BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF043I06

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFY26882.1|  catalase                                                221   1e-69   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                220   1e-65   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          220   2e-65   Ipomoea batatas [batate]
gb|AFR42412.1|  catalase                                                181   2e-54   Eperua falcata
gb|AFR42410.1|  catalase                                                179   7e-54   Eperua falcata
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      187   6e-53   Nicotiana tomentosiformis
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      181   9e-51   Nicotiana sylvestris
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 179   5e-50   Eucalyptus grandis [rose gum]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      179   7e-50   Prunus mume [ume]
emb|CBI29556.3|  unnamed protein product                                168   8e-50   Vitis vinifera
emb|CAD42908.1|  catalase                                               179   8e-50   Prunus persica
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             179   9e-50   Prunus persica
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 179   9e-50   Elaeis guineensis
emb|CAB56850.1|  catalase                                               177   1e-49   Prunus persica
dbj|BAH20283.1|  AT1G20620                                              169   1e-49   Arabidopsis thaliana [mouse-ear cress]
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               178   1e-49   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    178   1e-49   Gossypium raimondii
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                178   2e-49   Citrus sinensis [apfelsine]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 178   2e-49   Nicotiana sylvestris
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             178   2e-49   Citrus clementina [clementine]
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 178   2e-49   Nicotiana tomentosiformis
gb|AAM97542.1|  catalase 3                                              177   3e-49   Capsicum annuum
ref|NP_001289779.1|  catalase isozyme 1                                 177   4e-49   Nelumbo nucifera [Indian lotus]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      177   5e-49   
dbj|BAF91369.1|  catalase                                               177   5e-49   Capsicum annuum
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      177   5e-49   
emb|CAA10286.1|  catalase                                               166   7e-49   Cicer arietinum [garbanzo]
dbj|BAD94702.1|  catalase                                               166   9e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061175.1|  PREDICTED: catalase-like                           176   9e-49   Eucalyptus grandis [rose gum]
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 176   9e-49   Prunus mume [ume]
gb|AGC65520.1|  catalase                                                176   1e-48   Eriobotrya japonica [loquat]
gb|KJB14249.1|  hypothetical protein B456_002G115900                    172   2e-48   Gossypium raimondii
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    175   2e-48   Capsicum annuum
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          175   2e-48   Soldanella alpina
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      175   2e-48   Populus euphratica
gb|AAB88173.1|  catalase                                                171   2e-48   Glycine max [soybeans]
ref|XP_002306976.2|  catalase family protein                            175   3e-48   
ref|XP_002301920.1|  catalase family protein                            174   3e-48   Populus trichocarpa [western balsam poplar]
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         174   3e-48   Tarenaya hassleriana [spider flower]
emb|CAI43948.1|  catalase                                               174   3e-48   Populus deltoides
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     176   4e-48   Eucalyptus grandis [rose gum]
gb|AIS20825.1|  CAT                                                     174   4e-48   Pyrus x bretschneideri [bai li]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      174   5e-48   Elaeis guineensis
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      174   5e-48   
gb|ABY19573.1|  catalase                                                168   6e-48   Manihot esculenta [manioc]
emb|CDP07287.1|  unnamed protein product                                174   6e-48   Coffea canephora [robusta coffee]
gb|ACJ11733.1|  catalase                                                174   6e-48   Gossypium hirsutum [American cotton]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 174   6e-48   Populus euphratica
gb|AAA57551.1|  catalase                                                171   8e-48   Nicotiana sylvestris
gb|AAX84671.1|  catalase CAT2                                           168   9e-48   Manihot esculenta [manioc]
emb|CAD42909.1|  catalase                                               173   1e-47   Prunus persica
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             173   1e-47   Prunus persica
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      173   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      173   1e-47   Eucalyptus grandis [rose gum]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 173   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|AJE26131.1|  catalase                                                173   1e-47   Salix matsudana [tortured willow]
gb|AAR84578.1|  catalase 1a                                             173   2e-47   Lotus japonicus
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      172   2e-47   Phoenix dactylifera
gb|KHG25152.1|  Catalase isozyme 1                                      172   2e-47   Gossypium arboreum [tree cotton]
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          172   2e-47   Solanum melongena [aubergine]
ref|XP_009110221.1|  PREDICTED: catalase-3                              172   2e-47   Brassica rapa
ref|XP_010498496.1|  PREDICTED: catalase-3                              172   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      172   3e-47   Nicotiana tomentosiformis
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    172   3e-47   Nicotiana tabacum [American tobacco]
gb|AFK46618.1|  unknown                                                 162   3e-47   Lotus japonicus
gb|AGV54297.1|  peroxisomal catalase                                    172   3e-47   Phaseolus vulgaris [French bean]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      172   3e-47   Nicotiana sylvestris
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             172   3e-47   Phaseolus vulgaris [French bean]
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    172   4e-47   Arabis alpina [alpine rockcress]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             172   4e-47   Phaseolus vulgaris [French bean]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    172   4e-47   Gossypium raimondii
gb|ABR15776.1|  catalase                                                167   4e-47   Litchi
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           172   4e-47   Sesamum indicum [beniseed]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           172   4e-47   
ref|NP_001237571.1|  catalase-4                                         171   4e-47   Glycine max [soybeans]
gb|AET97564.1|  catalase                                                171   4e-47   Ziziphus jujuba [Chinese jujube]
gb|AIA61608.1|  catalase                                                171   5e-47   Gynostemma pentaphyllum [jiaogulan]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         171   5e-47   Brassica rapa
emb|CAC04509.1|  catalase                                               166   5e-47   Digitalis lanata [Grecian foxglove]
emb|CDY31488.1|  BnaC05g15970D                                          171   5e-47   Brassica napus [oilseed rape]
emb|CDY33636.1|  BnaC08g19360D                                          171   5e-47   Brassica napus [oilseed rape]
emb|CDY29519.1|  BnaA06g14510D                                          171   6e-47   Brassica napus [oilseed rape]
ref|NP_001031072.3|  catalase 3                                         169   6e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149539.1|  PREDICTED: catalase-3                              172   6e-47   Brassica rapa
ref|XP_007018034.1|  Catalase 2                                         171   7e-47   
ref|NP_001240021.1|  catalase                                           171   8e-47   Glycine max [soybeans]
gb|ADC95629.1|  catalase                                                171   8e-47   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      171   8e-47   Vitis vinifera
gb|AGE15298.2|  catalase 1                                              171   8e-47   Eriobotrya japonica [loquat]
emb|CDY01364.1|  BnaA07g11370D                                          172   8e-47   
gb|AHF27428.1|  catalase                                                167   9e-47   Cucurbita moschata [ayote]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 171   1e-46   Phoenix dactylifera
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      170   1e-46   Solanum lycopersicum
gb|AAG43363.1|AF151368_1  catalase                                      170   1e-46   Hevea brasiliensis [jebe]
emb|CCP37650.1|  catalase-1                                             170   1e-46   Nicotiana tabacum [American tobacco]
gb|ACJ73905.1|  CAT1                                                    162   1e-46   Solanum nigrum
gb|ACL27272.1|  catalase                                                170   2e-46   Nicotiana benthamiana
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 170   2e-46   Vitis vinifera
ref|NP_001268098.1|  catalase                                           170   2e-46   Vitis vinifera
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               170   2e-46   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AFU48609.1|  catalase 1                                              170   2e-46   Nicotiana benthamiana
gb|AIX10947.1|  putative catalase                                       170   2e-46   Gardenia jasminoides
dbj|BAH20307.1|  AT1G20620                                              169   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      169   2e-46   Cucumis melo [Oriental melon]
gb|AAB62892.1|  catalase-1                                              169   2e-46   Nicotiana glutinosa
ref|NP_001234827.1|  catalase isozyme 1                                 169   2e-46   Solanum lycopersicum
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               169   2e-46   Gossypium hirsutum [American cotton]
emb|CDY31878.1|  BnaC07g15280D                                          169   3e-46   Brassica napus [oilseed rape]
ref|NP_564120.1|  catalase 3                                            169   3e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65021.1|  unknown                                                 169   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001291326.1|  catalase isozyme 1                                 169   3e-46   Sesamum indicum [beniseed]
ref|XP_010530333.1|  PREDICTED: catalase-2                              169   3e-46   Tarenaya hassleriana [spider flower]
gb|AAB71764.1|  catalase 1                                              169   4e-46   Nicotiana tabacum [American tobacco]
dbj|BAC79443.1|  catalase                                               169   4e-46   Acacia ampliceps
gb|AFU90822.1|  catalase                                                169   5e-46   Populus tomentosa [Chinese white poplar]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               168   6e-46   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAF19965.1|AF207906_1  catalase 1                                    168   6e-46   Zantedeschia aethiopica [arum-lily]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      168   6e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010692544.1|  PREDICTED: catalase-like                           168   7e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                168   8e-46   Erythranthe guttata [common monkey flower]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          168   9e-46   Avicennia marina
gb|AFU90823.1|  catalase                                                167   9e-46   Populus x beijingensis
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             168   9e-46   Eutrema salsugineum [saltwater cress]
dbj|BAJ33995.1|  unnamed protein product                                168   9e-46   Eutrema halophilum
gb|AAO17721.1|  catalase                                                168   1e-45   Hypericum perforatum
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             168   1e-45   Citrus clementina [clementine]
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      168   1e-45   
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          167   1e-45   Vigna radiata var. radiata [golden gram]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      167   1e-45   Citrus sinensis [apfelsine]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     168   1e-45   Sesamum indicum [beniseed]
gb|AAD37788.1|AF149283_1  catalase 1                                    166   1e-45   Phaseolus vulgaris [French bean]
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             167   1e-45   Capsella rubella
gb|AEQ30070.1|  catalase                                                167   1e-45   Litchi chinensis [litchi]
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       167   1e-45   Cucumis sativus [cucumbers]
emb|CDX72514.1|  BnaC07g45360D                                          167   1e-45   
ref|NP_001237556.1|  catalase-1/2                                       167   2e-45   Glycine max [soybeans]
ref|XP_010094556.1|  Catalase isozyme 1                                 167   2e-45   Morus notabilis
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      167   2e-45   Nicotiana sylvestris
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               167   2e-45   Cucurbita pepo
gb|ACV92695.1|  catalase                                                167   2e-45   Brassica oleracea
gb|ABC01913.1|  catalase isozyme 1-like protein                         167   2e-45   Solanum tuberosum [potatoes]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             167   2e-45   
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               167   2e-45   Ricinus communis
gb|AAC48918.1|  salicylic acid binding catalase                         167   2e-45   Nicotiana tabacum [American tobacco]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 167   3e-45   Solanum tuberosum [potatoes]
emb|CDP07288.1|  unnamed protein product                                167   3e-45   Coffea canephora [robusta coffee]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             167   3e-45   
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      166   3e-45   Nicotiana tomentosiformis
gb|AAB86582.2|  catalase                                                166   3e-45   Raphanus sativus
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             166   3e-45   Populus trichocarpa [western balsam poplar]
emb|CAA64220.1|  catalase                                               166   3e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAF71742.1|AF248491_1  catalase                                      166   3e-45   Raphanus sativus
gb|ABM47415.1|  catalase                                                166   3e-45   Prunus avium [gean]
ref|XP_009106100.1|  PREDICTED: catalase-2                              166   3e-45   Brassica rapa
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              166   4e-45   Cicer arietinum [garbanzo]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              166   4e-45   
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             166   4e-45   Capsella rubella
gb|ACV30589.1|  catalase                                                158   4e-45   Carica papaya [mamon]
gb|ACJ76836.3|  catalase                                                166   4e-45   Dimocarpus longan [longan]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               166   4e-45   Gossypium hirsutum [American cotton]
gb|KHG12976.1|  Catalase isozyme 2                                      166   4e-45   Gossypium arboreum [tree cotton]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         166   4e-45   Tarenaya hassleriana [spider flower]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          166   4e-45   Amborella trichopoda
emb|CDX76313.1|  BnaA08g10870D                                          166   4e-45   
gb|AAD30292.1|AF139539_1  catalase 3                                    166   4e-45   Raphanus sativus
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         166   4e-45   Tarenaya hassleriana [spider flower]
ref|NP_001235974.1|  catalase-3                                         166   4e-45   Glycine max [soybeans]
prf||1906388A  catalase                                                 166   5e-45
emb|CAA45564.1|  catalase                                               166   5e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AHF27433.1|  catalase                                                166   5e-45   Cucurbita maxima [Boston marrow]
ref|NP_195235.1|  catalase 2                                            166   5e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96854.1|  catalase                                                166   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138342.1|  PREDICTED: catalase-2                              166   5e-45   Brassica rapa
gb|AHF27430.1|  catalase                                                166   6e-45   Cucurbita moschata [ayote]
emb|CDY40645.1|  BnaA03g53180D                                          166   6e-45   Brassica napus [oilseed rape]
gb|AAD17935.1|  catalase                                                166   6e-45   Brassica juncea [brown mustard]
dbj|BAQ21275.1|  catalase                                               166   6e-45   Citrus tamurana
ref|NP_001234186.1|  catalase isozyme 2                                 166   6e-45   
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          166   6e-45   Amborella trichopoda
gb|AAR14052.2|  catalase                                                165   7e-45   Solanum tuberosum [potatoes]
gb|AAD30291.2|AF139538_1  catalase 2                                    166   7e-45   Raphanus sativus
ref|NP_001274863.1|  catalase isozyme 1                                 166   7e-45   Solanum tuberosum [potatoes]
gb|AAD17936.1|  catalase                                                166   7e-45   Brassica juncea [brown mustard]
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               166   7e-45   Solanum tuberosum [potatoes]
gb|KFK30147.1|  catalase                                                166   8e-45   Arabis alpina [alpine rockcress]
ref|XP_011022275.1|  PREDICTED: catalase-like                           165   8e-45   Populus euphratica
gb|ACA50528.1|  putative catalase 2                                     165   9e-45   Brassica napus [oilseed rape]
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      165   1e-44   
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      165   1e-44   Phoenix dactylifera
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              165   1e-44   Populus euphratica
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         165   1e-44   Jatropha curcas
gb|ACB11496.1|  catalase                                                165   1e-44   Pinus sylvestris [Scotch pine]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              165   1e-44   Populus euphratica
gb|AAC49807.1|  catalase 3                                              165   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007046520.1|  Catalase 2                                         165   1e-44   Theobroma cacao [chocolate]
emb|CDY17510.1|  BnaC03g65530D                                          164   1e-44   Brassica napus [oilseed rape]
emb|CDY52649.1|  BnaAnng11640D                                          164   1e-44   Brassica napus [oilseed rape]
gb|AAR97905.1|  catalase                                                165   1e-44   Solanum tuberosum [potatoes]
emb|CAA85470.1|  catalase                                               165   1e-44   Solanum tuberosum [potatoes]
emb|CDP01803.1|  unnamed protein product                                165   1e-44   Coffea canephora [robusta coffee]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               165   1e-44   Solanum tuberosum [potatoes]
prf||2104177A  catalase                                                 164   2e-44
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          164   2e-44   Helianthus annuus
gb|AAF79625.1|AC027665_26  F5M15.5                                      168   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAL00886.1|  catalase                                                160   2e-44   Suaeda salsa
gb|AFR53082.1|  CAT                                                     164   2e-44   Anthurium andraeanum [flamingo-lily]
gb|ADZ45556.1|  catalase                                                164   2e-44   Vigna radiata [mung bean]
gb|ADZ45555.1|  catalase                                                164   2e-44   Vigna radiata [mung bean]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      164   2e-44   Solanum tuberosum [potatoes]
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          164   2e-44
gb|ACJ73906.1|  CAT2                                                    160   3e-44   Solanum nigrum
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      164   3e-44   Elaeis guineensis
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               163   6e-44   Ricinus communis
gb|AAM97541.1|  catalase 2                                              163   7e-44   Capsicum annuum
ref|XP_002510677.1|  catalase, putative                                 166   8e-44   
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         163   8e-44   Camelina sativa [gold-of-pleasure]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 162   8e-44   Manihot esculenta [manioc]
ref|XP_010437527.1|  PREDICTED: catalase-2                              162   8e-44   Camelina sativa [gold-of-pleasure]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      162   1e-43   Cucumis melo [Oriental melon]
gb|ABK24453.1|  unknown                                                 162   1e-43   Picea sitchensis
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                162   1e-43   Erythranthe guttata [common monkey flower]
gb|AHF21552.1|  catalase                                                162   1e-43   Hylocereus undatus [dragon fruit]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    162   1e-43   Gossypium raimondii
ref|XP_002890395.1|  F5M15.5                                            166   1e-43   
gb|AHF27432.1|  catalase                                                161   1e-43   Cucurbita maxima [Boston marrow]
gb|AHF27429.1|  catalase                                                161   1e-43   Cucurbita moschata [ayote]
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               162   1e-43   Cucurbita pepo
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 162   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 162   2e-43   
gb|AAZ29552.1|  catalase-C                                              162   2e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 162   2e-43   
gb|ADM96039.1|  catalase                                                162   2e-43   Cucumis sativus [cucumbers]
ref|NP_001048861.1|  Os03g0131200                                       162   2e-43   
dbj|BAA34205.1|  catalase                                               162   2e-43   Oryza sativa Japonica Group [Japonica rice]
gb|AAC19397.1|  leaf catalase                                           161   2e-43   Mesembryanthemum crystallinum
dbj|BAA34714.1|  catalase                                               161   2e-43   Oryza sativa [red rice]
gb|ACJ22771.1|  catalase 1                                              161   3e-43   Jatropha curcas
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               161   3e-43   Cucurbita pepo
gb|EPS69543.1|  catalase                                                161   4e-43   Genlisea aurea
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              160   4e-43   
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         160   4e-43   Camelina sativa [gold-of-pleasure]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 160   5e-43   Cucumis melo [Oriental melon]
emb|CDX69111.1|  BnaC01g03420D                                          160   5e-43   
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 160   6e-43   Oryza brachyantha
ref|XP_002521709.1|  catalase, putative                                 160   6e-43   Ricinus communis
gb|AHA50082.1|  catalase                                                160   6e-43   Eleutherococcus senticosus
dbj|BAJ87148.1|  predicted protein                                      156   7e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW69584.1|  catalase1                                               157   7e-43   
gb|ACL35349.1|  catalase                                                160   7e-43   Picea glauca
gb|AAY59707.1|  catalase                                                160   8e-43   Oryza sativa Indica Group [Indian rice]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    160   8e-43   Oryza sativa Indica Group [Indian rice]
gb|AAD17933.1|  catalase                                                160   9e-43   Brassica juncea [brown mustard]
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       158   1e-42   Cucumis sativus [cucumbers]
gb|AFN81243.1|  catalase 1                                              160   1e-42   Brassica rapa subsp. pekinensis [bai cai]
gb|KEH36312.1|  catalase heme-binding enzyme                            159   1e-42   Medicago truncatula
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    159   2e-42   
dbj|BAA05494.1|  catalase                                               159   2e-42   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA34204.1|  catalase                                               159   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058635.1|  Os06g0727200                                       159   2e-42   
emb|CAG23920.1|  catalase                                               159   3e-42   Festuca arundinacea [tall fescue]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      159   3e-42   Fragaria vesca subsp. vesca
gb|ADU56199.1|  catalase                                                158   3e-42   Hevea brasiliensis [jebe]
gb|AIU99481.1|  catalase                                                158   3e-42   Saccharum spontaneum [fodder cane]
emb|CDP01802.1|  unnamed protein product                                158   4e-42   Coffea canephora [robusta coffee]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       158   4e-42   Triticum aestivum [Canadian hard winter wheat]
gb|AIU99488.1|  catalase                                                158   4e-42   Saccharum hybrid cultivar ROC22
gb|ABQ44283.1|  catalase                                                155   4e-42   Saccharum hybrid cultivar NCo 376
gb|AIM43584.1|  catalase                                                158   4e-42   Saccharum hybrid cultivar Yacheng05-179
gb|AIU99484.1|  catalase                                                158   4e-42   Saccharum arundinaceum
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         158   4e-42   Oryza brachyantha
gb|AIU99480.1|  catalase                                                158   4e-42   Saccharum spontaneum [fodder cane]
gb|AIU99485.1|  catalase                                                158   4e-42   Saccharum spontaneum [fodder cane]
gb|EMT05040.1|  Catalase-1                                              158   4e-42   
gb|AAG61140.2|AF332973_1  catalase 2                                    158   4e-42   Zantedeschia aethiopica [arum-lily]
ref|XP_003558892.1|  PREDICTED: catalase-1                              158   5e-42   Brachypodium distachyon [annual false brome]
gb|AIU99479.1|  catalase                                                157   6e-42   Saccharum arundinaceum
gb|AAC17729.1|  catalase 1                                              156   6e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          157   6e-42   
ref|NP_001241808.1|  catalase isozyme B                                 157   6e-42   Zea mays [maize]
emb|CAA42720.1|  catalase-1                                             157   7e-42   
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 160   8e-42   
ref|NP_564121.1|  catalase 1                                            157   1e-41   
gb|AAC17731.1|  catalase 1                                              157   1e-41   
dbj|BAJ90861.1|  predicted protein                                      157   1e-41   
gb|AIU99482.1|  catalase                                                156   2e-41   
dbj|BAJ88747.1|  predicted protein                                      157   2e-41   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               156   2e-41   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      156   2e-41   
ref|XP_009103333.1|  PREDICTED: catalase-1                              156   2e-41   
emb|CDY01363.1|  BnaA07g11360D                                          156   2e-41   
emb|CDY31877.1|  BnaC07g15270D                                          156   2e-41   
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    156   3e-41   
gb|ABB72796.1|  catalase isozyme 1-like protein                         155   3e-41   
gb|ABY21704.1|  catalase-1 precursor                                    155   4e-41   
ref|NP_001105415.1|  catalase isozyme 1                                 155   4e-41   
gb|AIU99486.1|  catalase                                                155   4e-41   
gb|AAF61732.1|AF243517_1  catalase 2                                    155   5e-41   
ref|XP_010692546.1|  PREDICTED: catalase                                155   5e-41   
gb|AIZ77475.1|  catalase                                                155   6e-41   
gb|AAK67359.2|AF390210_1  catalase                                      155   6e-41   
gb|AIU99487.1|  catalase                                                154   7e-41   
gb|AIU99483.1|  catalase                                                154   8e-41   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 155   1e-40   
gb|AIP93616.1|  CAT1                                                    154   1e-40   
gb|ACN36234.1|  unknown                                                 151   1e-40   
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         154   1e-40   
emb|CAE82295.1|  catalase                                               154   2e-40   
gb|ADU56198.1|  catalase                                                154   2e-40   
gb|AAB07026.1|  catalase 1                                              154   2e-40   
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             154   2e-40   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      153   3e-40   
gb|ADK25939.1|  catalase                                                147   3e-40   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             152   4e-40   
gb|ABV55108.1|  catalase 2                                              152   5e-40   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      152   7e-40   
gb|KHG21219.1|  Catalase isozyme 1                                      151   7e-40   
gb|AAC19398.1|  root catalase                                           152   9e-40   
gb|AHB72694.1|  catalase                                                152   9e-40   
dbj|BAH37035.1|  catalase 1                                             151   1e-39   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            151   1e-39   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               151   1e-39   
gb|AFD29285.1|  catalase                                                151   2e-39   
gb|AAF61733.1|AF243518_1  catalase 3                                    151   2e-39   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         150   2e-39   
tpg|DAA43177.1|  TPA: catalase2                                         150   2e-39   
gb|ACH63223.1|  catalase                                                150   2e-39   
prf||1803522A  catalase                                                 150   3e-39
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               150   3e-39   
ref|NP_001105310.1|  catalase isozyme 2                                 150   3e-39   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             150   4e-39   
tpg|DAA43178.1|  TPA: catalase2                                         149   1e-38   
ref|NP_001031073.1|  catalase 3                                         149   1e-38   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             148   2e-38   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         148   2e-38   
gb|ADN94253.1|  catalase                                                148   2e-38   
gb|AAF61734.1|AF243519_1  catalase 4                                    147   3e-38   
gb|ABS72010.1|  putative catalase                                       137   4e-38   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             146   8e-38   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         146   8e-38   
ref|XP_008365914.1|  PREDICTED: catalase isozyme 3-like                 137   1e-37   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      145   1e-37   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   146   2e-37   
ref|XP_009149540.1|  PREDICTED: catalase-1                              145   2e-37   
emb|CDY29518.1|  BnaA06g14520D                                          145   2e-37   
emb|CDY31490.1|  BnaC05g15990D                                          145   2e-37   
ref|XP_010477308.1|  PREDICTED: catalase-1                              145   2e-37   
ref|XP_008348923.1|  PREDICTED: catalase isozyme 3-like                 135   6e-37   
ref|XP_001779509.1|  predicted protein                                  143   1e-36   
gb|AJF34884.1|  catalase                                                142   2e-36   
dbj|BAD07937.1|  catalase catA-like protein                             134   5e-36   
gb|ACL81498.1|  catalase                                                141   6e-36   
emb|CAA42026.1|  catalase                                               131   1e-35   
gb|ABY68159.1|  catalase                                                131   4e-35   
gb|ABY68162.1|  catalase                                                131   4e-35   
gb|AFI48101.1|  catalase isozyme B                                      130   5e-35   
gb|ABY68160.1|  catalase                                                130   6e-35   
gb|ABY68158.1|  catalase                                                130   6e-35   
gb|ABY68164.1|  catalase                                                130   7e-35   
gb|AFI48111.1|  catalase isozyme B                                      130   7e-35   
dbj|BAJ92414.1|  predicted protein                                      137   2e-34   
gb|AFI48054.1|  catalase isozyme B                                      129   2e-34   
gb|ADY02963.1|  catalase                                                137   2e-34   
dbj|BAH56915.1|  AT1G20620                                              136   2e-34   
gb|AAC17730.1|  catalase 2                                              135   3e-34   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      136   3e-34   
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             136   3e-34   
gb|ABY68161.1|  catalase                                                129   3e-34   
emb|CAH61266.1|  catalase                                               136   3e-34   
gb|EMS51034.1|  Catalase isozyme 2                                      136   3e-34   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               136   4e-34   
gb|AAX88799.1|  catalase                                                136   4e-34   
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              135   5e-34   
gb|AFI48068.1|  catalase isozyme B                                      128   6e-34   
ref|XP_010105996.1|  Catalase isozyme 1                                 134   7e-34   
gb|AFI48131.1|  catalase isozyme B                                      127   7e-34   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 135   1e-33   
gb|AFI48098.1|  catalase isozyme B                                      126   2e-33   
dbj|BAH19523.1|  AT4G35090                                              134   2e-33   
ref|NP_001031791.1|  catalase 2                                         134   2e-33   
gb|EMT06167.1|  Catalase isozyme 2                                      135   4e-33   
gb|ABY68163.1|  catalase                                                125   5e-33   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          132   7e-33   
ref|NP_001045673.1|  Os02g0115700                                       132   8e-33   
gb|AFI48130.1|  catalase isozyme B                                      125   8e-33   
gb|ABK24449.1|  unknown                                                 132   1e-32   
ref|XP_001752315.1|  predicted protein                                  131   1e-32   
gb|AGI65617.1|  catalase                                                131   1e-32   
gb|ABN71233.2|  catalase                                                131   1e-32   
ref|XP_005645077.1|  catalase                                           129   7e-32   
gb|EMS61345.1|  Catalase isozyme 1                                      130   8e-32   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      129   1e-31   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      129   1e-31   
ref|XP_002980252.1|  hypothetical protein SELMODRAFT_112333             122   1e-31   
gb|ADQ28492.1|  catalase                                                129   2e-31   
ref|XP_001784759.1|  predicted protein                                  127   3e-31   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          127   4e-31   
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656             122   5e-31   
gb|ABR16304.1|  unknown                                                 127   5e-31   
emb|CDY43951.1|  BnaC04g21590D                                          123   6e-31   
gb|ABK24543.1|  unknown                                                 127   7e-31   
emb|CDY31866.1|  BnaC07g15160D                                          122   1e-30   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          125   3e-30   
gb|AGT16203.1|  catalase                                                123   1e-29   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    123   1e-29   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           122   3e-29
emb|CAA43814.1|  catalase                                               122   4e-29   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              120   2e-28   
gb|KIY96954.1|  catalase                                                118   3e-28   
gb|AII23739.1|  catalase                                                119   4e-28   
gb|ABK41476.1|  catalase                                                115   9e-27   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     114   2e-26   
gb|AHZ13843.1|  catalase                                                114   2e-26   
gb|AFW66787.1|  catalase3                                               114   2e-26   
gb|AGT16188.1|  catalase                                                114   2e-26   
gb|AGT16054.1|  catalase                                                114   2e-26   
gb|AGT15888.1|  catalase                                                114   3e-26   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               114   3e-26   
gb|AGT16310.1|  catalase                                                114   3e-26   
gb|AFW66785.1|  catalase3 isoform 1                                     113   3e-25   
gb|AID50071.1|  catalase                                                103   3e-24   
ref|XP_011396830.1|  Catalase isozyme 2                                 108   3e-24   
gb|AFN85536.1|  catalase                                                100   5e-24   
ref|XP_002950455.1|  catalase                                           107   1e-23   
gb|ABR25882.1|  catalase isozyme b                                    98.6    3e-23   
emb|CAA73663.1|  catalase                                               105   3e-23   
ref|NP_001105416.1|  catalase isozyme 3                                 105   5e-23   
ref|XP_001696763.1|  catalase/peroxidase                                105   5e-23   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        104   8e-23   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      104   1e-22   
gb|AAY34915.1|  catalase                                              96.3    2e-22   
gb|EMS35721.1|  Catalase isozyme 1                                      101   3e-22   
gb|AAB70006.1|  catalase                                                102   8e-22   
gb|AEY70510.1|  catalase                                              99.8    1e-21   
ref|XP_005708279.1|  catalase                                         97.8    3e-20   
ref|XP_002963082.1|  hypothetical protein SELMODRAFT_79329            90.1    8e-20   
gb|AFW66789.1|  catalase3                                             93.6    2e-19   
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1            89.0    2e-19   
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g           93.2    9e-19   
gb|AFW66788.1|  catalase3                                             93.2    9e-19   
gb|KJB10391.1|  hypothetical protein B456_001G198700                  91.3    3e-18   
gb|AAR84577.1|  catalase 1b                                           90.5    6e-18   
gb|ABB88582.1|  catalase                                              89.7    2e-17   
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)          89.4    3e-17
gb|KDD77132.1|  catalase                                              87.4    1e-16   
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1    85.1    7e-16   
ref|XP_005536240.1|  catalase                                         83.2    3e-15   
gb|KJB17474.1|  hypothetical protein B456_003G002800                  82.8    3e-15   
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                   81.3    4e-15   
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg           80.1    4e-15   
gb|AGS17821.1|  catalase 2                                            71.6    3e-14   
ref|XP_005712277.1|  unnamed protein product                          79.0    1e-13   
emb|CCQ26769.2|  perixode catalase                                    72.8    1e-13   
ref|XP_002980255.1|  hypothetical protein SELMODRAFT_112561           72.0    2e-13   
gb|KCW44990.1|  hypothetical protein EUGRSUZ_L01419                   76.6    4e-13   
ref|XP_004366029.2|  catalase isozyme 2                               77.0    5e-13   
gb|KJE89728.1|  catalase isozyme 2                                    77.0    5e-13   
gb|AAO16182.1|  catalase-1                                            65.9    1e-10   
dbj|BAK04899.1|  predicted protein                                    61.6    1e-09   
gb|AAP57673.1|  catalase                                              63.9    2e-09   
ref|XP_005644653.1|  catalase-domain-containing protein               63.5    2e-08   
ref|WP_026673818.1|  catalase                                         58.5    6e-07   
ref|WP_033543820.1|  catalase                                         58.2    7e-07   
ref|WP_034418237.1|  catalase                                         57.4    1e-06   
gb|AFH53190.1|  catalase                                              55.8    2e-06   
gb|AFH53187.1|  catalase                                              55.8    2e-06   
gb|AFH53189.1|  catalase                                              55.8    2e-06   
ref|WP_043830984.1|  catalase                                         56.6    2e-06   
ref|WP_044037961.1|  catalase                                         56.2    3e-06   
emb|CAB64452.1|  catalase                                             51.6    4e-06   
ref|WP_027955028.1|  catalase                                         55.1    8e-06   
ref|WP_024631056.1|  MULTISPECIES: catalase                           55.1    8e-06   
ref|XP_005647994.1|  catalase-domain-containing protein               54.7    1e-05   
ref|WP_037277190.1|  catalase                                         54.3    1e-05   
gb|ABB51561.1|  truncated catalase 2                                  53.9    2e-05   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg           53.9    2e-05   
ref|WP_031254620.1|  catalase                                         53.9    2e-05   
ref|WP_027476258.1|  catalase                                         53.5    2e-05   
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2    53.1    3e-05   
emb|CEG24228.1|  Vegetative catalase                                  53.1    4e-05   
ref|WP_036674944.1|  catalase                                         52.8    5e-05   
ref|WP_036650771.1|  catalase                                         52.4    6e-05   
ref|WP_043193175.1|  catalase                                         52.0    8e-05   
gb|EFM10689.1|  Catalase                                              52.0    9e-05   
ref|WP_040712563.1|  catalase                                         52.0    9e-05   
ref|WP_034415032.1|  catalase                                         51.6    1e-04   
ref|XP_010320460.1|  PREDICTED: catalase isozyme 3-like               49.3    1e-04   
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like               51.2    1e-04   
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like               51.2    1e-04   
ref|WP_028412779.1|  catalase                                         51.6    1e-04   
ref|WP_036614478.1|  catalase                                         51.2    1e-04   
ref|WP_041058476.1|  catalase                                         51.2    1e-04   
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g           51.2    1e-04   
ref|WP_035422271.1|  MULTISPECIES: catalase                           50.8    2e-04   
ref|WP_036802832.1|  catalase                                         50.8    2e-04   
ref|WP_032664185.1|  catalase                                         50.4    2e-04   
ref|WP_026826608.1|  catalase                                         50.4    3e-04   
ref|WP_038702218.1|  catalase                                         50.4    3e-04   
ref|WP_002617110.1|  catalase                                         50.4    3e-04   
ref|WP_009593853.1|  catalase                                         50.1    3e-04   
ref|WP_014459443.1|  catalase                                         50.4    3e-04   



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score =   221 bits (563),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDR
Sbjct  67   RDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDR  126

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  127  FINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  173



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDR
Sbjct  386  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  446  FINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  492



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/107 (98%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDR
Sbjct  386  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  446  FINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  492



>gb|AFR42412.1| catalase, partial [Eperua falcata]
Length=131

 Score =   181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS+FD  R+AERFP P  IVTG+R++C+IEKEN+FKQPG+RYRSWAPDRQDR
Sbjct  25   RDEEIDYFPSRFDPVRHAERFPIPPAIVTGKRERCIIEKENDFKQPGERYRSWAPDRQDR  84

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ L++PRVTHEIRS WISYL+QADRSLGQKVAS LN+RP++
Sbjct  85   FVRRWVEVLADPRVTHEIRSIWISYLSQADRSLGQKVASHLNMRPSI  131



>gb|AFR42410.1| catalase, partial [Eperua falcata]
Length=135

 Score =   179 bits (455),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS+FD  R+A+RFP P  IVTG+R++C+IEKEN+FKQPG+RYRSWAPDRQDR
Sbjct  29   RDEEIDYFPSRFDPVRHAKRFPIPPAIVTGKRERCIIEKENDFKQPGERYRSWAPDRQDR  88

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ L++PRVTHEIRS WISYL+QADRSLGQKVAS LN+RP++
Sbjct  89   FVRRWVEVLADPRVTHEIRSIWISYLSQADRSLGQKVASHLNMRPSI  135



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AE++P PLR++TG+RDKC++EKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRFDPCRHAEQYPIPLRVLTGKRDKCIVEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNIRPTM  492



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AE+ P P R++TG+RDKC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRFDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QAD++LGQK+ASRLN+RPTM
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKTLGQKIASRLNVRPTM  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++YFPSKFD  R+AER+P P +IVTG+R+K +IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEINYFPSKFDPVRHAERYPIPSQIVTGKREKVIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FINRW+K+L+EPRVTHE RS WISY TQAD+SLGQK+ASRL+ RP+M
Sbjct  446  FINRWIKALTEPRVTHEHRSIWISYWTQADKSLGQKLASRLSARPSM  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  RNAERFP P  I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRNAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CBI29556.3| unnamed protein product [Vitis vinifera]
 emb|CBI37653.3| unnamed protein product [Vitis vinifera]
Length=112

 Score =   168 bits (426),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS+FD  R+AE FP P  I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+R
Sbjct  6    RDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQER  65

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  253
            FINRWV++LS+PRVT+EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  66   FINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  110



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AERFP P  I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AERFP P  I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AERFP P RI+TGRR+KCVI KENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPFRILTGRREKCVIHKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PRVT+EIR+ WISY +Q DRSLGQK+A+RLN++P+M
Sbjct  446  FICRWVEALSDPRVTYEIRTIWISYWSQCDRSLGQKIATRLNVKPSM  492



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  317  RDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQER  376

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  377  FIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  423



>dbj|BAH20283.1| AT1G20620 [Arabidopsis thaliana]
Length=145

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDR
Sbjct  39   RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  98

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  99   FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  145



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AE++P P  ++TG+RDKC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRFDPCRHAEQYPIPPCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS W SY +QAD++LGQK+ASRLN+RPTM
Sbjct  446  FICRWVDALSDPRVTHEIRSIWFSYWSQADKTLGQKIASRLNVRPTM  492



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++YFPS++D +R+AERFP P  + TG+R+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEINYFPSRYDPSRHAERFPIPPALCTGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FINRWV ++S+PRVTHEIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FINRWVDAMSDPRVTHEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS++D TR+AER+P P  ++TGRR+K  IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  371  RDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQER  430

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+NRW+K+L +PRVTHE+RS W+SY +QADRSLGQK+ASRLN+RP++
Sbjct  431  FLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  477



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AE++P P RI+TG+RD+C+IEKENNFKQPG+RYRSW+PDRQ+R
Sbjct  386  RDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PRVTHEIR  WISY +QAD+SLG+K+ASRLN+RPTM
Sbjct  446  FICRWINALSDPRVTHEIRIIWISYWSQADKSLGEKIASRLNVRPTM  492



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS++D TR+AER+P P  ++TGRR+K  IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  387  RDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQER  446

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+NRW+K+L +PRVTHE+RS W+SY +QADRSLGQK+ASRLN+RP++
Sbjct  447  FLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  493



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AE++P P RI+TG+RD+C+IEKENNFKQPG+RYRSW+PDRQ+R
Sbjct  386  RDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PRVTHEI + WISY +QAD+SLG+K+ASRLN+RPTM
Sbjct  446  FICRWINALSDPRVTHEIHTIWISYWSQADKSLGEKIASRLNVRPTM  492



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AE++P P R++ G+RD+C+I+KENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRFDPCRHAEQYPIPPRVLNGKRDRCIIQKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LSEPRVTHEIR+ W+SY +QAD+SLGQK+ASRLN++PTM
Sbjct  446  FICRWVDALSEPRVTHEIRTIWLSYWSQADKSLGQKLASRLNVKPTM  492



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            R+EEV+YFPS++D  R+AER+P P +I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  REEEVNYFPSRYDPVRHAERYPIPPQICTGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN++P+M
Sbjct  446  FIKRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVKPSM  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE FP P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F++RWV  LSEPRVTHEIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  446  FLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI KENNFKQ G+RYRSWAPDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            +IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE FP P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F++RWV  LSEPRVTHEIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  446  FLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>emb|CAA10286.1| catalase [Cicer arietinum]
Length=125

 Score =   166 bits (421),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D  R+AERFPTP   ++G+R++C+  KENNFKQPG+RYR+WAPDRQDR
Sbjct  19   RDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDR  78

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F  RW+++LS+PRVTHE+RS WISY +QADRSLGQK+AS LN+RP++
Sbjct  79   FARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  125



>dbj|BAD94702.1| catalase [Arabidopsis thaliana]
Length=108

 Score =   166 bits (419),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+R
Sbjct  2    RDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQER  61

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  62   FIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  108



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD+ R+AE+FP P  ++ G+RD+C+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PRVT EIRS WISY TQAD+SLGQK+AS LN+RP+M
Sbjct  446  FIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPSM  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER+P P  I+ G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERYPIPSNILYGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS++   R+AE FP P  I+TG+RDKCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVDYFPSRYQPARHAETFPIPSNIITGKRDKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F++RWV  LSEPRVT+EIRS WISY +QADRS GQK+A+RLN+RP++
Sbjct  446  FLHRWVDVLSEPRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+R
Sbjct  238  RDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQER  297

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+ASRLN+RP++
Sbjct  298  FICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPSI  344



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI KENNFKQ G+RYRSWAPDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            +IN+WV+SLS+PR THEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  446  YINKWVESLSDPRATHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AER P P  ++TG+RD+C+IEKENNFKQPG+RYR++APDRQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAERHPIPPPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PRVTHEIRS WISY TQAD+SLGQK+ASRLN+RPTM
Sbjct  446  FVCRWVDALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D +R+AERFP P  + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LSEPRVTHE+RS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  446  FVCRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPSI  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE FP P  I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDR
Sbjct  202  RDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDR  261

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRL++RP +
Sbjct  262  FNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPNI  308



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D +R+AERFP P  + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LSEPRVTHE+RS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  446  FVRRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPSV  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AERFP+P  I +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAERFPSPPAICSGRREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV++LS+ R THEIRS WISY +QAD+SLGQK+ASRLN+RP+ 
Sbjct  446  FLKRWVEALSDKRCTHEIRSIWISYWSQADKSLGQKLASRLNVRPSF  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD+ R+AE+FP P  ++ G+RD+C+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  478  RDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQER  537

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PRVT EIRS WISY TQAD+SLGQK+AS LN+RP+M
Sbjct  538  FIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPSM  584



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE FP P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F++RWV +LS+PRVT+EIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  446  FLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AERFP P RI+TGRR+KCVI KENNFKQPG+RYRSW P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPSRILTGRREKCVIHKENNFKQPGERYRSWDPNRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PRVTHEI+S WISY +Q D+SLGQK+A+RLN++P M
Sbjct  446  FIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGQKIATRLNVKPCM  492



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE FP P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F++RWV +LS+PRVT+EIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  446  FLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS++D  R+AER P P  I++GRR+KCVIEKENNFKQPGDRYRSW PDRQ+R
Sbjct  155  RDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQER  214

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ R V +LS+PR+THEIRS W+SY +Q D+SLGQK+ASRLN+RP  
Sbjct  215  FLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKLASRLNVRPNF  261



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER P P  +++G+RDKCVI+KENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERHPIPPPVLSGKRDKCVIQKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+ RVTHEIRS WISY +QAD+SLGQK+A+RLN+RPTM
Sbjct  446  FICRWVDALSDARVTHEIRSIWISYWSQADKSLGQKIATRLNVRPTM  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+R
Sbjct  386  RDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FICRWVEALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FVCRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   171 bits (434),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR
Sbjct  277  RDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDR  336

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            ++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  337  YVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  383



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   168 bits (426),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS++D  R+AER P P  I++GRR+KCVIEKENNFKQPGDRYRSW PDRQ+R
Sbjct  164  RDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQER  223

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ R V +LS+PR+THEIRS W+SY +Q D+SLGQK+ASRLN+RP  
Sbjct  224  FLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKLASRLNVRPNF  270



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ SRLN+RP++
Sbjct  446  FIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ SRLN+RP++
Sbjct  446  FIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AERFP P RI TG+R+KCVIEKENNFKQPG+RYRS+ PDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPPRICTGKREKCVIEKENNFKQPGERYRSFDPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW  +LS+PRVTHEIRS WISY +QAD+SLGQK+A+RLN++P+M
Sbjct  446  FIKRWFDALSDPRVTHEIRSIWISYWSQADKSLGQKLATRLNVKPSM  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++YFPSKFD  R+AER+P P +IVTG+R++ +IEKENNFKQ G+RYRSWAPDRQ+R
Sbjct  386  RDEEINYFPSKFDPVRHAERYPIPSQIVTGKRERVIIEKENNFKQAGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FINRW+K+LSEPRVTHE RS WISY TQAD+S+GQK+AS L+ RP+M
Sbjct  446  FINRWIKALSEPRVTHEHRSIWISYWTQADKSIGQKLASSLSARPSM  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AERFP P  +VTGRR+K +I KENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPSSVVTGRREKSIINKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F++RWV +LS+PRVTHEIR  WISY +Q D+SLGQK+A+RLN++PTM
Sbjct  446  FVHRWVDALSDPRVTHEIRDIWISYWSQCDKSLGQKIATRLNVKPTM  492



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PR THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FICRWVDALSDPRATHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER+P P  I TG R++C IEKENNFKQPG+RYRS+APDRQDR
Sbjct  386  RDEEVNYFPSRYDPVRHAERYPIPPAICTGSRERCAIEKENNFKQPGERYRSFAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PRVTHEIRSTWISY +QADRSLGQK+AS LN+RP++
Sbjct  446  FVRRWVDALSDPRVTHEIRSTWISYWSQADRSLGQKIASHLNLRPSI  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE FP P  ++TGRR+KCVI KENNFKQPG+RYRSWAPDRQ R
Sbjct  386  RDEEVNYFPSRYDPVRHAETFPIPSCVLTGRREKCVIHKENNFKQPGERYRSWAPDRQGR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PRVT+EIRS WISY +Q DRSLGQK+A+RLN++P+M
Sbjct  446  FICRWVEALSDPRVTYEIRSIWISYWSQCDRSLGQKIATRLNVKPSM  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+R
Sbjct  386  RDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++ S+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FICRWVEAFSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI KENNFKQ G+RYR+W PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            +IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLLVKPTM  492



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  446  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  446  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            ++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  446  YVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            ++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  446  YVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>gb|AFK46618.1| unknown [Lotus japonicus]
Length=112

 Score =   162 bits (409),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER+P P  I TG R++C +EKEN+FKQPG+RYRS+APDRQDR
Sbjct  6    RDEEVNYFPSRYDPVRHAERYPIPPAICTGSRERCAVEKENDFKQPGERYRSFAPDRQDR  65

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PRVTHEIRS WISY +QADRS GQK+A  LN+ P++
Sbjct  66   FVRRWVDALSDPRVTHEIRSAWISYWSQADRSFGQKIAFHLNLGPSI  112



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D+ R+AE FP P  I +GRR+KC IEKENNFKQ G+R+RSWAPDRQDR
Sbjct  386  RDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  446  FIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            ++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  446  YVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D+ R+AE FP P  I +GRR+KC IEKENNFKQ G+R+RSWAPDRQDR
Sbjct  386  RDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  446  FIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P +  TG R KCVI+KENNFKQPGDRYRSWAPDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPVPSKSYTGIRTKCVIKKENNFKQPGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  446  FIKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER P P RI+ G+R+KC+IEKENNFKQPG+RYRSWA DRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMIEKENNFKQPGERYRSWASDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LSEPRVTHEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  446  FLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+R
Sbjct  386  RDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+ASRLN+RP++
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPSI  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPSKF N  NAE+FP P RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+R
Sbjct  185  RDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKACIEKENNFKLPGDRYRSWAPDRQER  244

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI R V  LS+PRVT EIRS W+SY +QAD+SLGQK+ASRLN+RP +
Sbjct  245  FIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQKIASRLNVRPNI  291



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D +R+AER+P P  +++G+R K  IEKENNFKQPGDRYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+THEIRS W+SY +QAD+SLGQK+AS LN+RPTM
Sbjct  446  FIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKLASHLNVRPTM  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D +R+AER+P P  +++G+R K  IEKENNFKQPGDRYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+THEIRS W+SY +QAD+SLGQK+ASRLN+RP M
Sbjct  446  FIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKLASRLNVRPAM  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AERFP P  I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDR
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS L+ RP +
Sbjct  446  FARRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSTRPNI  492



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE+ P P  I  G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEQHPIPSAIFNGKREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER+P P  + TG+R++CVI+KENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVIDKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QADRS+GQK+AS LN+RP++
Sbjct  446  FIRRWVNALSDPRVTHEIRSIWISYWSQADRSVGQKLASHLNMRPSI  492



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  446  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   166 bits (420),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AERFP P   + G+RD+  IEKENNFKQPG++YRS+ PDRQ+R
Sbjct  159  RDEEVNYFPSRYDPCRHAERFPHPPVALNGKRDRICIEKENNFKQPGEKYRSFPPDRQER  218

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PR+THEIRS W+SY TQAD+SLGQK+ASRLNIRPTM
Sbjct  219  FIKRWVDALSDPRLTHEIRSIWVSYWTQADKSLGQKLASRLNIRPTM  265



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDR
Sbjct  394  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  453

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  454  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  500



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  446  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  446  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDR
Sbjct  271  RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  330

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  331  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  377



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDR
Sbjct  437  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  496

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  497  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  543



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++YFPS++D  R+AERFP P  + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEINYFPSRYDPVRHAERFPIPPAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WI+Y +QA +SLGQK+ASRLN++P +
Sbjct  446  FICRWVDALSDPRVTHEIRSIWITYWSQACKSLGQKLASRLNVKPNI  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE FP P  I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDR
Sbjct  386  RDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRL++RP +
Sbjct  446  FNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPNI  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+Y PS+FD  R+AERFP P  + TGRR+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYLPSRFDPVRHAERFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F +RWV++LS+PRVTHEI S WISY TQ D+ LGQK+A+RLN+RP++
Sbjct  446  FTHRWVEALSDPRVTHEICSIWISYWTQCDKFLGQKLATRLNVRPSI  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER+P P  I+TGRR+KC+I KENNFKQPG+RYRS+APDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERYPIPPAILTGRREKCIIPKENNFKQPGERYRSFAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVT+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIQRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++   R+AE FP P  I+TG+RDKCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYQPARHAETFPIPSSIITGKRDKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F++RWV  LSE RVT+EIRS WISY +QADRS GQK+A+RLN+RP++
Sbjct  446  FLHRWVDVLSESRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   172 bits (435),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDR
Sbjct  450  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  509

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  510  FVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  556



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   167 bits (424),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD +R+AER+P P  + +G+R++C+IEKENNFK+PG+RYRSW PDRQ+R
Sbjct  238  RDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQER  297

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+ RVTHEIRS WISY +QADRSLGQK+AS LN+RP++
Sbjct  298  FVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI  344



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER P P RI+TGRR+KCVI+KENNFKQPG+RYRSW PDRQ R
Sbjct  386  RDEEVNYFPSRYDPVRHAERCPIPSRILTGRREKCVIQKENNFKQPGERYRSWDPDRQGR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PRVTHEI+S WISY +Q D+SLG+K+A+RLN++P+M
Sbjct  446  FIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGRKIATRLNVKPSM  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+Y PS+ D  R+AE++P P R++TG+R+K +IEKENNFKQPG+ YRSWAPDRQ+R
Sbjct  386  RDEEVNYLPSRLDPCRHAEQYPIPPRVLTGKREKVIIEKENNFKQPGEHYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PR THEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  446  FLCRWVDALSDPRATHEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D  R++ERFP P  I +GRRDKCVIEKENNF+QPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRCDPVRHSERFPIPSTICSGRRDKCVIEKENNFEQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+NR V  LS+PR+THE+RS WISY TQ DRSLGQK+A RLN+RP++
Sbjct  446  FLNRMVGCLSDPRITHELRSIWISYWTQCDRSLGQKLAFRLNVRPSI  492



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACJ73905.1| CAT1 [Solanum nigrum]
Length=168

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE +P P ++ +G+R+KC+I+KENNFKQ G+RYR++ PDRQ+R
Sbjct  62   RDEEIDYFPSRYDQVRHAEIYPIPSKVCSGKREKCIIQKENNFKQAGERYRTFTPDRQER  121

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  122  FVRRWVEPLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  168



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS+FD  R+AE FP P  I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+R
Sbjct  386  RDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  253
            FINRWV++LS+PRVT+EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  446  FINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS+FD  R+AE FP P  I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+R
Sbjct  386  RDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  253
            FINRWV++LS+PRVT+EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  446  FINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R+AE++P P R++ GRR+ CVIEKENNFKQ G+RYRSW PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRHAEQYPIPSRVLNGRREMCVIEKENNFKQAGERYRSWEPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            ++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  446  YVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+R
Sbjct  385  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQER  444

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  445  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AER P P R++TGRR++ VIEKENNFKQP +RYRSWAPDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAERHPIPTRVLTGRRERRVIEKENNFKQPVERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PR+THEIRS WISY +QAD+SLGQK+A RLN+RPTM
Sbjct  446  FVRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKIAFRLNVRPTM  492



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDR
Sbjct  352  RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  411

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  412  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  458



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AER+P P  + TG+R++CVI+KENNFK+PG+RYRSW PDRQ+R
Sbjct  386  RDEEVNYFPSRFDPARHAERYPHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QADRS+GQK+AS LN+RP++
Sbjct  446  FIRRWVDALSDPRVTHEIRSIWISYWSQADRSVGQKLASHLNVRPSI  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI KENNFKQPG+RYRS+ PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVILKENNFKQPGERYRSFTPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWVEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPSCVLNGRRTNCVIPKENNFKQAGERYRSWEPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            +IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+R
Sbjct  386  RDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+AS LN+RP++
Sbjct  446  FICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASLLNVRPSI  492



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKAPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  446  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  446  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  446  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D TR++E +P P  +++G+R+K  IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPTRHSEMYPIPPVVLSGKREKRCIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RPTM
Sbjct  446  FIRRWVEALSDPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER+P P  I +GRR++C+IEKENNFKQPG+RYRS+ PDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERYPIPPVICSGRRERCIIEKENNFKQPGERYRSFTPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKLASRLNVRPSI  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+T+EIR+ WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWVEALSDPRITYEIRTIWISYWSQADKSLGQKLASRLNVRPSI  492



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS++D  R+AE+FP P   + GRRD+ +IEKENNFKQPGD YR+WAPDRQ+R
Sbjct  386  RDEEVDYFPSRYDTARHAEKFPIPPVNLIGRRDRRIIEKENNFKQPGDLYRTWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+  LS+P+VTHE+RS WISYL+QADRSLGQKVAS LN+RP++
Sbjct  446  FIRRWIGVLSDPKVTHEVRSIWISYLSQADRSLGQKVASHLNMRPSI  492



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  385  RDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQER  444

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNI  259
            FI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+
Sbjct  445  FICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  487



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQPG+RYRS+ PDRQ+R
Sbjct  379  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGERYRSFTPDRQER  438

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  FIRRWVETLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  485



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE+FP P RI+ G R+KC I+KENNFKQPG++YRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEQFPIPPRILNGGREKCCIQKENNFKQPGEKYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PRVTHEIR+ WI+Y +Q D+ LGQK+ASRLNI+PT+
Sbjct  446  FIKRWIDALSDPRVTHEIRTIWITYWSQCDKFLGQKLASRLNIKPTL  492



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS++D  R+AERFP P R++TG+R+KC+I KENNFKQPG+RYRS++PDRQ+R
Sbjct  386  RDEEVDYFPSRYDPVRHAERFPIPTRVLTGKREKCMISKENNFKQPGERYRSFSPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+P+VTHEIRS WISY +Q D+SL QK+A+RL+++P+M
Sbjct  446  FIRRWVEALSDPKVTHEIRSIWISYWSQCDKSLSQKLATRLSVKPSM  492



>ref|XP_010692544.1| PREDICTED: catalase-like [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS+FD  R AERFP P  I+ GRR+K +I KENNFK+PG RYRSW P RQDR
Sbjct  386  RDEEIDYFPSRFDPLREAERFPIPTAIIHGRREKQIIPKENNFKEPGVRYRSWDPARQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ R+VK+LS+PR+T+EIRS W+SYLTQAD+SLG KVASRLNIRPTM
Sbjct  446  FVGRFVKALSDPRLTYEIRSIWVSYLTQADKSLGMKVASRLNIRPTM  492



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE+ P P  +++G+RD+C IEKENNFKQPG+RYR+++PDRQ+R
Sbjct  386  RDEEVNYFPSRYDPCRHAEKHPIPPVVLSGKRDRCCIEKENNFKQPGERYRTFSPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RPTM
Sbjct  446  FIRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPSK+D TR+AER P P  ++TGRRD+ VIEKE+NFKQ GDRYRSWAPDRQ+R
Sbjct  386  RDEEVDYFPSKYDPTRHAERHPIPNAVITGRRDRRVIEKEDNFKQAGDRYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PR+T EIRS W+SY +QAD+S GQK+ASRLN+RPTM
Sbjct  446  FLRRWVDALSDPRLTLEIRSIWVSYWSQADKSFGQKLASRLNVRPTM  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE FP P  + +G+R++C+IEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  344  RDEEVNYFPSRYDPVRHAESFPIPPAVCSGKRERCIIEKENNFKQPGERYRSWAPDRQER  403

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNI  259
            FI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+
Sbjct  404  FICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  446



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+AP+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+AP+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++P P  ++ GRR+KC+I KENNFKQPG+RYRS++PDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPIPPVVLNGRREKCMIAKENNFKQPGERYRSFSPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+NRW+ SLS+PRVTHEIR+ W++Y  QAD+SLGQK+ASRLN+RP M
Sbjct  446  FLNRWISSLSDPRVTHEIRAIWVTYWYQADKSLGQKLASRLNVRPNM  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  446  FICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+R
Sbjct  406  RDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQER  465

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  466  FICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  512



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE+FP P  + +GRR+K  IEKENNFKQ G+R+RSWAPDRQDR
Sbjct  386  RDEEVNYFPSRYDPVRHAEKFPIPPAVFSGRREKIAIEKENNFKQAGERFRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  446  FIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  446  FICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE+FP P  +++G+R K VIEKENNFKQPGDRYRSWAPDRQ+R
Sbjct  407  RDEEVNYFPSRYDPCRHAEKFPIPPVVLSGQRVKTVIEKENNFKQPGDRYRSWAPDRQER  466

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+T EIRS W+SY TQAD+SLGQK+ASRLN+RP M
Sbjct  467  FIRRWIDALSDPRLTAEIRSIWVSYWTQADKSLGQKLASRLNVRPAM  513



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER P P RI+ G+R+KC+IEKENNFKQPG+RYRSWA DRQ+R
Sbjct  327  RDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMIEKENNFKQPGERYRSWASDRQER  386

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLN  262
            F+ RWV +LSEPRVTHEIRS WISY +QADRSLGQK+AS LN
Sbjct  387  FLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKIASHLN  428



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P    TG R KCVI+KENNFKQ GDRYRSWAPDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  446  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPSKF N  NAE+FP P RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+R
Sbjct  381  RDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKACIEKENNFKLPGDRYRSWAPDRQER  440

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI R V  LS+PRVT EIRS W+SY +QAD+SLGQK+ASRLN+RP +
Sbjct  441  FIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQKIASRLNVRPNI  487



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER+P P  + TG+R++CVI+KENNFK+PG+RYRSW PDRQ+R
Sbjct  386  RDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WI+Y +QADRS+GQK+AS LN+RP++
Sbjct  446  FIRRWVDALSDPRVTHEIRSIWITYWSQADRSVGQKLASHLNVRPSI  492



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  374  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQER  433

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  434  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  480



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE+ P P RI+ G+R+KC+IEKENNFKQPG+RYRSW  DRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKVPVPPRILGGKREKCMIEKENNFKQPGERYRSWPSDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  446  FVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            R+EEV+YFPS++D  R+AER+P P  I TGRR++ VI+KENNFKQPG+RYRS++PDRQ+R
Sbjct  386  REEEVNYFPSRYDPVRHAERYPIPSAICTGRRERTVIDKENNFKQPGERYRSFSPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  446  FIKRWVNALSDPRVTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQ GDRYRS+ PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQAGDRYRSFTPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD +R+AER+P P  + +G+R++C+IEKENNFK+PG+RYRSW PDRQ+R
Sbjct  386  RDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+ RVTHEIRS WISY +QADRSLGQK+AS LN+RP++
Sbjct  446  FVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            +IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIQRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D  RNAE FP P  I +G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRCDPARNAESFPVPSAICSGKREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+NR V  LS+PR+THE+R+ WISY  Q D+SLGQK+A+RLN++P++
Sbjct  446  FLNRLVGGLSDPRITHELRTIWISYWIQCDKSLGQKLATRLNVKPSI  492



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR
Sbjct  383  RDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDR  442

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            ++++WV+ LS+PRVT+EIRS WI  L+QAD+S GQKVASRL ++PTM
Sbjct  443  YVSKWVEHLSDPRVTYEIRSIWICSLSQADKSCGQKVASRLTLKPTM  489



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D  R+AE++P P R++TG+R+K +IEKENNFKQPG+ YRSWAP RQ+R
Sbjct  386  RDEEVNYFPSRLDPCRHAEQYPIPPRVLTGKREKVIIEKENNFKQPGEHYRSWAPGRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+ R THEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  446  FVCRWVDALSDLRATHEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS+FD  R+A R P P  ++ G+RD+CVI KENNFKQ G+RYRSWAPDRQ+R
Sbjct  386  RDEEVDYFPSRFDPVRHAARHPIPSTVLRGKRDRCVIPKENNFKQAGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV  LS+ RVTHEIRS WISY +QAD+SLGQK+A+RLN+RPTM
Sbjct  446  FICRWVDILSDARVTHEIRSIWISYWSQADKSLGQKMATRLNVRPTM  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++R
Sbjct  384  RDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKER  443

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  444  FVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPSI  490



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNF QPG+RYRS+ PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFNQPGERYRSFTPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  385  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQER  444

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  445  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++R
Sbjct  386  RDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  446  FVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPSI  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYR++ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRTFTPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AERFP P  I+TG+R++ VIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPIPSNILTGKRERRVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI R V +LS+PRV+HEIRS WISY +QAD+SLGQK+A+RLN+RP++
Sbjct  446  FIRRCVDALSDPRVSHEIRSIWISYWSQADKSLGQKIATRLNVRPSI  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  446  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D  R+AERFPTP   ++G+R++C+  KENNFKQPG+RYR+WAPDRQDR
Sbjct  386  RDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F  RW+++LS+PRVTHE+RS WISY +QADRSLGQK+AS LN+RP++
Sbjct  446  FARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D  R+AERFPTP   ++G+R++C+  KENNFKQPG+RYR+WAPDRQDR
Sbjct  387  RDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDR  446

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F  RW+++LS+PRVTHE+RS WISY +QADRSLGQK+AS LN+RP++
Sbjct  447  FARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  493



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACV30589.1| catalase [Carica papaya]
Length=170

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTG-RRDKCVIEKENNFKQPGDRYRSWAPDRQD  391
            RDEEV+Y PSKFD   NAER+P P ++ +  +R+KC+IEK+N+FKQPG+RYR++ PDRQ+
Sbjct  63   RDEEVNYHPSKFDPVTNAERYPIPTKVYSACKREKCIIEKQNDFKQPGERYRTFEPDRQE  122

Query  390  RFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            RFINRWVK+LSEPR+THEIRS WI +L++AD SLG+KVA RLNIRP++
Sbjct  123  RFINRWVKALSEPRITHEIRSIWIDWLSRADESLGRKVAMRLNIRPSI  170



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPSKF N  NAE+FP P RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+R
Sbjct  386  RDEEVDYFPSKFTNVANAEKFPIPSRICSGKREKACIEKENNFKLPGDRYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI R V  LS+PRVT E+RS W+SY +QAD+SLGQK+ASRLN+RP +
Sbjct  446  FIKRVVDGLSDPRVTFELRSIWVSYWSQADKSLGQKIASRLNVRPNI  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE+ P P  +++G+R+KC+I KENNFKQPG+RYRS++ DRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FINRW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE+ P P  +++G+R+KC+I KENNFKQPG+RYRS++ DRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FINRW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD+ R+A ++P P  I +G R KCVIEKENNFKQPGDRYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRFDSVRHAAKYPIPSAICSGERVKCVIEKENNFKQPGDRYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            + NRWV++LS+ RVT EIR  WISYL+Q+D+SLG KVA+RLN+RP+ 
Sbjct  446  YANRWVEALSDARVTDEIRGIWISYLSQSDKSLGMKVANRLNVRPSF  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS+FD  R+AE+FP P +I +G+R+KC+IEKENNFKQPG+RYRS+A DRQ+R
Sbjct  386  RDEEVDYFPSRFDPVRHAEKFPMPPQICSGKREKCMIEKENNFKQPGERYRSFAIDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVTHEI S WISY +Q D+SLGQK+A+ LN++P M
Sbjct  446  FIKRWVDALSDPRVTHEILSIWISYWSQCDKSLGQKLATHLNLKPNM  492



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  371  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQER  430

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  431  FIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  477



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQ GDRYRSWAPDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQAGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIRS WISY +QAD SLGQK+ASRLN+RP++
Sbjct  446  FVKRWVEILSEPRLTHEIRSIWISYWSQADASLGQKLASRLNVRPSI  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER+P P  + +GRR++C+IEKENNFKQPG+RYRS+ PDR++R
Sbjct  386  RDEEVNYFPSRYDPVRHAERYPVPSVVCSGRRERCIIEKENNFKQPGERYRSFTPDRKER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASR+N+RP +
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKLASRMNVRPNI  492



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER P P R + G+R+KC+IEKENNFKQPG+RYRSW  DRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERVPVPPRTLGGKREKCMIEKENNFKQPGERYRSWPSDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  446  FVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>prf||1906388A catalase
Length=492

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENN-FKQPGDRYRSWAPDRQD  391
            RDEEV+YFPS++D  R+AE+FP P  ++TG+R++CVI KENN FKQ GDRYRSWAPDRQD
Sbjct  385  RDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQD  444

Query  390  RFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            RF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASRLN+RP +
Sbjct  445  RFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  446  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENN-FKQPGDRYRSWAPDRQD  391
            RDEEV+YFPS++D  R+AE+FP P  ++TG+R++CVI KENN FKQ GDRYRSWAPDRQD
Sbjct  385  RDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQD  444

Query  390  RFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            RF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASRLN+RP +
Sbjct  445  RFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  379  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQER  438

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  439  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  485



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  492



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+R
Sbjct  370  RDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQER  429

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ +RLN+RP++
Sbjct  430  FVCRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLTARLNVRPSI  476



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I+KENNFKQPG+RYRS+ PDRQ+R
Sbjct  386  RDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRSFTPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+T+EIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS+FD  R+AER P P ++V+G+R++CVIEKENNFKQPGDRYRS+APDRQ+R
Sbjct  386  RDEEVDYFPSRFDPVRHAERCPLPPQLVSGKRERCVIEKENNFKQPGDRYRSFAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ R V +LS+ RVTHEIRS WISY +Q D+SLGQK+A+RLNI+P M
Sbjct  446  FVKRIVDALSDTRVTHEIRSIWISYWSQCDKSLGQKIATRLNIKPHM  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I+KENNFKQPG+RYR++ PDRQ+R
Sbjct  369  RDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQER  428

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  429  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  475



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P +  TG R KCVI+KENNFKQ GDRYRSWAPDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPIPSKSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSE R+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  446  FVKRWVEILSELRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS+FD  R AE++P P  ++ GRR  CVI KENN KQ G+RYRSW  DRQDR
Sbjct  386  RDEEVDYFPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            +IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  I +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAICSGKRERCIIEKENNFKEPGERYRSFTPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+A+RLN+RP++
Sbjct  446  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLANRLNVRPSI  492



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS+FD  R AE++P P  ++ GRR  CVI KENN KQ G+RYRSW  DRQDR
Sbjct  386  RDEEVDYFPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            +IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++P P  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDTVRHAEKYPAPPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++R
Sbjct  370  RDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKER  429

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  430  FVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  476



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNF+QPG+RYRSW  DRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFQQPGERYRSWDADRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  253
            F+ R+V++L+EPRVTHEIRS WISY TQAD+SLGQK+ASRLN+RP
Sbjct  446  FVKRFVEALAEPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  490



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            R+EEVDYFPS+ D  R+AERFP P R+VTG+R+K VI K+N+FKQPG+RYRSWAPDRQ+R
Sbjct  386  RNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKIVIPKQNDFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RW +SL  P+V+HE+RS WI+YLTQ D SLGQKVA+RLN++P+M
Sbjct  446  FVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQKVANRLNVKPSM  492



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            R+EEVDYFPS+ D  R+AERFP P R+VTG+R+K VI K+N+FKQPG+RYRSWAPDRQ+R
Sbjct  386  RNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKTVIPKQNDFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RW +SL  P+V+HE+RS WI+YLTQ D SLGQKVA+RLN++P+M
Sbjct  446  FVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQKVANRLNVKPSM  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++R
Sbjct  386  RDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  446  FVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  492



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++P P  ++TGRR+K VI KENNFKQPG+RYRS+ PDR+DR
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPIPPPVLTGRREKTVIPKENNFKQPGERYRSFTPDRKDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RPTM
Sbjct  446  FIRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKIASHLNMRPTM  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AERFP P    TG+R+KCVIEKENNFKQPG+RYRS+AP+RQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAERFPIPSHTHTGKREKCVIEKENNFKQPGERYRSFAPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PRVTHEI S WISY +Q D+SLGQK+A+RLN++  M
Sbjct  446  FVKRWVAALSDPRVTHEICSIWISYWSQCDKSLGQKIAARLNMKANM  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++R
Sbjct  405  RDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKER  464

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  465  FVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  511



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDR
Sbjct  386  RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV+ LSEPR+THEIR  W SY  +ADRSLGQK+ASRLN+RP++
Sbjct  446  FVKRWVEILSEPRLTHEIRGIWTSYWLKADRSLGQKLASRLNVRPSI  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AE++P P  I +G+R+KC+I+KENNF+QPG+RYRS+APDRQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAEKYPIPTAICSGKREKCIIDKENNFQQPGERYRSFAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVT+EIRS WISY ++AD+SLGQK+ASRL++RP++
Sbjct  446  FIYRWVDALSDPRVTYEIRSIWISYWSKADKSLGQKLASRLSVRPSI  492



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+R
Sbjct  371  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQER  430

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+++LS+PR+THEIRS WISY +QAD++LGQK+AS LN+RP++
Sbjct  431  FIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASHLNVRPSI  477



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+R +R
Sbjct  343  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERLER  402

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  403  FIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  449



>gb|AAR97905.1| catalase [Solanum tuberosum]
Length=492

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            +I +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  446  YITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>emb|CAA85470.1| catalase [Solanum tuberosum]
Length=491

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR
Sbjct  385  RDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDR  444

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            +I +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  445  YITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  491



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS++D  R+AE  P P  ++TGRR+K +I KENNFKQPG+RYRS+APDRQ+R
Sbjct  386  RDEEVDYFPSRYDPVRHAEMHPIPSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PRVT+EIRS WISY +QAD+SLGQK+ASRLNIRP++
Sbjct  446  FICRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRLNIRPSI  492



>sp|P55312.1|CATA2_SOLTU RecName: Full=Catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            +I +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  446  YITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>prf||2104177A catalase
Length=492

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE++P P   ++G+RDKCVIEKENNFKQPG+RYRS++PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  253
            FINR V  LS+PRVTHE+RS W+SY +QAD+SLGQK+ASRLN++P
Sbjct  446  FINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE++P P   ++G+RDKCVIEKENNFKQPG+RYRS++PDRQ+R
Sbjct  386  RDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  253
            FINR V  LS+PRVTHE+RS W+SY +QAD+SLGQK+ASRLN++P
Sbjct  446  FINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDR
Sbjct  425  RDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  484

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  250
            F+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  485  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  530


 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -1

Query  567   RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
             RDEEV+YFPS+ D  R+AE++PT   + +G R+KC I KENNFKQPG+RYRSW  DRQ+R
Sbjct  907   RDEEVNYFPSRLDPVRHAEKYPTTPIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQER  966

Query  387   FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
             F+ R+V++LSEPRVTHEIRS WISY +QAD+SLGQK+A+RLN+RP  
Sbjct  967   FVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRPNF  1013



>gb|AAL00886.1| catalase [Suaeda salsa]
Length=287

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS+FD  R AER P P  I++GRR+K +I KENNFK+PGDRYRSW P RQ+R
Sbjct  181  RDEEIDYFPSRFDPVREAERHPIPTAIISGRREKQIIPKENNFKEPGDRYRSWDPARQER  240

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ R+VK+LS+PR+T+EI S W +YL+QAD+SLG KVASRLN+RPTM
Sbjct  241  FVGRFVKALSDPRLTYEICSIWETYLSQADKSLGMKVASRLNVRPTM  287



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D  R+AER+P   RIVTGRR+KC+IEK+N+FKQPGDRYRSWA DRQ+R
Sbjct  386  RDEEVNYFPSRHDPLRHAERYPINNRIVTGRREKCIIEKQNDFKQPGDRYRSWAHDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV++L+ P+V+HE+RS W+SYL+++D SLGQKVA+RLN++P+M
Sbjct  446  FVRRWVEALAHPKVSHEVRSIWVSYLSKSDVSLGQKVANRLNMKPSM  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE+FP P  I +GRR+K  IEKENNFKQ G+R+RSWAPDRQDR
Sbjct  386  RDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS L++RP +
Sbjct  446  FTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE+FP P  I +GRR+K  IEKENNFKQ G+R+RSWAPDRQDR
Sbjct  386  RDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS L++RP +
Sbjct  446  FTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I+KENNFKQPG+RYR++ PDRQ+R
Sbjct  386  RDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+T+EIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI KENNFKQ G+RYR+W PDRQDR
Sbjct  386  RDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRL  265
            +IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL
Sbjct  446  YINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRL  486



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDY PS+FD  R AE++P P  ++ G R  CV  KENNFKQ G+RYRSW PDRQDR
Sbjct  209  RDEEVDYLPSRFDPCRPAEQYPIPSCVLNGPRTMCVTPKENNFKQAGERYRSWEPDRQDR  268

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            +IN+WV+SLS+PRVTHEI S WISYL+QAD+S GQKVASRL ++P M
Sbjct  269  YINKWVESLSDPRVTHEIPSIWISYLSQADKSCGQKVASRLTVKPPM  315



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AERFP P R++TG+R+KCVI KENNFKQPG+RYRS+ P RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAERFPLPPRVLTGKREKCVIGKENNFKQPGERYRSFDPARQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F++RWV++LS+ RVTHEIR  WI+Y +Q D+SLGQK+A+RLN+RP+M
Sbjct  446  FVHRWVEALSDTRVTHEIRGIWITYWSQCDKSLGQKLATRLNMRPSM  492



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYF S++D  R+AE+ P P  I +GRR+KCVIEKE+NF+QPGDRYRSWAPDRQ+R
Sbjct  386  RDEEVDYFQSRYDPVRHAEKVPIPNAICSGRREKCVIEKEDNFRQPGDRYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ R V +LSEPR+THEIRS W+S+ TQ D+SLGQK+ASRLN+RP +
Sbjct  446  FLCRLVNALSEPRITHEIRSIWVSWWTQCDKSLGQKLASRLNVRPNI  492



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I+KENNF+QPG+RYRS++ DRQ+R
Sbjct  378  RDEEIDYFPSRYDPVRHAENYPIPTTVCSGKREKCIIQKENNFQQPGERYRSFSADRQER  437

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  438  FIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  484



>ref|XP_002510677.1| catalase, putative [Ricinus communis]
 gb|EEF52864.1| catalase, putative [Ricinus communis]
Length=974

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D  RNAE FP P  I +G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  868  RDEEVNYFPSRCDPARNAESFPVPSAICSGKREKCVIEKENNFKQPGERYRSWAPDRQER  927

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+NR V  LS+PR+THE+R+ WISY  Q D+SLGQK+A+RLN++P++
Sbjct  928  FLNRLVGGLSDPRITHELRTIWISYWIQCDKSLGQKLATRLNVKPSI  974


 Score =   161 bits (407),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYF S++D  R+AE+ P P  I +GRR+KCVIEKE+NF+QPGDRYRSWAPDRQ+R
Sbjct  386  RDEEVDYFQSRYDPVRHAEKVPIPNAICSGRREKCVIEKEDNFRQPGDRYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  250
            F+ R V +LSEPR+THEIRS W+S+ TQ D+SLGQK+ASRLN RP+
Sbjct  446  FLCRLVNALSEPRITHEIRSIWVSWWTQCDKSLGQKLASRLNNRPS  491



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++P P  + +G+R++CVI KENNFK+PG+RYRS+ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS++D  R+AER P P  I +GRR+KCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVDYFPSRYDPVRHAERSPIPNAICSGRREKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ R V +LSEPR+T EIRS W+SY ++ D SLGQK+ASRLN+RP +
Sbjct  446  FLCRLVNALSEPRITFEIRSIWVSYWSKCDASLGQKLASRLNVRPNI  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++P P  + +G+R++CVI KENNFK+PG+RYRS+ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQD  391
            RDEEV+YFPS++D  R+AE+FP P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+
Sbjct  385  RDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQE  444

Query  390  RFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            RF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASR+N+RP++
Sbjct  445  RFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPSI  492



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AERFP P    +G R+KCVIEKENNFKQPG+RYRS+ PDRQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PRVTHEI S WISY +Q+D+SLGQK+A+RLN++  M
Sbjct  446  FVKRWVAALSDPRVTHEICSIWISYWSQSDKSLGQKIAARLNMKANM  492



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AER P P  +++G+RD+  IEKENNFK+PG R+RSWA DRQ+R
Sbjct  386  RDEEVNYFPSRYDPCRHAERHPIPPVVLSGKRDRICIEKENNFKEPGVRFRSWATDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PR+THEIR  WISY TQAD+SLGQK+ASRLN+RPTM
Sbjct  446  FIRRWVDALSDPRLTHEIRGIWISYWTQADKSLGQKLASRLNVRPTM  492



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYFPSKFD  R AE++P   ++ TG+R+K VI KENNFKQPGDRYRSW P RQ+R
Sbjct  386  RDEEIDYFPSKFDPARQAEKYPILTKVYTGKREKTVIPKENNFKQPGDRYRSWDPARQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV  LS+PRVT E+RS W+SYL+Q DRSLG KVA+RLN+RPTM
Sbjct  446  FVKRWVDVLSDPRVTLELRSIWVSYLSQCDRSLGMKVATRLNMRPTM  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE+ P P  + +G+R+KC+I KENNFKQPG+RYRS++ DRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKHPIPSTVYSGKREKCIIGKENNFKQPGERYRSFSADRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FINRW+ +LS+ RVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FINRWIDALSDSRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE++Y+PSKFD  R AE+ P P    TG R KCVI+KENNFKQ GDRYRSWAPDRQDR
Sbjct  393  RDEEINYYPSKFDPVRCAEKAPIPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDR  452

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  250
            F+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  453  FVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  498


 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D  R+AE++PT   + TG R+KC I KENNF+QPG+RYRSW  DRQ+R
Sbjct  875  RDEEVNYFPSRLDPVRHAEKYPTTPIVCTGNREKCFIGKENNFQQPGERYRSWDSDRQER  934

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ R+V++LSEPRVTHEIRS WISY +QAD+SLGQK+A+RLN+RP  
Sbjct  935  FVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRPNF  981



>gb|AHF27432.1| catalase, partial [Cucurbita maxima]
Length=461

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQD  391
            RDEEV+YFPS++D  R+AE++P P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+
Sbjct  354  RDEEVNYFPSRYDACRHAEKYPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQE  413

Query  390  RFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            RF+NR+V++LS+ +VTHE+R+ WISY TQADRSLGQK+ASR+N RP M
Sbjct  414  RFVNRFVEALSDSKVTHEVRNIWISYWTQADRSLGQKIASRMNARPNM  461



>gb|AHF27429.1| catalase, partial [Cucurbita moschata]
Length=461

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQD  391
            RDEEV+YFPS++D  R+AE++P P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+
Sbjct  354  RDEEVNYFPSRYDACRHAEKYPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQE  413

Query  390  RFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            RF+NR+V++LS+ +VTHE+R+ WISY TQADRSLGQK+ASR+N RP M
Sbjct  414  RFVNRFVEALSDSKVTHEVRNIWISYWTQADRSLGQKIASRMNARPNM  461



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENN-FKQPGDRYRSWAPDRQD  391
            RDEEV+YFPS++D  R+AE+FP P  ++TG+R++CVI KENN FKQ GDRYRSWAPDRQD
Sbjct  385  RDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQD  444

Query  390  RFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            RF+ R+V++LS+PRVT E+R+ WISY +QADRSLGQK+ASRLN+RP +
Sbjct  445  RFVKRFVEALSDPRVTDEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD+ R+A ++P P  + +G R KCVIEKENNFKQPG+RYRSWAPDRQ+R
Sbjct  386  RDEEVNYFPSRFDSVRHAAKYPIPSAVCSGERIKCVIEKENNFKQPGERYRSWAPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            +  RWV++LS+ RVT EIR  WISYL+Q+D+SLG KVA+RLN+RP+ 
Sbjct  446  YAKRWVEALSDARVTDEIRGVWISYLSQSDKSLGMKVANRLNVRPSF  492



>ref|XP_004144240.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
Length=483

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQD  391
            RDEEV+YFPS++D  R+AE+FP P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+
Sbjct  376  RDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQE  435

Query  390  RFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            RF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASR+N+RP +
Sbjct  436  RFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPNI  483



>gb|AAZ29552.1| catalase-C [Oryza sativa Indica Group]
Length=500

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS++D  ++A R+P P   +TGRR+K VI KENNFKQPG+RYRSW P RQDR
Sbjct  394  RDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDR  453

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  454  FIKRWIDALSGPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  500



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQD  391
            RDEEV+YFPS++D  R+AE+FP P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+
Sbjct  385  RDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQE  444

Query  390  RFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            RF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASR+N+RP +
Sbjct  445  RFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPNI  492



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQD  391
            RDEEV+YFPS++D  R+AE+FP P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+
Sbjct  385  RDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQE  444

Query  390  RFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            RF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASR+N+RP +
Sbjct  445  RFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPNI  492



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS++D  ++A R+P P   +TGRR+K VI KENNFKQPG+RYRSW P RQDR
Sbjct  386  RDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  446  FIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS++D  ++A R+P P   +TGRR+K VI KENNFKQPG+RYRSW P RQDR
Sbjct  386  RDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  446  FIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RD+EVDYFPS++D  R+AER+P P  ++ G RD+ +I+KENNFKQPG+RYRSW P RQ+R
Sbjct  386  RDDEVDYFPSRYDPVRHAERYPIPPNVLNGNRDRQIIQKENNFKQPGERYRSWDPARQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PR+THEIR+ WISY +QAD+S+G K+ASRLN+RPTM
Sbjct  446  FICRWVDALSDPRITHEIRNIWISYWSQADKSVGMKLASRLNVRPTM  492



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEVDYFPS++D  ++A R+P P   +TGRR+K VI KENNFKQPG+RYRSW P RQDR
Sbjct  386  RDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  446  FIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEE+DYF S++D  R+AER+P P  I++GRR+KCVI KENNFKQPG+RYRSW PDRQ+R
Sbjct  386  RDEEIDYFQSRYDPVRHAERYPIPNAIISGRREKCVIPKENNFKQPGERYRSWTPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ R V +LS+PR+THEIR  W+SY +Q D+SLGQK+ASRLN+RP +
Sbjct  446  FLCRLVNALSDPRITHEIRGIWVSYWSQCDQSLGQKLASRLNVRPNI  492



>sp|P48351.1|CATA2_CUCPE RecName: Full=Catalase isozyme 2 [Cucurbita pepo]
 dbj|BAA09507.1| catalase [Cucurbita pepo]
Length=492

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQD  391
            RDEEV+YFPS++D  R+AE++P P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+
Sbjct  385  RDEEVNYFPSRYDACRHAEKYPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQE  444

Query  390  RFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            RF+NR+V++LS+ +VTHE+R+ WISY TQADRSLGQK+ASR+N RP M
Sbjct  445  RFVNRFVEALSDSKVTHEVRNIWISYWTQADRSLGQKIASRMNARPNM  492



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+A++ P P    +GRR+K  IEKENNFKQPG+RYRSW PDRQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHADKVPIPSVPFSGRREKVSIEKENNFKQPGERYRSWDPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PR+T EIRS WISY TQAD+SLGQK+ASRLN+RPTM
Sbjct  446  FIRRWVDALSDPRLTQEIRSIWISYWTQADKSLGQKLASRLNVRPTM  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 97/111 (87%), Gaps = 4/111 (4%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPD----  400
            RDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG RYRS+ PD    
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGGRYRSFTPDSFDF  445

Query  399  RQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  446  RQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  496



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE++P P  + +G R++CVI KENNFK+PG+RYRS+ P+RQ+R
Sbjct  386  RDEEVNYFPSRYDPVRHAEKYPAPPAVCSGTRERCVIAKENNFKEPGERYRSFPPERQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  446  FICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+ D   +AER+P P  + TG+R++CVIEKENNFKQPG+RYRSW  DRQ+R
Sbjct  386  RDEEVNYFPSRIDPAHHAERYPQPPAVYTGKRERCVIEKENNFKQPGERYRSWPADRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIR  256
            F+ RWV +LS+PRVTHEIR+ WISY +QAD+SLGQK+ASRLN++
Sbjct  446  FVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGQKLASRLNVK  489



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+++  R+AE++PTP  +  G+R++CVIEKENNFK+PG+RYR + P+RQ+R
Sbjct  374  RDEEVNYFPSRYNPVRHAEKYPTPPAVCAGKRERCVIEKENNFKEPGERYRYFPPERQER  433

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  434  FIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASHLNVRPNI  480



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI KENNFKQ G+RYRS+ P RQDR
Sbjct  386  RDEEVNYFPSRFDAARHAEKVPVPPRVLTGCREKCVINKENNFKQAGERYRSFDPARQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  446  FIQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS++D  R+AE+ P P RI++G+R+KC+I KENNFKQPG+RYRS+ PDR++R
Sbjct  386  RDEEVNYFPSRYDPARHAEQHPIPPRILSGKREKCIILKENNFKQPGERYRSFTPDRKER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV++L++ R+T+EIRS WISY +QAD+SLGQK+AS LN+RPTM
Sbjct  446  FIRRWVEALTDTRITYEIRSIWISYWSQADKSLGQKLASHLNMRPTM  492



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AER P P  ++TGRRD+C+++KENNFKQPG+RYRS++ DRQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAERHPLPPPMLTGRRDRCMVQKENNFKQPGERYRSFSTDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI+R V +LS+PRVTHEIRS WISY TQA +SLGQK+ASRLN++P++
Sbjct  446  FISRLVDALSDPRVTHEIRSIWISYWTQACKSLGQKLASRLNVKPSI  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD TR+AE++P P R+++G R+KC+I+KENNFKQ G+RYRS+ P RQDR
Sbjct  196  RDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDR  255

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +L++ RVTHEI+S W+SY +Q D SLGQK+ASRL I+P M
Sbjct  256  FLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPNM  302



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDR
Sbjct  247  RDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDR  306

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            FI RWV +L++PRVTHE R+ WISY +Q D +LGQK+ASRLN++P+M
Sbjct  307  FIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPSM  353



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AERFP P    +G R+KCVIEKENNFKQPG+RYRS+ PDRQ+R
Sbjct  386  RDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQER  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PRVTHEI S WI Y +Q+D+SLGQK+A+RLN++  M
Sbjct  446  FVKRWVAALSDPRVTHEICSIWIFYWSQSDKSLGQKIAARLNMKANM  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -1

Query  567  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  388
            RDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI+KENNFKQ G+RYRS+ P RQDR
Sbjct  386  RDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDR  445

Query  387  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  247
            F+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  446  FLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960