15             49.3    5e-04   Glycine soja [wild soybean]
ref|XP_002315410.2|  hypothetical protein POPTR_0010s25110g           49.3    6e-04   
gb|EEC81554.1|  hypothetical protein OsI_24980                        48.9    0.001   Oryza sativa Indica Group [Indian rice]



>ref|XP_011094205.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Sesamum 
indicum]
Length=465

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFPPE S   AP A+P+AKVVSKPRRGKL+EMAC +LG+
Sbjct  399  DPDIYTDGRISVQGIDGVLFPPEESK-VAPTAAPVAKVVSKPRRGKLLEMACTLLGT  454



>ref|XP_004228680.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Solanum 
lycopersicum]
Length=439

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 53/64 (83%), Gaps = 5/64 (8%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPL----AKVVSKPRRGKLMEMACGMLG  407
            DPDIYTDGRISVQGIDGVLFP E     APK++PL    AKVV+KPRRGKLME+AC M+G
Sbjct  377  DPDIYTDGRISVQGIDGVLFPVEDIK-VAPKSAPLVGGDAKVVAKPRRGKLMEVACSMMG  435

Query  406  SFCH  395
            SFCH
Sbjct  436  SFCH  439



>ref|XP_011077777.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Sesamum 
indicum]
Length=463

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 2/57 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFPPE     APK +P+AK+VSKPRRGKL+E+AC MLG+
Sbjct  398  DPDIYTDGRISVQGIDGVLFPPE--EIKAPKTAPVAKIVSKPRRGKLLELACSMLGA  452



>gb|EYU18152.1| hypothetical protein MIMGU_mgv1a003573mg [Erythranthe guttata]
 gb|EYU18153.1| hypothetical protein MIMGU_mgv1a003573mg [Erythranthe guttata]
Length=576

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 4/63 (6%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGML---GS  404
            DPDIYTDGRISVQGIDGVLFPPE +  AAPK +P AK+ SKPRRGKL+EMAC ML   GS
Sbjct  515  DPDIYTDGRISVQGIDGVLFPPEETT-AAPKPAPSAKIASKPRRGKLLEMACTMLGAVGS  573

Query  403  FCH  395
             CH
Sbjct  574  SCH  576



>ref|XP_007163001.1| hypothetical protein PHAVU_001G197900g [Phaseolus vulgaris]
 gb|ESW34995.1| hypothetical protein PHAVU_001G197900g [Phaseolus vulgaris]
Length=437

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDI+TDGRISVQGIDGVLFPPE       + +PL KV +KPRRGKLME+AC MLG+F
Sbjct  375  DPDIHTDGRISVQGIDGVLFPPEELEERTRRTTPLVKVAAKPRRGKLMEVACSMLGAF  432



>ref|XP_006348432.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Solanum 
tuberosum]
Length=436

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 52/66 (79%), Gaps = 7/66 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPL------AKVVSKPRRGKLMEMACGM  413
            DPDIYTDGRISVQGIDGVLFP E     APK++P+      AKVV+K RRGKLME+AC M
Sbjct  372  DPDIYTDGRISVQGIDGVLFPVEDIK-VAPKSAPVVAAAGDAKVVAKQRRGKLMEVACSM  430

Query  412  LGSFCH  395
            +GSFCH
Sbjct  431  MGSFCH  436



>ref|XP_006339181.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Solanum 
tuberosum]
Length=453

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 5/64 (8%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF--  401
            DPDIYTDGRISVQG+DGVLFP E    A P A+P+AKVV+KPRRGKLME+ CG +GSF  
Sbjct  391  DPDIYTDGRISVQGVDGVLFPLEEIK-ATPIAAPVAKVVAKPRRGKLMEVVCGTMGSFAF  449

Query  400  --CH  395
              CH
Sbjct  450  ASCH  453



>ref|XP_008387142.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Malus domestica]
Length=455

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSFCH  395
            DPDIYTDGRISVQGIDGVL+P E    A  K++P+ KV +KPRRGKLME+AC MLG+  H
Sbjct  388  DPDIYTDGRISVQGIDGVLYPTEEEAKAEKKSAPVVKVAAKPRRGKLMEVACRMLGAVGH  447



>ref|XP_009595093.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
tomentosiformis]
Length=454

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 5/64 (8%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF--  401
            DPDIYTDGRISVQG+DGVLFP E      P A+P+AK+V+KPRRGKLME+ CG LGSF  
Sbjct  392  DPDIYTDGRISVQGVDGVLFPIEEIK-VTPVAAPVAKLVAKPRRGKLMEVVCGTLGSFAF  450

Query  400  --CH  395
              CH
Sbjct  451  ASCH  454



>emb|CBI39118.3| unnamed protein product [Vitis vinifera]
Length=192

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPA-APKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFPPE        K S  AKVVSK RRGKLME+AC MLG+F
Sbjct  124  DPDIYTDGRISVQGIDGVLFPPEEKESKPETKTSRAAKVVSKSRRGKLMEVACRMLGAF  182



>ref|XP_004249393.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Solanum 
lycopersicum]
Length=449

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 9/64 (14%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF--  401
            DPDIYTDGRISVQG+DGVLFP E       KA+P+AKVV+KPRRGKLME+ CG +GSF  
Sbjct  391  DPDIYTDGRISVQGVDGVLFPLEEI-----KAAPVAKVVAKPRRGKLMEVVCGTMGSFAF  445

Query  400  --CH  395
              CH
Sbjct  446  ASCH  449



>emb|CBI39116.3| unnamed protein product [Vitis vinifera]
Length=178

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPA-APKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E        K S + K+V+KPRRGKLME+AC MLG+F
Sbjct  110  DPDIYTDGRISVQGIDGVLFPAEEKETKLEAKTSRVTKLVAKPRRGKLMEVACRMLGAF  168



>ref|XP_003527510.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Glycine max]
 ref|XP_006582372.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X2 [Glycine max]
Length=447

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAP--KASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFPP+    A P  +A P AKVV K RRGKL+E AC MLGSF
Sbjct  379  DPDIYTDGRISVQGIDGVLFPPQEEEAAGPVTRAQP-AKVVVKQRRGKLLETACWMLGSF  437



>gb|KEH24284.1| fasciclin-like arabinogalactan protein 16 precursor [Medicago 
truncatula]
Length=448

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 6/64 (9%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSN------PAAPKASPLAKVVSKPRRGKLMEMACGM  413
            DPDIYTDGRISVQGIDGVL PPE  N      P     +PL KV SKPRRGKL+++AC M
Sbjct  380  DPDIYTDGRISVQGIDGVLLPPEEENEDESSTPIRRVKTPLVKVASKPRRGKLLQLACSM  439

Query  412  LGSF  401
            +GSF
Sbjct  440  VGSF  443



>ref|XP_002270606.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Vitis vinifera]
Length=466

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPA-APKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFPPE        K S  AKVVSK RRGKLME+AC MLG+F
Sbjct  398  DPDIYTDGRISVQGIDGVLFPPEEKESKPETKTSRAAKVVSKSRRGKLMEVACRMLGAF  456



>emb|CDP10566.1| unnamed protein product [Coffea canephora]
Length=474

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVL PPE +  A   + P+AK   KPRRGKLME+AC MLG+F
Sbjct  407  DPDIYTDGRISVQGIDGVLMPPEETKLAPKSSPPVAKAAVKPRRGKLMEVACRMLGAF  464



>gb|KFK36481.1| hypothetical protein AALP_AA4G130300 [Arabis alpina]
Length=447

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPK--ASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E + PA     ++P+ K VSKPRRGKLME+AC M+GS
Sbjct  383  DPDIYTDGRISVQGIDGVLFPVEETTPATEVKPSAPVVKKVSKPRRGKLMEVACNMIGS  441



>ref|XP_010426853.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Camelina 
sativa]
Length=435

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +      A+P+ K  +KPRRGKLME+AC MLGS
Sbjct  373  DPDIYTDGRISVQGIDGVLFPEEKTPVEKKTAAPVVKKTTKPRRGKLMEVACTMLGS  429



>ref|XP_010503981.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Camelina 
sativa]
Length=435

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +      A+P+ K  +KPRRGKLME+AC MLGS
Sbjct  373  DPDIYTDGRISVQGIDGVLFPEEKTPVEKKTAAPVVKKTTKPRRGKLMEVACTMLGS  429



>ref|XP_008450315.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Cucumis 
melo]
 ref|XP_008450316.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Cucumis 
melo]
Length=466

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSN-PAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFPPE +    + K     KVV+KPRRGKL+E+AC MLG+F
Sbjct  398  DPDIYTDGRISVQGIDGVLFPPEEAEAKVSVKTVQHVKVVTKPRRGKLLEVACRMLGAF  456



>ref|XP_002876139.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52398.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPK-ASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLF PE  NP   K A+P+ K  +KPRRGKLME+AC MLGS
Sbjct  373  DPDIYTDGRISVQGIDGVLF-PEEKNPVEKKTAAPVVKKAAKPRRGKLMEVACTMLGS  429



>ref|XP_006291159.1| hypothetical protein CARUB_v10017276mg [Capsella rubella]
 gb|EOA24057.1| hypothetical protein CARUB_v10017276mg [Capsella rubella]
Length=437

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +      A+P+ K  +KPRRGKLME+AC MLGS
Sbjct  375  DPDIYTDGRISVQGIDGVLFPEEKTPVEKKTAAPVVKKAAKPRRGKLMEVACTMLGS  431



>ref|XP_009139464.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Brassica 
rapa]
Length=440

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSFCH  395
            DPDIYTDGRISVQGIDGVLFP E +      A P+ K  +KPRRGKLME+AC M GS  H
Sbjct  378  DPDIYTDGRISVQGIDGVLFPEEETPVEKKSAGPVVKKTAKPRRGKLMEVACRMFGSQFH  437



>emb|CDX95333.1| BnaC04g28250D [Brassica napus]
Length=440

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSFCH  395
            DPDIYTDGRISVQGIDGVLFP E +      A P+ K  +KPRRGKLME+AC M GS  H
Sbjct  378  DPDIYTDGRISVQGIDGVLFPEEETPVEKKSAGPVVKKTAKPRRGKLMEVACRMFGSQFH  437



>emb|CDY23209.1| BnaA04g05500D [Brassica napus]
Length=440

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSFCH  395
            DPDIYTDGRISVQGIDGVLFP E +      A P+ K  +KPRRGKLME+AC M GS  H
Sbjct  378  DPDIYTDGRISVQGIDGVLFPEEETPVEKKSAGPVVKKTAKPRRGKLMEVACRMFGSQFH  437



>ref|XP_004154697.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like, partial 
[Cucumis sativus]
Length=399

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPA-APKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFPPE +    + K     KVV+KPRRGKL+E+ C MLG+F
Sbjct  331  DPDIYTDGRISVQGIDGVLFPPEEAEEKLSVKTVQHVKVVTKPRRGKLLEVTCRMLGAF  389



>ref|XP_010685475.1| PREDICTED: fasciclin-like arabinogalactan protein 17 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=443

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNP--AAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E  +   +A + S  AKVV+KPRRGKLME  C MLG+
Sbjct  376  DPDIYTDGRISVQGIDGVLFPIEEKDHQISALQKSTRAKVVTKPRRGKLMETTCWMLGT  434



>ref|XP_008442961.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Cucumis 
melo]
Length=465

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E       K++   KV +KPRRGKLME+ C MLG+F
Sbjct  398  DPDIYTDGRISVQGIDGVLFPLEEEKAPEKKSNSALKVATKPRRGKLMELTCTMLGAF  455



>ref|XP_002270321.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Vitis vinifera]
Length=466

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPA-APKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E        K S + K+V+KPRRGKLME+AC MLG+F
Sbjct  398  DPDIYTDGRISVQGIDGVLFPAEEKETKLEAKTSRVTKLVAKPRRGKLMEVACRMLGAF  456



>ref|XP_004139069.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cucumis 
sativus]
 gb|KGN66568.1| hypothetical protein Csa_1G629740 [Cucumis sativus]
Length=466

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPA-APKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFPPE +    + K     KVV+KPRRGKL+E+ C MLG+F
Sbjct  398  DPDIYTDGRISVQGIDGVLFPPEEAEEKLSVKTVQHVKVVTKPRRGKLLEVTCRMLGAF  456



>ref|XP_010685474.1| PREDICTED: fasciclin-like arabinogalactan protein 17 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=462

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNP--AAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E  +   +A + S  AKVV+KPRRGKLME  C MLG+ 
Sbjct  395  DPDIYTDGRISVQGIDGVLFPIEEKDHQISALQKSTRAKVVTKPRRGKLMETTCWMLGTM  454



>ref|XP_004494272.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X2 [Cicer arietinum]
Length=453

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 4/62 (6%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNP----AAPKASPLAKVVSKPRRGKLMEMACGMLG  407
            DPDIYTDGRISVQGIDGVL PPE  +           PL KV +KPRRGKL+E+AC M+G
Sbjct  387  DPDIYTDGRISVQGIDGVLLPPEEESEDDSSIRHTKIPLVKVATKPRRGKLLELACSMVG  446

Query  406  SF  401
            SF
Sbjct  447  SF  448



>ref|XP_010515698.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Camelina 
sativa]
Length=435

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +       +P+ K  +KPRRGKLME+AC MLGS
Sbjct  373  DPDIYTDGRISVQGIDGVLFPEEKTPVEKKTVAPVIKKTTKPRRGKLMEVACTMLGS  429



>ref|XP_006592365.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Glycine 
max]
Length=453

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFPP+  +      S  AKVV K RRGKL+E AC MLGSF
Sbjct  386  DPDIYTDGRISVQGIDGVLFPPQEEDAGPVTRSKPAKVVVKQRRGKLLETACWMLGSF  443



>ref|XP_002524094.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38304.1| conserved hypothetical protein [Ricinus communis]
Length=462

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIY+DGRISVQGIDGVLFP E       K +   KVV+K RRGKLME+AC MLG+F
Sbjct  394  DPDIYSDGRISVQGIDGVLFPEEEKETTDAKPTTSVKVVTKARRGKLMEVACRMLGAF  451



>ref|XP_010110455.1| hypothetical protein L484_006448 [Morus notabilis]
 gb|EXC26397.1| hypothetical protein L484_006448 [Morus notabilis]
Length=460

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKP-RRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFPPE    +  K S   KV +KP RRGKLMEMAC +L  F
Sbjct  394  DPDIYTDGRISVQGIDGVLFPPEEETASEKKTSSPVKVATKPTRRGKLMEMACNVLEVF  452



>dbj|BAH20344.1| AT3G52370 [Arabidopsis thaliana]
Length=149

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +        P+ K   KPRRGKLME+AC MLGS
Sbjct  87   DPDIYTDGRISVQGIDGVLFPEEKTPVEKKTGVPVVKKAPKPRRGKLMEVACTMLGS  143



>ref|XP_007204352.1| hypothetical protein PRUPE_ppa005721mg [Prunus persica]
 gb|EMJ05551.1| hypothetical protein PRUPE_ppa005721mg [Prunus persica]
Length=447

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP-PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSFC  398
            DPDIYTDGRISVQGIDGVLFP  E    A  K +P+ KV +KPRRGKLME+AC MLG+F 
Sbjct  379  DPDIYTDGRISVQGIDGVLFPFEEEEVKAEKKTAPVVKVAAKPRRGKLMEVACRMLGAFG  438

Query  397  H  395
            H
Sbjct  439  H  439



>ref|XP_010938934.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 17 [Elaeis guineensis]
Length=468

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVV--SKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGID VLFPPE   PAA   + L K V  +KPRRGKL+E+ C M+G+F
Sbjct  399  DPDIYTDGRISVQGIDAVLFPPEEETPAAVAPTALRKTVQAAKPRRGKLLELGCQMVGAF  458



>gb|KEH29726.1| fasciclin-like arabinogalactan protein 16 precursor [Medicago 
truncatula]
Length=466

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 44/64 (69%), Gaps = 6/64 (9%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPL------AKVVSKPRRGKLMEMACGM  413
            DPDIYTDGRISVQGIDGVLFP E       KA         AKVV+K RRGKL+E AC M
Sbjct  394  DPDIYTDGRISVQGIDGVLFPHEEKEEVVDKAVTQERKGKPAKVVAKQRRGKLLETACWM  453

Query  412  LGSF  401
            LG+F
Sbjct  454  LGTF  457



>ref|XP_006403811.1| hypothetical protein EUTSA_v10010381mg [Eutrema salsugineum]
 gb|ESQ45264.1| hypothetical protein EUTSA_v10010381mg [Eutrema salsugineum]
Length=441

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKAS--PLAKVVSKPRRGKLMEMACGMLGS-  404
            DPDIYTDGRISVQGIDGVLFP E + P   K S  P+ K  +KPRRGKLME+AC +LGS 
Sbjct  378  DPDIYTDGRISVQGIDGVLFPEEET-PVKKKNSVGPVVKKTAKPRRGKLMEVACTLLGSQ  436

Query  403  --FCH  395
               CH
Sbjct  437  FLICH  441



>ref|XP_010509549.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=445

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPK-ASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +     K ASP+ K V+K RRGKLME+AC M+GS
Sbjct  382  DPDIYTDGRISVQGIDGVLFPAEETPATEIKPASPVVKKVAKSRRGKLMEVACRMMGS  439



>ref|XP_010543842.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Tarenaya 
hassleriana]
Length=468

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E +   A K S   K V+ PRRGKL+E+AC MLG+F
Sbjct  402  DPDIYTDGRISVQGIDGVLFPEEETE-TAKKPSSAVKKVAHPRRGKLLEVACRMLGAF  458



>ref|XP_004136532.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cucumis 
sativus]
 gb|KGN59239.1| hypothetical protein Csa_3G783850 [Cucumis sativus]
Length=465

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E       K++   KV +KPRRGKLME+ C MLG+
Sbjct  398  DPDIYTDGRISVQGIDGVLFPLEEDKAPEKKSNSALKVATKPRRGKLMELTCTMLGA  454



>ref|XP_004167872.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cucumis 
sativus]
Length=465

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E       K++   KV +KPRRGKLME+ C MLG+
Sbjct  398  DPDIYTDGRISVQGIDGVLFPLEEDKAPEKKSNSALKVATKPRRGKLMELTCTMLGA  454



>ref|XP_006430020.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
 ref|XP_006430021.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
 gb|ESR43260.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
 gb|ESR43261.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
Length=451

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 2/57 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E + P   K + + KVV+KPRRGKLME+AC MLG+
Sbjct  386  DPDIYTDGRISVQGIDGVLFPEEET-PTVKKPAAV-KVVTKPRRGKLMEVACRMLGA  440



>ref|XP_006481636.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Citrus 
sinensis]
Length=451

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 2/57 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E + P   K + + KVV+KPRRGKLME+AC MLG+
Sbjct  386  DPDIYTDGRISVQGIDGVLFPEEET-PTVKKPAAV-KVVTKPRRGKLMEVACRMLGA  440



>ref|XP_006487827.1| PREDICTED: fasciclin-like arabinogalactan protein 18-like [Citrus 
sinensis]
Length=180

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 45/69 (65%), Gaps = 9/69 (13%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKP-RRGKLMEMACGMLGSF-  401
            DPDIYTDGRISVQGIDGVLFP +       K   + K+ +KP RRGKL+E AC MLG+F 
Sbjct  112  DPDIYTDGRISVQGIDGVLFPVKEGTKDWKKTKTVVKLAAKPARRGKLLEAACWMLGAFR  171

Query  400  -------CH  395
                   CH
Sbjct  172  QDSRFITCH  180



>ref|NP_850253.1| fasciclin-like arabinogalactan protein 16 [Arabidopsis thaliana]
 sp|Q8RWC5.1|FLA16_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 16; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAM13188.1| unknown protein [Arabidopsis thaliana]
 gb|AAP31934.1| At2g35860 [Arabidopsis thaliana]
 gb|AEC09172.1| fasciclin-like arabinogalactan protein 16 [Arabidopsis thaliana]
Length=445

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 47/59 (80%), Gaps = 3/59 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE--PSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E  P+    P A+P+ K VSK RRGKLME+AC M+GS
Sbjct  382  DPDIYTDGRISVQGIDGVLFPKEETPATEIKP-AAPVVKKVSKSRRGKLMEVACRMMGS  439



>gb|KFK34484.1| hypothetical protein AALP_AA5G151600 [Arabis alpina]
Length=430

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +         + K  +KPRRGKLME+AC MLGS
Sbjct  368  DPDIYTDGRISVQGIDGVLFPDEETPVEKKTTGTVVKKTAKPRRGKLMEVACSMLGS  424



>ref|XP_006294220.1| hypothetical protein CARUB_v10023217mg [Capsella rubella]
 gb|EOA27118.1| hypothetical protein CARUB_v10023217mg [Capsella rubella]
Length=445

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPK-ASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +     K ASP+ K V+K RRGKLME+AC M+GS
Sbjct  382  DPDIYTDGRISVQGIDGVLFPREETPATEIKPASPVVKKVAKSRRGKLMEVACRMMGS  439



>ref|NP_190805.1| fasciclin-like arabinogalactan protein 15 [Arabidopsis thaliana]
 sp|Q9FT45.1|FLA15_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 15; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC07928.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42264.1| GPI-anchored protein [Arabidopsis thaliana]
 gb|ABG48483.1| At3g52370 [Arabidopsis thaliana]
 gb|AEE78939.1| fasciclin-like arabinogalactan protein 15 [Arabidopsis thaliana]
Length=436

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +        P+ K   KPRRGKLME+AC MLGS
Sbjct  374  DPDIYTDGRISVQGIDGVLFPEEKTPVEKKTGVPVVKKAPKPRRGKLMEVACTMLGS  430



>ref|XP_010516793.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=445

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPK-ASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +     K A+P+ K V+K RRGKLME+AC M+GS
Sbjct  382  DPDIYTDGRISVQGIDGVLFPAEETPATEIKPAAPVVKKVAKSRRGKLMEVACRMMGS  439



>emb|CDX84594.1| BnaA03g16360D [Brassica napus]
Length=446

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPK-ASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +     K A+P+ K V+K RRGKLME+AC M+GS
Sbjct  383  DPDIYTDGRISVQGIDGVLFPVEETPATEIKPAAPVVKKVAKSRRGKLMEVACKMMGS  440



>ref|XP_009133050.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Brassica 
rapa]
Length=446

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPK-ASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +     K A+P+ K V+K RRGKLME+AC M+GS
Sbjct  383  DPDIYTDGRISVQGIDGVLFPVEETPATEIKPAAPVVKKVAKSRRGKLMEVACKMMGS  440



>ref|XP_007132513.1| hypothetical protein PHAVU_011G100600g [Phaseolus vulgaris]
 gb|ESW04507.1| hypothetical protein PHAVU_011G100600g [Phaseolus vulgaris]
Length=450

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 47/60 (78%), Gaps = 4/60 (7%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAP--KASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIY DGRISVQGIDGVLFPP+  + A P  +A P AKVV K RRGKL+E AC MLGSF
Sbjct  383  DPDIYKDGRISVQGIDGVLFPPQ-EDEAGPVTRAQP-AKVVVKQRRGKLLETACWMLGSF  440



>ref|XP_002879581.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55840.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPK-ASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +     K A+P+ K V+K RRGKLME+AC M+GS
Sbjct  382  DPDIYTDGRISVQGIDGVLFPAEETPATEIKPAAPVVKKVAKSRRGKLMEVACRMMGS  439



>ref|XP_004303393.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Fragaria 
vesca subsp. vesca]
Length=457

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGID VLFP E       KA+P+ K   KPRRGKLME+AC MLG+ 
Sbjct  396  DPDIYTDGRISVQGIDEVLFPVE---ELEKKATPVVKAAVKPRRGKLMEVACSMLGTL  450



>emb|CDX79631.1| BnaC03g19670D [Brassica napus]
Length=446

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPK-ASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +     K A+P+ K V+K RRGKLME+AC M+GS
Sbjct  383  DPDIYTDGRISVQGIDGVLFPVEETPATEIKPAAPVFKKVAKSRRGKLMEVACKMMGS  440



>ref|XP_007028043.1| FASCICLIN-like arabinogalactan protein 17 precursor [Theobroma 
cacao]
 gb|EOY08545.1| FASCICLIN-like arabinogalactan protein 17 precursor [Theobroma 
cacao]
Length=463

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E +      A+   KV SKPRRGKL+E+ C MLG+ 
Sbjct  398  DPDIYTDGRISVQGIDGVLFPEEETQTVQKPAA--VKVASKPRRGKLLEVGCWMLGTL  453



>ref|XP_008241098.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Prunus 
mume]
Length=483

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP-PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSFC  398
            DPDIYTDGRISVQGIDGVLFP  E    A  K +P+ KV +K RRGKLME+AC MLG+F 
Sbjct  415  DPDIYTDGRISVQGIDGVLFPFEEEEVKAEKKTAPVVKVAAKHRRGKLMEVACRMLGAFG  474

Query  397  H  395
            H
Sbjct  475  H  475



>gb|KDP42957.1| hypothetical protein JCGZ_23899 [Jatropha curcas]
Length=458

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQG+DGVLFP E   P   K   +AKVV+K RRGKL+ +AC MLG+ 
Sbjct  392  DPDIYTDGRISVQGVDGVLFPAEEMKP-VEKEVKVAKVVTKTRRGKLLAVACKMLGAL  448



>ref|XP_006445815.1| hypothetical protein CICLE_v10015097mg [Citrus clementina]
 ref|XP_006485518.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Citrus 
sinensis]
 gb|ESR59055.1| hypothetical protein CICLE_v10015097mg [Citrus clementina]
Length=476

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 4/62 (6%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSK----PRRGKLMEMACGMLG  407
            DPDIYTDGRISVQGIDGVLFPPE ++    ++    KV  K     RRGKL+E+AC MLG
Sbjct  405  DPDIYTDGRISVQGIDGVLFPPEETSTKLSESKKNVKVAVKQKPATRRGKLLEVACQMLG  464

Query  406  SF  401
            +F
Sbjct  465  AF  466



>gb|EPS67882.1| hypothetical protein M569_06891, partial [Genlisea aurea]
Length=475

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKP--RRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFPPE +    PK+SPLA   + P  RRGKL+E++C +LG+F
Sbjct  412  DPDIYTDGRISVQGIDGVLFPPEETR-IPPKSSPLAAKTALPNHRRGKLLELSCRILGAF  470



>ref|XP_006424052.1| hypothetical protein CICLE_v10030024mg [Citrus clementina]
 gb|ESR37292.1| hypothetical protein CICLE_v10030024mg [Citrus clementina]
Length=442

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 46/69 (67%), Gaps = 9/69 (13%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKP-RRGKLMEMACGMLGSF-  401
            DPDIYTDGRISVQGIDGVLFP +     + K   +AKV + P RRGKL+E AC MLG+F 
Sbjct  374  DPDIYTDGRISVQGIDGVLFPVKEGTKNSKKTKAVAKVAANPARRGKLLEAACWMLGAFR  433

Query  400  -------CH  395
                   CH
Sbjct  434  QDSRFITCH  442



>emb|CDY01050.1| BnaC05g41500D [Brassica napus]
Length=463

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 2/57 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E       + SPL KVV +PRRGKL+E+AC MLG+
Sbjct  399  DPDIYTDGRISVQGIDGVLFPEEEGT-VKKQTSPLKKVV-QPRRGKLLEVACRMLGA  453



>ref|XP_010495088.1| PREDICTED: fasciclin-like arabinogalactan protein 17, partial 
[Camelina sativa]
Length=151

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E     + K  P+ KVV +PRRG+L+E+AC M G+F
Sbjct  86   DPDIYTDGRISVQGIDGVLFPQEEEIFESVKI-PVKKVV-QPRRGRLLEVACSMFGAF  141



>emb|CDY40429.1| BnaA04g20880D [Brassica napus]
Length=443

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 3/59 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP--PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP    P+    P A+P+ K V+K RRGKLME+AC M+GS
Sbjct  381  DPDIYTDGRISVQGIDGVLFPMKETPATEIKP-AAPVVKKVAKSRRGKLMEIACRMMGS  438



>ref|XP_010505110.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=492

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 3/59 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE--PSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E  P+    P A+P+ K V+K RRGKL+E+AC M+GS
Sbjct  429  DPDIYTDGRISVQGIDGVLFPVEETPATEIKP-AAPVVKKVAKSRRGKLIEVACRMMGS  486



>emb|CDY32082.1| BnaC04g44840D [Brassica napus]
Length=444

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 3/59 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP--PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP    P+    P A+P+ K V+K RRGKLME+AC M+GS
Sbjct  381  DPDIYTDGRISVQGIDGVLFPMKETPATEMKP-AAPVVKKVAKSRRGKLMEVACRMMGS  438



>ref|NP_196257.2| fasciclin-like arabinogalactan protein 17 precursor [Arabidopsis 
thaliana]
 sp|Q66GR0.1|FLA17_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 17; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAU05465.1| At5g06390 [Arabidopsis thaliana]
 gb|AAV74247.1| At5g06390 [Arabidopsis thaliana]
 gb|AED91009.1| fasciclin-like arabinogalactan protein 17 precursor [Arabidopsis 
thaliana]
Length=458

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E     + K  P+ K+V +PRRGKL+E+AC MLG+F
Sbjct  393  DPDIYTDGRISVQGIDGVLFPQEEEVVESVK-KPVKKIV-QPRRGKLLEVACSMLGAF  448



>emb|CDY08502.1| BnaA05g27380D [Brassica napus]
Length=456

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E       + SP+ KVV +PRRGKL+E+AC MLG+ 
Sbjct  392  DPDIYTDGRISVQGIDGVLFPEEEGT-VKKQTSPVKKVV-QPRRGKLLEVACRMLGAI  447



>gb|KHN36515.1| Fasciclin-like arabinogalactan protein 16 [Glycine soja]
Length=365

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP-----PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGML  410
            DPDIYTDGRISVQGIDGVLFP      E   P         K+V K RRGKL+E AC ML
Sbjct  293  DPDIYTDGRISVQGIDGVLFPAAEEDAERVRPVTQTGQNATKLVVKHRRGKLLETACWML  352

Query  409  GSF  401
            G+F
Sbjct  353  GTF  355



>ref|XP_006410756.1| hypothetical protein EUTSA_v10016656mg [Eutrema salsugineum]
 gb|ESQ52209.1| hypothetical protein EUTSA_v10016656mg [Eutrema salsugineum]
Length=446

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 3/59 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE--PSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E  P+    P A+P+ K V+K RRGKLME+AC ++GS
Sbjct  383  DPDIYTDGRISVQGIDGVLFPVEETPAKEIKP-AAPVVKKVAKSRRGKLMEVACKLMGS  440



>ref|XP_009141525.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Brassica 
rapa]
Length=443

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 3/59 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP--PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP    P+    P A+P+ K V+K RRGKLME+AC M+GS
Sbjct  381  DPDIYTDGRISVQGIDGVLFPMKETPATEIKP-AAPVVKKVAKSRRGKLMEIACRMMGS  438



>ref|XP_009348615.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Pyrus x 
bretschneideri]
Length=452

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKAS-PLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVL+P E       K S P+ KV +KPRRGKLME+AC MLG+
Sbjct  389  DPDIYTDGRISVQGIDGVLYPTEEEEAKTEKKSAPVVKVAAKPRRGKLMEVACRMLGA  446



>ref|XP_006407421.1| hypothetical protein EUTSA_v10020679mg [Eutrema salsugineum]
 gb|ESQ48874.1| hypothetical protein EUTSA_v10020679mg [Eutrema salsugineum]
Length=464

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E         S + KVV +PRRGKL+E+AC MLG+ 
Sbjct  399  DPDIYTDGRISVQGIDGVLFPEEEEETVKKPTSSVKKVV-QPRRGKLLEVACRMLGAI  455



>ref|XP_009362660.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Pyrus x 
bretschneideri]
Length=457

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPP-EPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSFC  398
            DPDIYTDGRISVQGIDGVL+P  E    A  K++P+ KV +KPRRGKLME+AC MLG+  
Sbjct  389  DPDIYTDGRISVQGIDGVLYPTEEEEAKAEKKSAPVVKVAAKPRRGKLMEVACRMLGAVG  448

Query  397  H  395
            H
Sbjct  449  H  449



>ref|XP_009146690.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Brassica 
rapa]
Length=456

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E       + SP+ KVV +PRRGKL+E+AC MLG+ 
Sbjct  392  DPDIYTDGRISVQGIDGVLFPEEEGT-VKKQTSPVKKVV-QPRRGKLLEVACRMLGAI  447



>ref|XP_003540278.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Glycine 
max]
Length=454

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 42/64 (66%), Gaps = 6/64 (9%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPP------EPSNPAAPKASPLAKVVSKPRRGKLMEMACGM  413
            DPDIYTDGRISVQGIDGVLFP       E   P        AKVV K RRGKL+E AC M
Sbjct  381  DPDIYTDGRISVQGIDGVLFPTVEVEGAERVRPVTRTGQNGAKVVVKHRRGKLLETACWM  440

Query  412  LGSF  401
            LG+F
Sbjct  441  LGTF  444



>ref|XP_008392004.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Malus domestica]
Length=454

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKAS-PLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVL+P E       K S P+ KV +KPRRGKLME+AC MLG+
Sbjct  391  DPDIYTDGRISVQGIDGVLYPTEEEEAKTEKKSAPVVKVAAKPRRGKLMEVACRMLGA  448



>ref|XP_003521503.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Glycine max]
Length=453

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPA-APKASPLAKVVS-KPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVL PPE        + +PL KV + KPRRGKL+E+AC M GSF
Sbjct  389  DPDIYTDGRISVQGIDGVLIPPEEEEEERTRRITPLVKVAAPKPRRGKLVEVACSMFGSF  448



>ref|XP_006297639.1| hypothetical protein CARUB_v10013670mg [Capsella rubella]
 gb|EOA30537.1| hypothetical protein CARUB_v10013670mg [Capsella rubella]
Length=457

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLF PE       K++  AK V +PRRGKL+E+AC MLG+ 
Sbjct  392  DPDIYTDGRISVQGIDGVLF-PEEEEETVKKSTGSAKKVVQPRRGKLLEVACRMLGAI  448



>ref|XP_010452564.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Camelina 
sativa]
Length=456

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E     + K  P+ KVV +PRRG+L+E+AC MLG+F
Sbjct  391  DPDIYTDGRISVQGIDGVLFPQEEEIVESVKI-PVKKVV-QPRRGRLLEVACSMLGAF  446



>ref|XP_004296276.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Fragaria 
vesca subsp. vesca]
Length=459

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP-PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP  E  + +  K    AK+V++PRRGKLME+AC ML +
Sbjct  391  DPDIYTDGRISVQGIDGVLFPVEEVESKSKTKTVQPAKIVARPRRGKLMEVACRMLNA  448



>ref|XP_010917919.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Elaeis 
guineensis]
Length=544

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKV-VSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGID VLFPPE  +  +P  +P A V V+KPRRG L+E+AC M+G+F
Sbjct  477  DPDIYTDGRISVQGIDSVLFPPE-EDTVSPAPAPTATVGVAKPRRGMLLEVACQMVGAF  534



>ref|XP_010423345.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Camelina 
sativa]
Length=459

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E     + K  P+ KVV +PRRG+L+E+AC MLG+F
Sbjct  394  DPDIYTDGRISVQGIDGVLFPQEEEIVESVKI-PVKKVV-QPRRGRLLEVACSMLGAF  449



>gb|KDP36078.1| hypothetical protein JCGZ_08722 [Jatropha curcas]
Length=466

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQG+DGVLFP E         + +  V +KPRRGKLME+AC + G+F
Sbjct  399  DPDIYTDGRISVQGVDGVLFPEEEKETVTKPTAAVKVVSAKPRRGKLMEVACRIAGAF  456



>ref|XP_006487826.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Citrus 
sinensis]
Length=452

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 45/69 (65%), Gaps = 9/69 (13%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKP-RRGKLMEMACGMLGSF-  401
            DPDIYTDGRISVQGIDGVLFP +       K   + K+ +KP RRGKL+E AC MLG+F 
Sbjct  384  DPDIYTDGRISVQGIDGVLFPVKEGTKDWKKTKTVVKLAAKPARRGKLLEAACWMLGAFR  443

Query  400  -------CH  395
                   CH
Sbjct  444  QDSRFITCH  452



>emb|CDY47922.1| BnaAnng09540D [Brassica napus]
Length=227

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E        +  + KVV + RRGKL+E+AC MLG+
Sbjct  162  DPDIYTDGRISVQGIDGVLFPEEEEETVKKPSGSVKKVV-QTRRGKLLEVACRMLGA  217



>ref|XP_003543398.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Glycine max]
 ref|XP_006594907.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X2 [Glycine max]
Length=455

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP-----PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGML  410
            DPDIYTDGRISVQGIDGVLFP      E   P         K+V K RRGKL+E AC ML
Sbjct  383  DPDIYTDGRISVQGIDGVLFPAAEEDAERVRPVTQTGQNATKLVVKHRRGKLLETACWML  442

Query  409  GSF  401
            G+F
Sbjct  443  GTF  445



>ref|XP_010045160.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Eucalyptus 
grandis]
 gb|KCW87313.1| hypothetical protein EUGRSUZ_B03801 [Eucalyptus grandis]
 gb|KCW87314.1| hypothetical protein EUGRSUZ_B03801 [Eucalyptus grandis]
Length=480

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFPPE       +     KV +KPRRGKL+E+ C ML +F
Sbjct  413  DPDIYTDGRISVQGIDGVLFPPEEETEVKVEKKTPTKVAAKPRRGKLLELTCQMLTAF  470



>ref|XP_002515862.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46531.1| conserved hypothetical protein [Ricinus communis]
Length=464

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASP--LAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E             +AKVV+K RRGKL+E+AC MLG+F
Sbjct  395  DPDIYTDGRISVQGIDGVLFPVEEEEKKKKVMEKEYVAKVVTKTRRGKLLEVACKMLGAF  454



>gb|EYU38707.1| hypothetical protein MIMGU_mgv1a006053mg [Erythranthe guttata]
Length=459

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 47/68 (69%), Gaps = 10/68 (15%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLG----  407
            DPDIYTDGRISVQGIDGVL PPE S       +  AK+VSKPRRGKL+E+AC +LG    
Sbjct  394  DPDIYTDGRISVQGIDGVLLPPEESKAPKAAPA--AKIVSKPRRGKLLEVACSVLGAVGQ  451

Query  406  ----SFCH  395
                S CH
Sbjct  452  NSHFSTCH  459



>ref|XP_010525828.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Tarenaya 
hassleriana]
Length=464

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E +    P  + + K  +KPRR KLME+AC ML S
Sbjct  397  DPDIYTDGRISVQGIDGVLFPEEETPAKKPAGAGVVKKAAKPRRVKLMEVACRMLES  453



>dbj|BAE71191.1| hypothetical protein [Trifolium pratense]
Length=454

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 42/65 (65%), Gaps = 7/65 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPA-------APKASPLAKVVSKPRRGKLMEMACG  416
            DPDIYTDGRISVQGIDGVLFP E              K    AKVV K RRGKL+E AC 
Sbjct  380  DPDIYTDGRISVQGIDGVLFPMEEEKEEVVEQVKPVSKMGQTAKVVVKHRRGKLLETACW  439

Query  415  MLGSF  401
            MLG+F
Sbjct  440  MLGTF  444



>ref|XP_010248022.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nelumbo 
nucifera]
Length=469

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 44/66 (67%), Gaps = 6/66 (9%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEP--SNPAAPKASPL----AKVVSKPRRGKLMEMACGM  413
            DPDIYTDGRISVQGIDGVLFPPE   S P    A       +K   K RRGKLME+ C M
Sbjct  396  DPDIYTDGRISVQGIDGVLFPPEEQQSKPETKTAKTKTVKPSKTSVKARRGKLMEVTCKM  455

Query  412  LGSFCH  395
            LG+F H
Sbjct  456  LGAFGH  461



>ref|XP_007150000.1| hypothetical protein PHAVU_005G117500g [Phaseolus vulgaris]
 gb|ESW21994.1| hypothetical protein PHAVU_005G117500g [Phaseolus vulgaris]
Length=457

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 42/64 (66%), Gaps = 7/64 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP------PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGM  413
            DPDIYTDGRISVQGIDGVLFP       E   PA     P AKVV   RRGKL E AC M
Sbjct  385  DPDIYTDGRISVQGIDGVLFPIDEEEEAERVKPATRSGQPAAKVVMH-RRGKLQETACWM  443

Query  412  LGSF  401
            LG+F
Sbjct  444  LGAF  447



>ref|XP_008798695.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Phoenix 
dactylifera]
Length=464

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPA--APKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGID VLFPPE    A  AP A       +KPRRGKL+E+ C MLG+ 
Sbjct  395  DPDIYTDGRISVQGIDAVLFPPEEETHAAVAPAAVRSNVKAAKPRRGKLLELGCKMLGAL  454



>ref|XP_008803482.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 17 [Phoenix dactylifera]
Length=465

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVV--SKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGID VLFPPE   PAA   +   K V  +KPRRGKL+E+ C MLG+F
Sbjct  396  DPDIYTDGRISVQGIDAVLFPPEEETPAAVAPTAARKTVKAAKPRRGKLLELGCQMLGAF  455



>ref|XP_011032963.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
Length=463

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKAS-PLAKVVSKP-RRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E    +  K      KV +KP RRGKL+E+AC MLG+F
Sbjct  394  DPDIYTDGRISVQGIDGVLFPLEEKEKSDTKTEMKSVKVAAKPQRRGKLLEVACRMLGTF  453



>ref|XP_004506247.1| PREDICTED: fasciclin-like arabinogalactan protein 15-like [Cicer 
arietinum]
Length=459

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 6/64 (9%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE-----PSNPAA-PKASPLAKVVSKPRRGKLMEMACGM  413
            DPDIYTDGRISVQGIDGVLFP +     P N     +    AKV++K RRGKL+E AC M
Sbjct  386  DPDIYTDGRISVQGIDGVLFPHQEGEVLPDNTLTRTRMGQPAKVLAKQRRGKLLETACWM  445

Query  412  LGSF  401
            LG+F
Sbjct  446  LGTF  449



>ref|XP_007010508.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
 ref|XP_007010509.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
 gb|EOY19318.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
 gb|EOY19319.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
Length=454

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGML  410
            DPDIYTDGRISVQGIDGVLFPPE       K   +A   +KPRRGKL+E+AC ML
Sbjct  388  DPDIYTDGRISVQGIDGVLFPPEEKTKDEKKTIKVA--TAKPRRGKLLEVACRML  440



>ref|XP_010491197.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Camelina 
sativa]
Length=457

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E     + K  P+ KVV +PRRG+L+E+AC M G+F
Sbjct  392  DPDIYTDGRISVQGIDGVLFPQEEEIFESVKI-PVKKVV-QPRRGRLLEVACSMFGAF  447



>gb|ABV27485.1| fasciclin-like arabinogalactan protein 14 [Gossypium hirsutum]
Length=459

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGM  413
            DPDIYTDGRISVQGIDGVLFP E +      A+   KVVSKPRRGKL+E+ C M
Sbjct  394  DPDIYTDGRISVQGIDGVLFPEEETQTVKKPAA--VKVVSKPRRGKLLEVGCWM  445



>ref|XP_010557991.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Tarenaya 
hassleriana]
Length=469

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSFCH  395
            DPDIYTDGRISVQGIDGV+ P E +     K S  AK V +PRRGKL+ +AC MLG F H
Sbjct  403  DPDIYTDGRISVQGIDGVMLPEEEAE-MVKKPSSAAKKVVQPRRGKLLGVACRMLGGFGH  461



>gb|KHG03559.1| Fasciclin-like arabinogalactan protein 17 [Gossypium arboreum]
Length=459

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGM  413
            DPDIYTDGRISVQGIDGVLFP E +      A+   KV SKPRRGKL+E+ C M
Sbjct  394  DPDIYTDGRISVQGIDGVLFPEEETQTVKKPAA--VKVASKPRRGKLLEVGCWM  445



>ref|XP_009121226.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Brassica 
rapa]
Length=464

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E        +  + KVV + RRGKL+E+AC MLG+
Sbjct  399  DPDIYTDGRISVQGIDGVLFPEEEEETVKKPSGSVKKVV-QTRRGKLLEVACRMLGA  454



>ref|XP_003554480.1| PREDICTED: fasciclin-like arabinogalactan protein 15-like [Glycine 
max]
Length=455

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVS-KPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVL PPE       + +PL KV + KPRRGKLME+AC M GSF
Sbjct  392  DPDIYTDGRISVQGIDGVLIPPEEEEERTRRTTPLVKVAAPKPRRGKLMEIACSMFGSF  450



>ref|XP_006287712.1| hypothetical protein CARUB_v10000921mg [Capsella rubella]
 gb|EOA20610.1| hypothetical protein CARUB_v10000921mg [Capsella rubella]
Length=459

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 2/57 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDI+TDGRISVQGIDGVLFP E     + K  P+ KVV +PRRGKL+E+AC MLG+
Sbjct  394  DPDIFTDGRISVQGIDGVLFPQEEELVESVKI-PVKKVV-QPRRGKLLEVACSMLGA  448



>ref|XP_010553413.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Tarenaya 
hassleriana]
Length=464

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 3/59 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPA--APKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVL  PE  +PA   P  + + K  +KPRRGKLME+ C MLG+
Sbjct  396  DPDIYTDGRISVQGIDGVLL-PEKESPAKQKPAGAGVVKKAAKPRRGKLMEVTCRMLGA  453



>ref|XP_010677585.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Beta vulgaris 
subsp. vulgaris]
Length=448

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 43/60 (72%), Gaps = 4/60 (7%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSFCH  395
            DPDIYTDGRISVQGIDGVLFP E     AP A  + KVV+K RRGKLME+ C +  +  H
Sbjct  384  DPDIYTDGRISVQGIDGVLFPSEEVK--APPA--VKKVVAKQRRGKLMEVGCTLAAALGH  439



>ref|XP_010908912.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Elaeis 
guineensis]
Length=416

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVV--SKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGID VLFPPE   PAA   + +   V  +KPRRGKL E+ C MLG+ 
Sbjct  347  DPDIYTDGRISVQGIDAVLFPPEEETPAAVAPAAVRNTVKAAKPRRGKLFELGCQMLGAL  406



>ref|XP_011047143.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Populus 
euphratica]
Length=466

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP--PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP   + S       S +    +KPRRGKLME+AC MLG+ 
Sbjct  397  DPDIYTDGRISVQGIDGVLFPEVEKESTSVKKSVSSVKVATTKPRRGKLMEVACIMLGTL  456



>ref|XP_002309262.1| hypothetical protein POPTR_0006s21460g [Populus trichocarpa]
 gb|EEE92785.1| hypothetical protein POPTR_0006s21460g [Populus trichocarpa]
Length=466

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP--PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP   + S       S +    +KPRRGKLME+AC MLG+ 
Sbjct  397  DPDIYTDGRISVQGIDGVLFPEVEKESTSVKKSVSSVKVATTKPRRGKLMEVACIMLGTL  456



>ref|XP_010534382.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Tarenaya 
hassleriana]
Length=468

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKV--VSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLF  E +     K  P + V  V +PRRGKL+E AC MLG+F
Sbjct  398  DPDIYTDGRISVQGIDGVLFTEEETETETVKKKPSSAVKKVVQPRRGKLLEAACRMLGAF  457



>ref|XP_003596932.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
 gb|AES67183.1| fasciclin-like arabinogalactan protein 16 precursor [Medicago 
truncatula]
Length=446

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 8/66 (12%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAP--KASPLA------KVVSKPRRGKLMEMAC  419
            DPDIYTDGRISVQGIDGVLFP +      P  +  P++      K V + RRGKL+E AC
Sbjct  371  DPDIYTDGRISVQGIDGVLFPMKEEKEVVPVEQVKPISMMGQPRKGVVEHRRGKLLETAC  430

Query  418  GMLGSF  401
             MLG+F
Sbjct  431  WMLGTF  436



>gb|AGN92422.1| putative fasciclin-like arabinogalactan protein 2 [Centaurium 
erythraea]
Length=461

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP-PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP  E + P     +P AKV ++ RRGKL+E+ CG+LG+F
Sbjct  393  DPDIYTDGRISVQGIDGVLFPAEEKAKPEPKAVAPAAKVAAQSRRGKLLEVTCGILGAF  451



>ref|XP_002322769.2| hypothetical protein POPTR_0016s06680g [Populus trichocarpa]
 gb|EEF04530.2| hypothetical protein POPTR_0016s06680g [Populus trichocarpa]
Length=466

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP--PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP   + S       S +    + PRRGKLME+AC MLGS 
Sbjct  397  DPDIYTDGRISVQGIDGVLFPEVEKESTSVKKSVSSVKVATTTPRRGKLMEVACRMLGSL  456



>ref|NP_566398.1| FASCICLIN-like arabinogalactan protein 18 precursor [Arabidopsis 
thaliana]
 sp|Q93W32.1|FLA18_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 18; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL07046.1| unknown protein [Arabidopsis thaliana]
 gb|AAL24265.1| AT3g11700/T19F11_10 [Arabidopsis thaliana]
 gb|AAM91728.1| unknown protein [Arabidopsis thaliana]
 gb|AEE75085.1| FASCICLIN-like arabinogalactan protein 18 precursor [Arabidopsis 
thaliana]
Length=462

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E       K +   K V +PRRGKL+E+AC MLG+
Sbjct  396  DPDIYTDGRISVQGIDGVLFPEEKEEETVKKPTGPVKKVVQPRRGKLLEVACSMLGA  452



>gb|KJB36230.1| hypothetical protein B456_006G147500 [Gossypium raimondii]
Length=459

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGM  413
            DPDIYTDGRISVQGID VLFP E +      A+   KV SKPRRGKL+E+ C M
Sbjct  394  DPDIYTDGRISVQGIDEVLFPEEETQTVKKPAA--VKVASKPRRGKLLEVGCWM  445



>ref|XP_009587619.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
tomentosiformis]
Length=449

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSFC  398
            DPDIYTDGRISVQGIDGVLFP E    A   A   AKVV+KPRRGKLME+AC +LGSFC
Sbjct  392  DPDIYTDGRISVQGIDGVLFPVEEIKAAPVVAPV-AKVVAKPRRGKLMEVACSVLGSFC  449



>ref|XP_009794483.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
sylvestris]
Length=449

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSFC  398
            DPDIYTDGRISVQGIDGVLFP E    A   A   AKVV+KPRRGKLME+AC +LGSFC
Sbjct  392  DPDIYTDGRISVQGIDGVLFPVEEIKAAPVAAPV-AKVVAKPRRGKLMEVACSVLGSFC  449



>ref|XP_010497995.1| PREDICTED: fasciclin-like arabinogalactan protein 18 isoform 
X1 [Camelina sativa]
 ref|XP_010498004.1| PREDICTED: fasciclin-like arabinogalactan protein 18 isoform 
X2 [Camelina sativa]
Length=469

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E           + KVV + RRGKL+E+AC MLG+ 
Sbjct  404  DPDIYTDGRISVQGIDGVLFPEEEEESVKKSTGSVKKVVQQ-RRGKLLEVACRMLGAI  460



>ref|XP_010464900.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Camelina 
sativa]
Length=462

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E           + KVV + RRGKL+E+AC MLG+
Sbjct  397  DPDIYTDGRISVQGIDGVLFPEEEEESVKKSTGSVKKVVQQ-RRGKLLEVACRMLGA  452



>ref|XP_010486838.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Camelina 
sativa]
Length=461

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E           + KVV + RRGKL+E+AC MLG+
Sbjct  396  DPDIYTDGRISVQGIDGVLFPEEEEESVKKSTGSVKKVVQQ-RRGKLLEVACRMLGA  451



>ref|XP_002882744.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59003.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E       K +   K V +PRRGKL+E+AC MLG+ 
Sbjct  394  DPDIYTDGRISVQGIDGVLFPEEKEEETVKKTTGPVKKVVQPRRGKLLEVACRMLGAI  451



>gb|KJB73326.1| hypothetical protein B456_011G228300 [Gossypium raimondii]
Length=515

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGML  410
            DPDIYTDGRISVQGIDGVLFPPE       K   +A V  KPRRGKL+E AC ML
Sbjct  449  DPDIYTDGRISVQGIDGVLFPPEEKAKEEKKTIKVATV--KPRRGKLLEAACRML  501



>gb|KJB73327.1| hypothetical protein B456_011G228300 [Gossypium raimondii]
Length=443

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGML  410
            DPDIYTDGRISVQGIDGVLFPPE       K   +A V  KPRRGKL+E AC ML
Sbjct  377  DPDIYTDGRISVQGIDGVLFPPEEKAKEEKKTIKVATV--KPRRGKLLEAACRML  429



>ref|XP_002871217.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47476.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=458

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E             K V +PRRGKL+E+ C MLG+F
Sbjct  393  DPDIYTDGRISVQGIDGVLFPQEEE--IVESVKKPVKKVVQPRRGKLLEITCSMLGAF  448



>ref|XP_011076879.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Sesamum 
indicum]
Length=464

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 5/60 (8%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPP----EPSNPAAPK-ASPLAKVVSKPRRGKLMEMACGML  410
            DPDIYTDGRISVQGIDGVLFPP    + +    P+ A   AK V++ RRGKL+E+AC M+
Sbjct  391  DPDIYTDGRISVQGIDGVLFPPPAEGKKNEAKGPRIADQNAKTVTRARRGKLVEVACWMV  450



>gb|KJB78512.1| hypothetical protein B456_013G003200 [Gossypium raimondii]
Length=457

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGML  410
            DPDIYTDGRISVQGIDGVLFPPE       K   +A   +KPRRGKL+E+AC ML
Sbjct  391  DPDIYTDGRISVQGIDGVLFPPEEKTKEEKKTIKVA--TAKPRRGKLLEVACRML  443



>gb|KHN41248.1| Fasciclin-like arabinogalactan protein 16 [Glycine soja]
Length=265

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 39/54 (72%), Gaps = 4/54 (7%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAP--KASPLAKVVSKPRRGKLMEMAC  419
            DPDIYTDGRISVQGIDGVLFPP+    A P  +A P AKVV K RR K M M C
Sbjct  213  DPDIYTDGRISVQGIDGVLFPPQEEEAAGPVTRAQP-AKVVVKQRRVK-MRMTC  264



>ref|XP_006826417.1| hypothetical protein AMTR_s00004p00159330 [Amborella trichopoda]
 gb|ERM93654.1| hypothetical protein AMTR_s00004p00159330 [Amborella trichopoda]
Length=470

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPP-EPSNPAAPKASPLAKVVSK--PRRGKLMEMACGMLGS  404
            DPDIY DGRISVQGID VLFPP E   P   K    +K  +K   RRGKL+E+AC MLG+
Sbjct  400  DPDIYMDGRISVQGIDKVLFPPDERPTPKGKKTELTSKTAAKAPARRGKLLEVACRMLGA  459

Query  403  F  401
            F
Sbjct  460  F  460



>ref|XP_011024125.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
 ref|XP_011024126.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
Length=459

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLA-KVVSKP-RRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP E    +  K    + KV  KP RRG+L+E+AC MLG+F
Sbjct  390  DPDIYTDGRISVQGIDGVLFPLEEKEKSETKKEIKSVKVAVKPQRRGRLLEVACRMLGTF  449



>gb|ABV27487.1| fasciclin-like arabinogalactan protein 16 [Gossypium hirsutum]
Length=457

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGML  410
            DPDIYTDGRISVQGIDGVLFPPE       K   +A   +KPR+GKL+E+AC ML
Sbjct  391  DPDIYTDGRISVQGIDGVLFPPEEKTKEEKKTIQVA--TAKPRKGKLLEVACKML  443



>ref|XP_009783700.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
sylvestris]
Length=454

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 47/64 (73%), Gaps = 5/64 (8%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF--  401
            DPDIYTDGRISVQG+DGVLFP E    A   A   AKVV+KPRRGKLME+ CG LGSF  
Sbjct  392  DPDIYTDGRISVQGVDGVLFPIEEIKVAPVAAPV-AKVVAKPRRGKLMEVVCGTLGSFAF  450

Query  400  --CH  395
              CH
Sbjct  451  ASCH  454



>ref|XP_006399111.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
 gb|ESQ40564.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
Length=460

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLF P+          P+ KVV +PRRGKL+E+AC MLG+F
Sbjct  394  DPDIYTDGRISVQGIDGVLF-PDVEEIVESVKKPVKKVVVQPRRGKLLEVACRMLGAF  450



>ref|XP_004487436.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cicer 
arietinum]
Length=454

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 42/64 (66%), Gaps = 9/64 (14%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP------PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGM  413
            DPDIYTDGRISVQGIDGVLFP       E   P +    P  KV  + RRGKL+E AC M
Sbjct  384  DPDIYTDGRISVQGIDGVLFPMVEEEKVERDKPVSKMGQP-GKV--QHRRGKLLETACWM  440

Query  412  LGSF  401
            LG+F
Sbjct  441  LGTF  444



>ref|XP_009388984.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388985.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Musa acuminata 
subsp. malaccensis]
Length=476

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 44/70 (63%), Gaps = 12/70 (17%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAK------------VVSKPRRGKLM  431
            DPDIYTDGRISVQGID VLFPP+   P A   SP A             + +K RRGKL+
Sbjct  397  DPDIYTDGRISVQGIDAVLFPPDEEAPPASLLSPAAHKAEVAQVKAKAKLKAKLRRGKLL  456

Query  430  EMACGMLGSF  401
            E+ C +LG+F
Sbjct  457  EIGCNLLGAF  466



>ref|XP_011042549.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
 ref|XP_011042550.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
Length=466

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP--PEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYT GRISVQG+DGVLFP   + S       S +    + PRRGKLME+AC MLGS 
Sbjct  397  DPDIYTAGRISVQGVDGVLFPEVEKESTSVKKSVSSVKVATTTPRRGKLMEVACRMLGSL  456



>gb|ABV27486.1| fasciclin-like arabinogalactan protein 15 [Gossypium hirsutum]
Length=460

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGML  410
            DPDIYTDGRISVQGIDGVLFP E       K   +A V  KPRRGKL+E AC ML
Sbjct  394  DPDIYTDGRISVQGIDGVLFPLEEKAKEEKKTIKVATV--KPRRGKLLEAACRML  446



>gb|KCW90413.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
Length=462

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPK--ASPLAKVVSKPRR-GKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP E + PA+       + KVV+KPR   KLME+AC MLG+
Sbjct  392  DPDIYTDGRISVQGIDGVLFPAEETAPASTTAAEKKVVKVVAKPREVWKLMEVACSMLGA  451

Query  403  F  401
            F
Sbjct  452  F  452



>gb|KHN21208.1| Fasciclin-like arabinogalactan protein 18 [Glycine soja]
Length=223

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 40/57 (70%), Gaps = 6/57 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAP--KASPLAKVVSKPRR---GKLMEMAC  419
            DPDIYTDGRISVQGIDGVLFPP+    A P  +A P AKVV K RR   GK + M C
Sbjct  167  DPDIYTDGRISVQGIDGVLFPPQEEEAAGPVTRAQP-AKVVVKQRRVKLGKKVRMTC  222



>tpg|DAA51811.1| TPA: hypothetical protein ZEAMMB73_870378 [Zea mays]
Length=128

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 39/65 (60%), Gaps = 7/65 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE---PSNPAAPKASPLAKVVSKP----RRGKLMEMACG  416
            DPDIYTDGRISVQGID VLF P+    +  A P   P A V  K     RRGKL+E  C 
Sbjct  54   DPDIYTDGRISVQGIDAVLFAPDDTKATQTADPNRKPPAIVTHKKKIKLRRGKLLEATCQ  113

Query  415  MLGSF  401
            M G F
Sbjct  114  MAGLF  118



>ref|XP_008790162.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Phoenix 
dactylifera]
Length=549

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGID VLFPPE  + A   A       +KPRRGKL+E+ C MLG+ 
Sbjct  482  DPDIYTDGRISVQGIDSVLFPPEEDSVAPAPAPAATVAAAKPRRGKLLEVGCQMLGAL  539



>ref|XP_010090522.1| hypothetical protein L484_017146 [Morus notabilis]
 gb|EXB39671.1| hypothetical protein L484_017146 [Morus notabilis]
Length=459

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSFCH  395
            DPDIYTDGRISVQGIDGVLFPPE       K  P AKV + P+RG  M +  G LG   +
Sbjct  395  DPDIYTDGRISVQGIDGVLFPPEEVKAVTKKVQP-AKVAAVPKRG--MHLTFGSLGHTAY  451



>ref|XP_009387789.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 47/69 (68%), Gaps = 14/69 (20%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE-------PSNPAAPKASPLAKV------VSKPRRGKL  434
            DPDIYTDGRISVQGID VLFPP+       P +PAA KA  LA+V       +K RRGKL
Sbjct  395  DPDIYTDGRISVQGIDAVLFPPDEDAPPASPLSPAARKAE-LAQVKAKTKLKAKLRRGKL  453

Query  433  MEMACGMLG  407
            +E+ C +LG
Sbjct  454  LEIGCSLLG  462



>gb|KJB36232.1| hypothetical protein B456_006G147500 [Gossypium raimondii]
Length=460

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRR-GKLMEMACGM  413
            DPDIYTDGRISVQGID VLFP E +      A+   KV SKPRR GKL+E+ C M
Sbjct  394  DPDIYTDGRISVQGIDEVLFPEEETQTVKKPAA--VKVASKPRRAGKLLEVGCWM  446



>gb|ABI95416.1| fasciclin-like protein FLA26 [Triticum aestivum]
Length=460

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 40/65 (62%), Gaps = 7/65 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKV-------VSKPRRGKLMEMACG  416
            DPDIYTDGRISVQGID VL P +   PA P ++P  K         SK RRGKL+E  C 
Sbjct  386  DPDIYTDGRISVQGIDAVLLPEDDKKPATPVSAPDRKAPAVTGSRKSKLRRGKLLEATCR  445

Query  415  MLGSF  401
            M G F
Sbjct  446  MAGVF  450



>emb|CDY55758.1| BnaA03g55350D [Brassica napus]
Length=458

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 3/57 (5%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDI+TDGRISVQGIDGVLFP E    +  K     K V +PRRGKL+E+AC MLG+
Sbjct  393  DPDIFTDGRISVQGIDGVLFPEEEVVESVKKP---VKKVVQPRRGKLLEVACRMLGA  446



>gb|ACF84712.1| unknown [Zea mays]
Length=170

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 39/65 (60%), Gaps = 7/65 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE---PSNPAAPKASPLAKVVSKP----RRGKLMEMACG  416
            DPDIYTDGRISVQGID VLF P+    +  A P   P A V  K     RRGKL+E  C 
Sbjct  96   DPDIYTDGRISVQGIDAVLFAPDDTKATQTADPNRKPPAIVTHKKKIKLRRGKLLEATCQ  155

Query  415  MLGSF  401
            M G F
Sbjct  156  MAGLF  160



>emb|CDX81004.1| BnaC03g02580D [Brassica napus]
Length=488

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP       + K     K V +PRRGKL+E+AC MLG+ 
Sbjct  390  DPDIYTDGRISVQGIDGVLFPEVEEVVESVKKP--VKKVVQPRRGKLLEVACRMLGAI  445



>ref|XP_004981498.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Setaria 
italica]
Length=467

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 42/65 (65%), Gaps = 8/65 (12%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAK--VVS-----KPRRGKLMEMACG  416
            DPDIYTDGRISVQGID VLFPP   N A   A P  K  V++     K RRGKL+E +C 
Sbjct  393  DPDIYTDGRISVQGIDAVLFPPGDKN-ATQTADPHRKPPVITTKKKIKLRRGKLLEASCQ  451

Query  415  MLGSF  401
            M G F
Sbjct  452  MAGLF  456



>ref|XP_009399002.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 47/69 (68%), Gaps = 14/69 (20%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE-------PSNPAAPKASPLAKV------VSKPRRGKL  434
            DPDIYTDGRISVQGID VLFPP+       P +PAA KA  +A+V       +K RRGKL
Sbjct  407  DPDIYTDGRISVQGIDAVLFPPDEEVPPASPLSPAARKAE-IAQVKGKAKLKAKLRRGKL  465

Query  433  MEMACGMLG  407
            +E+ C +LG
Sbjct  466  LEVGCSLLG  474



>ref|XP_006651890.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Oryza 
brachyantha]
Length=413

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 9/64 (14%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVV--------SKPRRGKLMEMAC  419
            DPDIYTDGRI+VQGID VLFPP+ +   AP  +P+ +          SK RRGKL+E  C
Sbjct  339  DPDIYTDGRIAVQGIDAVLFPPDDTK-TAPDTAPVVRRAPAVTGTRKSKLRRGKLLEATC  397

Query  418  GMLG  407
             M G
Sbjct  398  QMAG  401



>ref|XP_002461483.1| hypothetical protein SORBIDRAFT_02g003410 [Sorghum bicolor]
 gb|EER98004.1| hypothetical protein SORBIDRAFT_02g003410 [Sorghum bicolor]
Length=471

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 44/69 (64%), Gaps = 10/69 (14%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPP------EPSNPAAP--KASPLAKVVSKP--RRGKLMEM  425
            DPDIYTDGRISVQGID VLFPP       P+  AAP  KA  +     KP  RRGKL+E 
Sbjct  398  DPDIYTDGRISVQGIDAVLFPPAEIGGTRPAAVAAPTWKAPAVTGGADKPKLRRGKLLEG  457

Query  424  ACGMLGSFC  398
            AC ++G F 
Sbjct  458  ACQLMGVFV  466



>gb|ABI95415.1| fasciclin-like protein FLA25 [Triticum aestivum]
Length=459

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 42/65 (65%), Gaps = 7/65 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVV-----SKP--RRGKLMEMACG  416
            DPDIYTDGRISVQGID VLFPP      +  ASP+ K +     +KP  RRGKL+E AC 
Sbjct  385  DPDIYTDGRISVQGIDAVLFPPVEDTAKSAGASPVRKALVVTGTAKPKLRRGKLLEGACH  444

Query  415  MLGSF  401
            +   F
Sbjct  445  VAAVF  449



>ref|XP_009130939.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Brassica 
rapa]
 ref|XP_009130940.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Brassica 
rapa]
Length=458

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDI+TDGRISVQGIDGVLFP               K V +PRRGKL+E+AC MLG+
Sbjct  392  DPDIFTDGRISVQGIDGVLFP--EMEEVVESVKKPVKKVVQPRRGKLLEVACRMLGA  446



>ref|XP_006658293.1| PREDICTED: fasciclin-like arabinogalactan protein 15-like [Oryza 
brachyantha]
Length=412

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 43/76 (57%), Gaps = 16/76 (21%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPS-------------NPAAPKASPLAKVVSKPRRGKL  434
            DPDIYTDGRISVQGID VLFPP+ +              PA    +  A   SK RRGKL
Sbjct  337  DPDIYTDGRISVQGIDAVLFPPQDTATGGSDSSGSSPSAPARKAPAVTAHSKSKLRRGKL  396

Query  433  MEMAC---GMLGSFCH  395
            +E AC   G LG+ C 
Sbjct  397  LEGACQVMGFLGASCQ  412



>ref|NP_001130335.1| uncharacterized protein LOC100191430 precursor [Zea mays]
 gb|ACF78522.1| unknown [Zea mays]
 gb|ACL52516.1| unknown [Zea mays]
 gb|ACL54364.1| unknown [Zea mays]
 gb|ACL54392.1| unknown [Zea mays]
 gb|ACL54585.1| unknown [Zea mays]
 gb|ACL54630.1| unknown [Zea mays]
 gb|ACL54654.1| unknown [Zea mays]
Length=465

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 39/65 (60%), Gaps = 7/65 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE---PSNPAAPKASPLAKVVSKP----RRGKLMEMACG  416
            DPDIYTDGRISVQGID VLF P+    +  A P   P A V  K     RRGKL+E  C 
Sbjct  391  DPDIYTDGRISVQGIDAVLFAPDDTKATQTADPNRKPPAIVTHKKKIKLRRGKLLEATCQ  450

Query  415  MLGSF  401
            M G F
Sbjct  451  MAGLF  455



>tpg|DAA51813.1| TPA: LOW QUALITY PROTEIN: fasciclin domain protein [Zea mays]
Length=464

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 39/65 (60%), Gaps = 7/65 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE---PSNPAAPKASPLAKVVSKP----RRGKLMEMACG  416
            DPDIYTDGRISVQGID VLF P+    +  A P   P A V  K     RRGKL+E  C 
Sbjct  390  DPDIYTDGRISVQGIDAVLFAPDDTKATQTADPNRKPPAIVTHKKKIKLRRGKLLEATCQ  449

Query  415  MLGSF  401
            M G F
Sbjct  450  MAGLF  454



>gb|ACG39696.1| fasciclin domain [Zea mays]
Length=469

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 39/65 (60%), Gaps = 7/65 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE---PSNPAAPKASPLAKVVSKP----RRGKLMEMACG  416
            DPDIYTDGRISVQGID VLF P+    +  A P   P A V  K     RRGKL+E  C 
Sbjct  395  DPDIYTDGRISVQGIDAVLFAPDDTKATQTADPNRKPPAIVTHKKKIKLRRGKLLEATCQ  454

Query  415  MLGSF  401
            M G F
Sbjct  455  MAGLF  459



>emb|CDX98919.1| BnaC09g49160D [Brassica napus]
Length=457

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGSF  401
            DPDIYTDGRISVQGIDGVLFP               K V + RRGKL+E+ C MLG+ 
Sbjct  392  DPDIYTDGRISVQGIDGVLFP--EVEEIVESVKKPVKKVVQQRRGKLLEVTCRMLGAI  447



>ref|XP_002463768.1| hypothetical protein SORBIDRAFT_01g005770 [Sorghum bicolor]
 gb|EER90766.1| hypothetical protein SORBIDRAFT_01g005770 [Sorghum bicolor]
Length=474

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 39/65 (60%), Gaps = 7/65 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE---PSNPAAPKASPLAKVVSKP----RRGKLMEMACG  416
            DPDIYTDGRISVQGID VLF P+    +  A P   P A V  K     RRGKL+E  C 
Sbjct  400  DPDIYTDGRISVQGIDAVLFAPDDTKATQTADPNRKPPAIVTHKKKIKLRRGKLLEATCQ  459

Query  415  MLGSF  401
            M G F
Sbjct  460  MAGLF  464



>ref|XP_010263095.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Nelumbo 
nucifera]
Length=470

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 40/65 (62%), Gaps = 7/65 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP----PEPSNPAAPKASPLAKVVSKP---RRGKLMEMACG  416
            DPDIYTDGRISVQGIDGVLFP    P+P   +      + K        RRGKLME+ C 
Sbjct  396  DPDIYTDGRISVQGIDGVLFPLEEKPKPETTSTKTTKKITKPTKTVTTLRRGKLMEVTCR  455

Query  415  MLGSF  401
            MLG F
Sbjct  456  MLGVF  460



>gb|ABI95417.1| fasciclin-like protein FLA27 [Triticum aestivum]
Length=482

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 39/65 (60%), Gaps = 7/65 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKV-------VSKPRRGKLMEMACG  416
            DPDIYTDGRISVQGID VL P +   PA P ++P  K         SK  RGKL+E  C 
Sbjct  408  DPDIYTDGRISVQGIDAVLLPEDDKKPATPVSAPDRKAPAVPGSRKSKLPRGKLLEATCR  467

Query  415  MLGSF  401
            M G F
Sbjct  468  MAGVF  472



>ref|NP_001051504.1| Os03g0788600 [Oryza sativa Japonica Group]
 gb|AAT75247.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99257.1| beta-Ig-H3 domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13418.1| Os03g0788600 [Oryza sativa Japonica Group]
 dbj|BAG91233.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97579.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76302.1| hypothetical protein OsI_13823 [Oryza sativa Indica Group]
 gb|EEE60067.1| hypothetical protein OsJ_12880 [Oryza sativa Japonica Group]
Length=474

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 41/64 (64%), Gaps = 9/64 (14%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKV--------VSKPRRGKLMEMAC  419
            DPDIYTDGRI+VQGID VLFPP+ +   AP  +P+ +          +K RRGKL+E  C
Sbjct  400  DPDIYTDGRIAVQGIDAVLFPPDDTK-TAPDTAPVRRAPAVTGTRKKNKLRRGKLLEATC  458

Query  418  GMLG  407
             M G
Sbjct  459  QMAG  462



>gb|AAD21471.1| unknown protein [Arabidopsis thaliana]
Length=475

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPK-ASPLAKVVSKPRRGK  437
            DPDIYTDGRISVQGIDGVLFP E +     K A+P+ K VSK RRGK
Sbjct  382  DPDIYTDGRISVQGIDGVLFPKEETPATEIKPAAPVVKKVSKSRRGK  428



>ref|XP_009122246.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Brassica 
rapa]
Length=457

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP       + K     K V + RRGKL+E+ C MLG+
Sbjct  392  DPDIYTDGRISVQGIDGVLFPEVEEVVESVKKP--VKKVVQQRRGKLLEVTCRMLGA  446



>emb|CDY57989.1| BnaA10g30360D [Brassica napus]
Length=457

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLMEMACGMLGS  404
            DPDIYTDGRISVQGIDGVLFP       + K     K V + RRGKL+E+ C MLG+
Sbjct  392  DPDIYTDGRISVQGIDGVLFPEVEEVVESVKKP--VKKVVQQRRGKLLEVTCRMLGA  446



>ref|NP_001159324.1| uncharacterized protein LOC100304417 precursor [Zea mays]
 gb|ACN25805.1| unknown [Zea mays]
 gb|AFW67416.1| hypothetical protein ZEAMMB73_395863 [Zea mays]
Length=473

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 39/65 (60%), Gaps = 7/65 (11%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE---PSNPAAPKASPLAKVVSKP----RRGKLMEMACG  416
            DPDIYTDGRISVQGID VLF P+    +  A P   P A V  K     RRGKL+E  C 
Sbjct  399  DPDIYTDGRISVQGIDAVLFAPDDAKATQTADPNRKPPAIVTHKKKIKLRRGKLLEATCQ  458

Query  415  MLGSF  401
            + G F
Sbjct  459  VAGLF  463



>ref|NP_001051505.1| Os03g0788700 [Oryza sativa Japonica Group]
 gb|AAT75257.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99260.1| beta-Ig-H3 domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13419.1| Os03g0788700 [Oryza sativa Japonica Group]
 dbj|BAG93670.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 12/66 (18%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNP----------AAPKASPLAKVVSKPRRGKLMEM  425
            DPDI+ DGRISVQGID VLFPP  +             AP  + ++K+  K RRGKL+E 
Sbjct  404  DPDIFADGRISVQGIDAVLFPPAETKTKTKPATARIRTAPAITGVSKI--KHRRGKLLEA  461

Query  424  ACGMLG  407
            AC M+G
Sbjct  462  ACQMVG  467



>dbj|BAJ87361.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=525

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 38/64 (59%), Gaps = 7/64 (11%)
 Frame = -3

Query  571  PDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKV-------VSKPRRGKLMEMACGM  413
            PDIYTDGRISVQGID VL P +   PA P ++P  K         SK RRGKL+E  C M
Sbjct  452  PDIYTDGRISVQGIDAVLLPEDDKKPATPVSTPERKAPAVTGSRKSKLRRGKLLEATCRM  511

Query  412  LGSF  401
             G  
Sbjct  512  AGVL  515



>ref|NP_001058941.1| Os07g0160600 [Oryza sativa Japonica Group]
 dbj|BAC79642.1| GPI-anchored protein -like [Oryza sativa Japonica Group]
 dbj|BAF20855.1| Os07g0160600 [Oryza sativa Japonica Group]
 dbj|BAG89338.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93771.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 41/70 (59%), Gaps = 14/70 (20%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPS--------------NPAAPKASPLAKVVSKPRRGK  437
            DPDIYTDGRISVQGID VLFPP+ +               PA    +  A   SK RRGK
Sbjct  398  DPDIYTDGRISVQGIDAVLFPPKDTATGGEGSGSGSSGAAPARKAPAVTAHSKSKLRRGK  457

Query  436  LMEMACGMLG  407
            L+E AC ++G
Sbjct  458  LLEGACQVMG  467



>ref|XP_004494271.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Cicer arietinum]
Length=467

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 33/51 (65%), Gaps = 4/51 (8%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNP----AAPKASPLAKVVSKPRRGKL  434
            DPDIYTDGRISVQGIDGVL PPE  +           PL KV +KPRRG  
Sbjct  387  DPDIYTDGRISVQGIDGVLLPPEEESEDDSSIRHTKIPLVKVATKPRRGMF  437



>ref|XP_003559349.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Brachypodium 
distachyon]
Length=483

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 41/67 (61%), Gaps = 9/67 (13%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPP------EPSNPAAP-KASP--LAKVVSKPRRGKLMEMA  422
            DPDIYTDGRISVQGID VL P         + PAAP + +P    K  +K RRGKLME  
Sbjct  407  DPDIYTDGRISVQGIDAVLLPEDDTKKTSTTTPAAPVRKAPAVTGKSKNKLRRGKLMEAT  466

Query  421  CGMLGSF  401
            C M G F
Sbjct  467  CHMAGIF  473



>dbj|BAB08961.1| unnamed protein product [Arabidopsis thaliana]
Length=465

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 2/48 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGKLM  431
            DPDIYTDGRISVQGIDGVLFP E     + K  P+ K+V +PRRG L+
Sbjct  393  DPDIYTDGRISVQGIDGVLFPQEEEVVESVK-KPVKKIV-QPRRGTLL  438



>dbj|BAJ97817.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 40/65 (62%), Gaps = 11/65 (17%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPP----EPSNPAAPKASPLAKV-----VSKP--RRGKLME  428
            DPDIYTDGRISVQGID VLF P      S  A+   SP+ K       +KP  RRGKL+E
Sbjct  388  DPDIYTDGRISVQGIDAVLFSPMEDTAKSGSASAGGSPVRKAPAVTGTAKPKLRRGKLLE  447

Query  427  MACGM  413
             AC M
Sbjct  448  GACQM  452



>dbj|BAJ98684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 40/65 (62%), Gaps = 11/65 (17%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPP----EPSNPAAPKASPLAKV-----VSKP--RRGKLME  428
            DPDIYTDGRISVQGID VLF P      S  A+   SP+ K       +KP  RRGKL+E
Sbjct  388  DPDIYTDGRISVQGIDAVLFSPMEDTAKSGSASAGGSPVRKAPAVTGTAKPKLRRGKLLE  447

Query  427  MACGM  413
             AC M
Sbjct  448  GACQM  452



>gb|KDO48671.1| hypothetical protein CISIN_1g013434mg [Citrus sinensis]
 gb|KDO48672.1| hypothetical protein CISIN_1g013434mg [Citrus sinensis]
Length=443

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAK  464
            DPDIYTDGRISVQGIDGVLFPPE ++    K   ++K
Sbjct  405  DPDIYTDGRISVQGIDGVLFPPEETSTNYQKVKKMSK  441



>ref|XP_004955500.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Setaria 
italica]
Length=489

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 41/71 (58%), Gaps = 12/71 (17%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPP----------EPSNPAAPKASPLAKVVSKP--RRGKLM  431
            DPDIYTDGRISVQGID VLFPP            +   A +A  +    +KP  RRGKL+
Sbjct  410  DPDIYTDGRISVQGIDAVLFPPVEDGGKSPAAAAAAKPARRAPAVTGATAKPKLRRGKLL  469

Query  430  EMACGMLGSFC  398
            E AC  +G F 
Sbjct  470  EGACQFMGVFV  480



>gb|EMT18986.1| hypothetical protein F775_43653 [Aegilops tauschii]
Length=88

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAK--VVSKPRRGKL  434
            DPDIYTDGRISVQGID VL P +   PA P ++P  K   V+  R+ KL
Sbjct  35   DPDIYTDGRISVQGIDAVLLPEDDKKPATPVSAPDRKAPAVTGSRKSKL  83



>ref|XP_006651891.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 16-like [Oryza brachyantha]
Length=464

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 8/64 (13%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNP--------AAPKASPLAKVVSKPRRGKLMEMAC  419
            DPDIY DGRISVQGID VLFPP+ +           A   +  +   +K RRGKL+E +C
Sbjct  382  DPDIYADGRISVQGIDAVLFPPDAAKTEPATARVTRATTTTITSTDKTKLRRGKLLEASC  441

Query  418  GMLG  407
             M G
Sbjct  442  RMAG  445



>gb|KHN17997.1| Fasciclin-like arabinogalactan protein 16 [Glycine soja]
Length=164

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 30/50 (60%), Gaps = 6/50 (12%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPP------EPSNPAAPKASPLAKVVSKPRR  443
            DPDIYTDGRISVQGIDGVLFP       E   P        AKVV K RR
Sbjct  96   DPDIYTDGRISVQGIDGVLFPTVEVEGAERVRPVTRTGQNGAKVVVKHRR  145



>ref|XP_006379436.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 ref|XP_006379437.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 ref|XP_002311924.2| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|ERP57233.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|ERP57234.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|EEE89291.2| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
Length=439

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLA-KVVSKPRR  443
            DPDIYTDGRISVQGIDGVLFP E    +  K    + KV +KP+R
Sbjct  394  DPDIYTDGRISVQGIDGVLFPLEEKEKSDTKTEMKSVKVAAKPQR  438



>ref|XP_006379435.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|ERP57232.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
Length=440

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLA-KVVSKPRR  443
            DPDIYTDGRISVQGIDGVLFP E    +  K    + KV +KP+R
Sbjct  394  DPDIYTDGRISVQGIDGVLFPLEEKEKSDTKTEMKSVKVAAKPQR  438



>gb|KHG00930.1| Fasciclin-like arabinogalactan protein 17 [Gossypium arboreum]
Length=434

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 32/46 (70%), Gaps = 2/46 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRGK  437
            DPDIYTDGRISVQGIDGVLFPPE       K   +A   +KPRRG 
Sbjct  391  DPDIYTDGRISVQGIDGVLFPPEEKTKEEKKTIKVA--TAKPRRGN  434



>ref|XP_003557575.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Brachypodium 
distachyon]
Length=489

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 43/87 (49%), Gaps = 19/87 (22%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVS-------------KPRRGKL  434
            DPDIYTDGRISVQGID VLFPP   + AA   +  A                 K RRGKL
Sbjct  409  DPDIYTDGRISVQGIDAVLFPPVDGDAAAAGKNAGAAPARARKAPAVTGSAKPKLRRGKL  468

Query  433  MEMACGMLGSFCH*KPRELKKRYNKKQ  353
            ME AC ++  F        + RY   Q
Sbjct  469  MEGACKVIAMFGQ------RSRYTSCQ  489



>gb|EYU19863.1| hypothetical protein MIMGU_mgv1a006599mg [Erythranthe guttata]
Length=437

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSN  497
            DPDIYTDGRISVQGIDGVLFPPE S+
Sbjct  403  DPDIYTDGRISVQGIDGVLFPPEESD  428



>gb|KCW90412.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
Length=463

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAA  488
            DPDIYTDGRISVQGIDGVLFP E + PA+
Sbjct  392  DPDIYTDGRISVQGIDGVLFPAEETAPAS  420



>ref|XP_010058812.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Eucalyptus 
grandis]
 gb|KCW90414.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
 gb|KCW90415.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
Length=439

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAA  488
            DPDIYTDGRISVQGIDGVLFP E + PA+
Sbjct  392  DPDIYTDGRISVQGIDGVLFPAEETAPAS  420



>gb|KHG10334.1| Fasciclin-like arabinogalactan protein 17 [Gossypium arboreum]
Length=468

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVSKPRRG  440
            DPDIYTDGRISVQGIDGVLFP E       K   +A V  KPRRG
Sbjct  393  DPDIYTDGRISVQGIDGVLFPLEEKAKEEKKTIKVATV--KPRRG  435



>gb|AAF02137.1|AC009918_9 unknown protein [Arabidopsis thaliana]
Length=447

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPK-ASPLAKVVSKPRRGKL  434
            DPDIYTDGRISVQGIDGVLFP E       K   P+ KVV +PRRG  
Sbjct  396  DPDIYTDGRISVQGIDGVLFPEEKEEETVKKPTGPVKKVV-QPRRGTF  442



>gb|EMS51573.1| hypothetical protein TRIUR3_27345 [Triticum urartu]
Length=140

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 7/57 (12%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVV-----SKP--RRGKLMEM  425
            DPDIYTDGRISVQGID VL PP      +  ASP+ K +     +KP  RRG + ++
Sbjct  62   DPDIYTDGRISVQGIDAVLSPPVEDTAKSAGASPVRKALVVTGTAKPKLRRGNMKKL  118



>gb|KDO48944.1| hypothetical protein CISIN_1g043668mg [Citrus sinensis]
Length=415

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFP-PEPSNPAAPKASPLAKVVSKPRRGKL  434
            DPDIYTDGRISVQGIDGVLFP  E +  +    +         RRGKL
Sbjct  367  DPDIYTDGRISVQGIDGVLFPVKEGTKNSKKTKAVAKVAAKPARRGKL  414



>gb|ABK25995.1| unknown [Picea sitchensis]
Length=185

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 36/68 (53%), Gaps = 13/68 (19%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAA------------PKASPLAKVVSKPRRGKLM  431
            D DIY DGRISVQGID VLFPP+P +                +    A   S+P RG+L+
Sbjct  110  DHDIYVDGRISVQGIDKVLFPPQPKDVKTVKTVKTKGRKLREEEEEEAVNESQPARGRLL  169

Query  430  EMA-CGML  410
              A CG+ 
Sbjct  170  TRAVCGLF  177



>gb|ABK25415.1| unknown [Picea sitchensis]
Length=464

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 36/68 (53%), Gaps = 13/68 (19%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAA------------PKASPLAKVVSKPRRGKLM  431
            D DIY DGRISVQGID VLFPP+P +                +    A   S+P RG+L+
Sbjct  389  DHDIYVDGRISVQGIDKVLFPPQPKDVKTVKTVKTKGRKLREEEEEEAVNESQPTRGRLL  448

Query  430  EMA-CGML  410
              A CG+ 
Sbjct  449  TRAVCGLF  456



>gb|KHN43596.1| Fasciclin-like arabinogalactan protein 15 [Glycine soja]
Length=298

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLAKVVS-KPRR  443
            DPDIYTDGRISVQGIDGVL PPE       + +PL KV + KPRR
Sbjct  205  DPDIYTDGRISVQGIDGVLIPPEEEEERTRRTTPLVKVAAPKPRR  249



>ref|XP_002315410.2| hypothetical protein POPTR_0010s25110g [Populus trichocarpa]
 gb|EEF01581.2| hypothetical protein POPTR_0010s25110g [Populus trichocarpa]
Length=439

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPEPSNPAAPKASPLA-KVVSKPRR  443
            DPDIYTDGRISVQGIDGVLFP E    +  K    + KV  KP+R
Sbjct  390  DPDIYTDGRISVQGIDGVLFPLEEKEKSETKKEIKSVKVAVKPQR  434



>gb|EEC81554.1| hypothetical protein OsI_24980 [Oryza sativa Indica Group]
Length=484

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -3

Query  574  DPDIYTDGRISVQGIDGVLFPPE  506
            DPDIYTDGRISVQGID VLFPP+
Sbjct  425  DPDIYTDGRISVQGIDAVLFPPK  447



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985