BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF043H11

Length=578
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786522.1|  PREDICTED: NADPH--cytochrome P450 reductase        149   4e-38   Nicotiana sylvestris
gb|AAZ39648.1|  cytochrome P450 NADPH-reductase                         148   6e-38   Petunia x hybrida [garden petunia]
ref|XP_009630023.1|  PREDICTED: NADPH--cytochrome P450 reductase        148   6e-38   Nicotiana tomentosiformis
ref|XP_006338052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    147   2e-37   Solanum tuberosum [potatoes]
ref|XP_004238001.1|  PREDICTED: NADPH--cytochrome P450 reductase        147   2e-37   Solanum lycopersicum
dbj|BAC41516.1|  NADPH-cytochrome P-450 reductase                       145   4e-37   Ophiorrhiza pumila
gb|ACF17649.1|  putative cytochrome reductase                           145   8e-37   Capsicum annuum
gb|ADI49691.1|  cytochrome P450 reductase                               144   2e-36   Withania somnifera [ashwagandha]
gb|AAS92623.1|  NADPH:cytochrome P450-reductase                         144   2e-36   Centaurium erythraea
ref|XP_006433816.1|  hypothetical protein CICLE_v10000469mg             143   3e-36   Citrus clementina [clementine]
gb|KDO81193.1|  hypothetical protein CISIN_1g005496mg                   143   4e-36   Citrus sinensis [apfelsine]
ref|XP_006472452.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    143   4e-36   Citrus sinensis [apfelsine]
emb|CDP11509.1|  unnamed protein product                                143   5e-36   Coffea canephora [robusta coffee]
ref|XP_009791726.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    142   7e-36   Nicotiana sylvestris
gb|KDO81195.1|  hypothetical protein CISIN_1g005496mg                   140   9e-36   Citrus sinensis [apfelsine]
ref|XP_003526551.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    142   9e-36   Glycine max [soybeans]
ref|XP_008219251.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    141   3e-35   
emb|CAC27143.1|  NADPH-cytochrome P450 reductase                        134   3e-35   Picea abies
ref|XP_010277516.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    140   4e-35   
gb|KDO81194.1|  hypothetical protein CISIN_1g005496mg                   139   5e-35   Citrus sinensis [apfelsine]
ref|XP_007226979.1|  hypothetical protein PRUPE_ppa002280mg             140   7e-35   Prunus persica
ref|XP_008219252.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    140   7e-35   Prunus mume [ume]
ref|NP_001236742.1|  NADPH:P450 reductase                               139   8e-35   
gb|KHN39959.1|  NADPH--cytochrome P450 reductase                        139   8e-35   Glycine soja [wild soybean]
ref|XP_010439016.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    139   8e-35   Camelina sativa [gold-of-pleasure]
ref|XP_007141274.1|  hypothetical protein PHAVU_008G182200g             139   9e-35   Phaseolus vulgaris [French bean]
ref|XP_010433757.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    139   9e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010086660.1|  NADPH--cytochrome P450 reductase                   139   1e-34   Morus notabilis
sp|P37116.1|NCPR_VIGRR  RecName: Full=NADPH--cytochrome P450 redu...    139   1e-34   Vigna radiata var. radiata [golden gram]
pir||A47298  NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung...    139   1e-34
ref|XP_009138145.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    139   1e-34   Brassica rapa
emb|CDY34288.1|  BnaA01g13910D                                          139   1e-34   Brassica napus [oilseed rape]
gb|EYU36460.1|  hypothetical protein MIMGU_mgv1a002296mg                139   1e-34   Erythranthe guttata [common monkey flower]
emb|CDY03447.1|  BnaC01g16350D                                          139   1e-34   
ref|XP_010277515.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    139   1e-34   Nelumbo nucifera [Indian lotus]
gb|AAT76449.1|  NADPH:cytochrome P450 reductase                         139   1e-34   Taxus cuspidata [ichii]
gb|AAX59902.1|  cytochrome P450 reductase                               139   2e-34   Taxus wallichiana var. chinensis [Chinese yew]
ref|XP_009137450.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    139   2e-34   Brassica rapa
ref|XP_010448554.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_003602898.1|  NADPH cytochrome P450 reductase                    138   3e-34   Medicago truncatula
ref|XP_010692385.1|  PREDICTED: NADPH--cytochrome P450 reductase        138   3e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009137451.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   3e-34   Brassica rapa
gb|AIG15452.1|  NADPH-cytochrome P450 reductase 2                       138   3e-34   Azadirachta indica [Indian-lilac]
ref|XP_003522768.1|  PREDICTED: NADPH--cytochrome P450 reductase        137   4e-34   Glycine max [soybeans]
ref|XP_006413419.1|  hypothetical protein EUTSA_v10024568mg             137   4e-34   Eutrema salsugineum [saltwater cress]
emb|CDY11017.1|  BnaA03g46760D                                          137   5e-34   Brassica napus [oilseed rape]
ref|XP_007136327.1|  hypothetical protein PHAVU_009G036200g             137   7e-34   Phaseolus vulgaris [French bean]
gb|KHG05124.1|  NADPH--cytochrome P450 reductase                        137   9e-34   Gossypium arboreum [tree cotton]
ref|XP_002867662.1|  hypothetical protein ARALYDRAFT_492391             137   1e-33   
gb|ACN54323.1|  NADPH:cytochrome P450 reductase                         136   1e-33   Gossypium hirsutum [American cotton]
ref|XP_004299743.1|  PREDICTED: NADPH--cytochrome P450 reductase        136   1e-33   Fragaria vesca subsp. vesca
gb|KJB58863.1|  hypothetical protein B456_009G229300                    136   1e-33   Gossypium raimondii
emb|CDX92639.1|  BnaC07g38970D                                          136   1e-33   
gb|KJB58865.1|  hypothetical protein B456_009G229300                    136   1e-33   Gossypium raimondii
gb|ABK92896.1|  unknown                                                 129   1e-33   Populus trichocarpa [western balsam poplar]
emb|CDY34287.1|  BnaA01g13900D                                          136   2e-33   Brassica napus [oilseed rape]
ref|NP_001190823.1|  NADPH--cytochrome P450 reductase 1                 136   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194183.1|  NADPH--cytochrome P450 reductase 1                    136   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AHB33949.1|  cytochrome P450 reductase                               136   2e-33   Santalum album
gb|AIG15451.1|  NADPH-cytochrome P450 reductase 1                       136   2e-33   Azadirachta indica [Indian-lilac]
gb|ACF35281.1|  cytochrome P450 reductase-like protein                  136   2e-33   Nothapodytes nimmoniana
gb|AIL29328.1|  cytochrome P450 reductase                               136   2e-33   Pinus contorta
ref|XP_009138137.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    135   2e-33   Brassica rapa
ref|XP_004501654.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    135   2e-33   Cicer arietinum [garbanzo]
ref|XP_002265859.2|  PREDICTED: NADPH--cytochrome P450 reductase        135   2e-33   Vitis vinifera
emb|CAA46814.1|  NADPH-ferrihemoprotein reductase                       135   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008338958.1|  PREDICTED: NADPH--cytochrome P450 reductase        135   3e-33   Malus domestica [apple tree]
ref|XP_002514049.1|  cytochrome P450, putative                          135   3e-33   Ricinus communis
emb|CAA89837.3|  NADPH-cytochrome P450 reductase                        135   3e-33   Pseudotsuga menziesii
emb|CAA81211.1|  NADPH-ferrihemoprotein reductase                       134   5e-33   Vicia sativa [spring vetch]
ref|XP_009376208.1|  PREDICTED: NADPH--cytochrome P450 reductase        134   6e-33   Pyrus x bretschneideri [bai li]
ref|XP_010254555.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    134   7e-33   Nelumbo nucifera [Indian lotus]
ref|XP_011069915.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    134   8e-33   Sesamum indicum [beniseed]
ref|XP_009414761.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    134   9e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008391625.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    134   1e-32   Malus domestica [apple tree]
emb|CCO62220.1|  putative cytochrome P450 reductase                     133   1e-32   Actaea racemosa
ref|XP_007018236.1|  NADPH--cytochrome P450 reductase isoform 3         134   1e-32   
ref|XP_002307336.1|  NADPH-cytochrome P450 oxydoreductase isoform...    133   1e-32   
ref|XP_007018235.1|  P450 reductase 1 isoform 2                         131   2e-32   
ref|XP_004165700.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    131   2e-32   
ref|XP_009385909.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    133   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008453604.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      133   2e-32   Cucumis melo [Oriental melon]
ref|XP_004507858.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    133   2e-32   Cicer arietinum [garbanzo]
ref|XP_010520739.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    133   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_006386427.1|  hypothetical protein POPTR_0002s10680g             131   3e-32   
ref|XP_004146317.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    133   3e-32   Cucumis sativus [cucumbers]
gb|KDP41487.1|  hypothetical protein JCGZ_15894                         132   3e-32   Jatropha curcas
ref|XP_010530279.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    132   3e-32   Tarenaya hassleriana [spider flower]
ref|XP_007018234.1|  P450 reductase 1 isoform 1                         132   3e-32   
ref|XP_010928663.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    132   3e-32   Elaeis guineensis
emb|CAN77401.1|  hypothetical protein VITISV_027794                     133   3e-32   Vitis vinifera
ref|NP_001131393.1|  uncharacterized protein LOC100192720               127   4e-32   
ref|NP_001136741.1|  uncharacterized protein LOC100216882               127   4e-32   
ref|XP_010046982.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    132   4e-32   Eucalyptus grandis [rose gum]
gb|AEW43314.1|  NADPH cytochrome P450 reductase                         132   4e-32   Picrorhiza kurrooa
ref|XP_008789667.1|  PREDICTED: NADPH--cytochrome P450 reductase        132   5e-32   Phoenix dactylifera
ref|XP_008383106.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    132   5e-32   Malus domestica [apple tree]
ref|XP_006661531.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    131   5e-32   
ref|XP_008383105.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    132   5e-32   Malus domestica [apple tree]
ref|XP_008781895.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    132   5e-32   Phoenix dactylifera
ref|XP_007227446.1|  hypothetical protein PRUPE_ppa002142mg             132   6e-32   Prunus persica
emb|CBI17838.3|  unnamed protein product                                131   6e-32   Vitis vinifera
ref|XP_008223694.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      132   6e-32   Prunus mume [ume]
gb|KJB14707.1|  hypothetical protein B456_002G138900                    131   7e-32   Gossypium raimondii
ref|XP_006381796.1|  putative NADPH-cytochrome P450 reductase fam...    131   8e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002270732.2|  PREDICTED: NADPH--cytochrome P450 reductase        131   9e-32   Vitis vinifera
gb|AGX85599.1|  NADPH:cytochrome P450 reductase                         131   1e-31   Scoparia dulcis [escobilla]
emb|CAC83301.1|  cytochrome P450 reductase                              131   1e-31   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004296434.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      130   2e-31   Fragaria vesca subsp. vesca
ref|XP_010265447.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    130   2e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006285937.1|  hypothetical protein CARUB_v10007449mg             130   2e-31   Capsella rubella
gb|ACF35280.1|  cytochrome P450 reductase-like protein                  130   2e-31   Nothapodytes nimmoniana
gb|EEE61817.1|  hypothetical protein OsJ_16444                          130   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AGL46979.1|  cytochrome P450 reductase                               130   2e-31   Salvia miltiorrhiza [Chinese salvia]
ref|XP_011015338.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    130   2e-31   Populus euphratica
ref|XP_011043963.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    130   2e-31   Populus euphratica
ref|XP_004960247.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    130   2e-31   Setaria italica
emb|CDP02981.1|  unnamed protein product                                130   2e-31   Coffea canephora [robusta coffee]
ref|XP_010048643.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    130   2e-31   Eucalyptus grandis [rose gum]
gb|KJB53794.1|  hypothetical protein B456_009G005600                    130   2e-31   Gossypium raimondii
ref|XP_002462826.1|  hypothetical protein SORBIDRAFT_02g032640          130   2e-31   Sorghum bicolor [broomcorn]
dbj|BAG68945.1|  cytochrome P450 reductase                              130   2e-31   Lotus japonicus
gb|KJB53797.1|  hypothetical protein B456_009G005600                    130   2e-31   Gossypium raimondii
ref|XP_007014268.1|  P450 reductase 2                                   130   2e-31   
gb|AAK15261.1|AF302498_1  NADPH-cytochrome P450 oxydoreductase is...    130   3e-31   Populus trichocarpa x Populus deltoides
emb|CAE01547.2|  OSJNBb0022F16.2                                        130   3e-31   Oryza sativa Japonica Group [Japonica rice]
gb|ACP43317.1|  NADPH cytochrome P450 reductase                         123   3e-31   Citrus maxima [buntan]
ref|NP_001063914.1|  Os09g0558900                                       129   4e-31   
gb|ADC94831.1|  cytochrome P450 reductase                               129   5e-31   Perilla frutescens [beefsteak-mint]
gb|KHG09184.1|  NADPH--cytochrome P450 reductase                        129   5e-31   Gossypium arboreum [tree cotton]
ref|XP_010259920.1|  PREDICTED: NADPH--cytochrome P450 reductase        129   5e-31   Nelumbo nucifera [Indian lotus]
ref|XP_011010331.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    129   5e-31   Populus euphratica
ref|XP_009795589.1|  PREDICTED: NADPH--cytochrome P450 reductase        129   5e-31   Nicotiana sylvestris
ref|XP_010525727.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      129   5e-31   Tarenaya hassleriana [spider flower]
gb|AEA86315.1|  NADPH-cytochrome P450 reductase                         121   6e-31   Solanum nigrum
gb|AHA50098.1|  CYP450 reductase                                        129   6e-31   Panax ginseng [Asiatic ginseng]
gb|ACN54324.1|  NADPH:cytochrome P450 reductase                         129   6e-31   Gossypium hirsutum [American cotton]
gb|EMT14573.1|  NADPH--cytochrome P450 reductase                        129   6e-31   
gb|ABR25415.1|  NADPH-cytochrome p450 reductase                         119   7e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_009607226.1|  PREDICTED: NADPH--cytochrome P450 reductase        129   7e-31   Nicotiana tomentosiformis
ref|XP_003541616.1|  PREDICTED: NADPH--cytochrome P450 reductase        129   7e-31   Glycine max [soybeans]
gb|EYU42400.1|  hypothetical protein MIMGU_mgv1a002170mg                129   7e-31   Erythranthe guttata [common monkey flower]
ref|XP_002444097.1|  hypothetical protein SORBIDRAFT_07g007640          129   8e-31   Sorghum bicolor [broomcorn]
ref|XP_006372089.1|  hypothetical protein POPTR_0018s09980g             126   9e-31   
gb|EPS73891.1|  hypothetical protein M569_00858                         128   1e-30   Genlisea aurea
ref|XP_002324469.1|  putative NADPH-cytochrome P450 reductase fam...    128   1e-30   Populus trichocarpa [western balsam poplar]
gb|KHN22700.1|  NADPH--cytochrome P450 reductase                        128   1e-30   Glycine soja [wild soybean]
ref|XP_004148333.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    128   1e-30   Cucumis sativus [cucumbers]
gb|KHN17598.1|  NADPH--cytochrome P450 reductase                        128   1e-30   Glycine soja [wild soybean]
ref|XP_011079296.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    128   1e-30   Sesamum indicum [beniseed]
ref|XP_004168364.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    128   1e-30   
ref|NP_001159331.1|  uncharacterized protein LOC100304425               128   1e-30   Zea mays [maize]
ref|XP_002447240.1|  hypothetical protein SORBIDRAFT_06g031110          128   1e-30   Sorghum bicolor [broomcorn]
ref|XP_003549436.1|  PREDICTED: NADPH--cytochrome P450 reductase        128   1e-30   Glycine max [soybeans]
gb|ACG27711.1|  NADPH--cytochrome P450 reductase                        128   1e-30   Zea mays [maize]
gb|AAZ39649.1|  cytochrome P450 NADPH-reductase                         128   1e-30   Petunia x hybrida [garden petunia]
ref|XP_008661364.1|  PREDICTED: uncharacterized protein LOC100192...    128   1e-30   
ref|XP_010093854.1|  NADPH--cytochrome P450 reductase                   128   1e-30   Morus notabilis
ref|XP_004242931.1|  PREDICTED: NADPH--cytochrome P450 reductase        128   1e-30   Solanum lycopersicum
ref|XP_008676669.1|  PREDICTED: uncharacterized protein LOC100216...    128   1e-30   
ref|XP_006653834.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    127   2e-30   Oryza brachyantha
dbj|BAD05443.1|  putative cytochrome P450 reductase                     126   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579401.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    127   2e-30   Brachypodium distachyon [annual false brome]
gb|AAC09468.2|  putative NADPH-cytochrome P450 reductase                127   2e-30   Pisum sativum [garden pea]
ref|NP_001061346.1|  Os08g0243500                                       127   2e-30   
ref|XP_010914150.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    127   2e-30   Elaeis guineensis
emb|CAA81209.1|  NADPH-ferrihemoprotein reductase                       127   2e-30   Helianthus tuberosus [Jerusalem artichoke]
dbj|BAJ41269.1|  NADPH-P450 reductase 2                                 127   2e-30   Zingiber officinale [ginger]
gb|EEE68301.1|  hypothetical protein OsJ_26563                          127   2e-30   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ97446.1|  predicted protein                                      122   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008653023.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    127   2e-30   Zea mays [maize]
ref|XP_009382841.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    127   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006453369.1|  hypothetical protein CICLE_v10007535mg             127   3e-30   
gb|KDO43871.1|  hypothetical protein CISIN_1g005072mg                   127   3e-30   Citrus sinensis [apfelsine]
gb|KDO43870.1|  hypothetical protein CISIN_1g005072mg                   127   3e-30   Citrus sinensis [apfelsine]
gb|KDO43876.1|  hypothetical protein CISIN_1g005072mg                   125   3e-30   Citrus sinensis [apfelsine]
gb|AIC73829.1|  cytochrome P450 reductase                               127   3e-30   Panax ginseng [Asiatic ginseng]
ref|XP_006453370.1|  hypothetical protein CICLE_v10007535mg             127   3e-30   
gb|KDO43868.1|  hypothetical protein CISIN_1g005072mg                   127   3e-30   Citrus sinensis [apfelsine]
emb|CDY28169.1|  BnaA01g06800D                                          127   4e-30   Brassica napus [oilseed rape]
ref|XP_010913661.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    127   4e-30   Elaeis guineensis
gb|KDO43869.1|  hypothetical protein CISIN_1g005072mg                   127   4e-30   Citrus sinensis [apfelsine]
gb|EAZ10065.1|  hypothetical protein OsI_32371                          127   4e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_006474186.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    127   4e-30   Citrus sinensis [apfelsine]
gb|AAC05022.1|  NADPH:ferrihemoprotein oxidoreductase                   126   4e-30   Eschscholzia californica
gb|ABC47946.1|  cytochrome P450 reductase                               126   5e-30   Artemisia annua [sweet Annie]
ref|XP_006474185.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    126   5e-30   Citrus sinensis [apfelsine]
ref|XP_007154761.1|  hypothetical protein PHAVU_003G145400g             126   5e-30   Phaseolus vulgaris [French bean]
ref|XP_006659239.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    125   5e-30   
ref|XP_009108997.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      126   5e-30   Brassica rapa
gb|ABI98819.1|  cytochrome P450 reductase                               126   5e-30   Artemisia annua [sweet Annie]
gb|ABM88789.1|  cytochrome P450 reductase                               126   5e-30   Artemisia annua [sweet Annie]
gb|AAK56276.1|AF367288_1  AT4g30210/F9N11_60                            123   5e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDY14183.1|  BnaA08g13140D                                          126   5e-30   Brassica napus [oilseed rape]
gb|AHB33950.1|  cytochrome P450 reductase                               126   5e-30   Santalum album
ref|XP_010447753.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    124   6e-30   Camelina sativa [gold-of-pleasure]
gb|AFW59699.1|  hypothetical protein ZEAMMB73_961001                    124   6e-30   
gb|AGC92176.1|  cytochrome P450 oxidoreductase                          126   6e-30   Ocimum basilicum [basil]
gb|ABL09938.1|  cytochrome P450 reductase                               126   6e-30   Artemisia annua [sweet Annie]
gb|EMS66177.1|  NADPH--cytochrome P450 reductase                        125   8e-30   Triticum urartu
gb|ABB88839.2|  NADPH cytochrome P450 reductase                         125   8e-30   Stevia rebaudiana
gb|AHM95445.1|  cytochrome P450 reductase                               125   9e-30   Matricaria chamomilla var. recutita [German chamomile]
ref|XP_003610109.1|  NADPH cytochrome P450 reductase                    125   1e-29   Medicago truncatula
ref|XP_006283224.1|  hypothetical protein CARUB_v10004254mg             125   1e-29   Capsella rubella
gb|AGO03799.1|  cytochrome P450-like protein                            125   1e-29   Tanacetum cinerariifolium [pyrethrum]
ref|XP_009408053.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    125   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO43874.1|  hypothetical protein CISIN_1g005072mg                   124   1e-29   Citrus sinensis [apfelsine]
gb|KDO43875.1|  hypothetical protein CISIN_1g005072mg                   124   1e-29   Citrus sinensis [apfelsine]
ref|XP_010234513.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    125   1e-29   Brachypodium distachyon [annual false brome]
ref|XP_003610110.1|  NADPH cytochrome P450 reductase                    123   1e-29   
ref|XP_009130253.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    125   1e-29   Brassica rapa
ref|XP_009384791.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    125   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY03543.1|  BnaC03g68020D                                          125   1e-29   
emb|CDX68634.1|  BnaC01g08190D                                          125   1e-29   
ref|XP_008667833.1|  PREDICTED: uncharacterized protein LOC100279...    125   1e-29   Zea mays [maize]
emb|CBX24555.1|  NADPH:cytochrome P450 reductase                        125   1e-29   Salvia miltiorrhiza [Chinese salvia]
ref|XP_008667834.1|  PREDICTED: uncharacterized protein LOC100279...    125   2e-29   
gb|KDP36395.1|  hypothetical protein JCGZ_08664                         125   2e-29   Jatropha curcas
gb|AFO64618.1|  cytochrome P450 reductase                               125   2e-29   Artemisia annua [sweet Annie]
ref|XP_004957625.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    124   2e-29   Setaria italica
gb|EPS66345.1|  hypothetical protein M569_08425                         124   2e-29   Genlisea aurea
ref|XP_010548619.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    124   2e-29   Tarenaya hassleriana [spider flower]
gb|AAC05021.1|  NADPH:ferrihemoprotein oxidoreductase                   124   3e-29   Papaver somniferum
ref|XP_006412733.1|  hypothetical protein EUTSA_v10024546mg             124   3e-29   Eutrema salsugineum [saltwater cress]
dbj|BAJ33878.1|  unnamed protein product                                124   3e-29   Eutrema halophilum
emb|CDX72222.1|  BnaC07g42440D                                          124   3e-29   
emb|CAA81210.1|  NADPH-ferrihemoprotein reductase                       122   3e-29   Helianthus tuberosus [Jerusalem artichoke]
emb|CDY51656.1|  BnaAnng10960D                                          124   3e-29   Brassica napus [oilseed rape]
gb|AAS00459.1|  NADPH:cytochrome P450-reductase                         124   3e-29   Hypericum androsaemum
sp|Q05001.1|NCPR_CATRO  RecName: Full=NADPH--cytochrome P450 redu...    124   3e-29   Catharanthus roseus [chatas]
ref|XP_010929254.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    124   4e-29   Elaeis guineensis
ref|XP_010447751.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    124   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010438203.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      124   5e-29   Camelina sativa [gold-of-pleasure]
gb|AAS90127.1|  NADPH cytochrome P450 reductase                         123   6e-29   Ammi majus [ameo mayor]
gb|AAB97736.1|  NADPH cytochrome P450 reductase                         123   7e-29   Petroselinum crispum
gb|EEE70211.1|  hypothetical protein OsJ_30318                          123   9e-29   Oryza sativa Japonica Group [Japonica rice]
emb|CAA46815.1|  NADPH-ferrihemoprotein reductase                       123   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194750.1|  NADPH--cytochrome P450 reductase 2                    122   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849472.2|  NADPH--cytochrome P450 reductase 2                    122   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb|ADG29353.1|  cytochrome P450 reductase                               122   1e-28   Withania somnifera [ashwagandha]
gb|EYU20907.1|  hypothetical protein MIMGU_mgv1a002097mg                122   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_002984697.1|  hypothetical protein SELMODRAFT_234596             122   1e-28   
dbj|BAJ99370.1|  predicted protein                                      122   1e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB22140.1|  hypothetical protein B456_004G0316002                   120   1e-28   Gossypium raimondii
gb|AAG17471.1|AF123610_10  NADPH-cytochrome P450 reductase              122   1e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003578634.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    122   2e-28   Brachypodium distachyon [annual false brome]
ref|XP_010433014.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    122   2e-28   Camelina sativa [gold-of-pleasure]
gb|KFK29577.1|  nadph-ferrihemoprotein reductase                        122   2e-28   Arabis alpina [alpine rockcress]
ref|XP_002978784.1|  hypothetical protein SELMODRAFT_152770             121   2e-28   
emb|CAQ37789.1|  NADPH:cytochrome P450 reductase                        122   2e-28   Plectranthus scutellarioides
ref|XP_006845640.1|  hypothetical protein AMTR_s00019p00222550          122   2e-28   
ref|XP_010523339.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    119   2e-28   
ref|XP_010688489.1|  PREDICTED: NADPH--cytochrome P450 reductase        122   2e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|AIO11759.1|  cytochrome p450 reductase                               122   2e-28   Croton stellatopilosus
gb|EPS67504.1|  hypothetical protein M569_07270                         121   3e-28   Genlisea aurea
ref|XP_004973052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    121   3e-28   Setaria italica
ref|XP_002869386.1|  hypothetical protein ARALYDRAFT_913457             121   4e-28   Arabidopsis lyrata subsp. lyrata
gb|AAB97737.1|  NADPH cytochrome P450 reductase                         121   4e-28   Petroselinum crispum
ref|XP_010523336.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    118   4e-28   
ref|XP_010523337.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    118   5e-28   
ref|XP_010523335.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    118   6e-28   
ref|XP_001779575.1|  predicted protein                                  120   7e-28   
ref|XP_010523334.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    118   7e-28   
ref|XP_001770150.1|  predicted protein                                  119   7e-28   
gb|ACF83106.1|  unknown                                                 110   7e-28   Zea mays [maize]
gb|KHG21257.1|  NADPH--cytochrome P450 reductase                        119   2e-27   Gossypium arboreum [tree cotton]
ref|XP_011016946.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    117   9e-27   Populus euphratica
ref|XP_001758838.1|  predicted protein                                  117   9e-27   
ref|XP_001785882.1|  predicted protein                                  117   1e-26   
ref|XP_010526342.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    116   2e-26   Tarenaya hassleriana [spider flower]
dbj|BAJ41268.1|  NADPH-P450 reductase 1                                 115   5e-26   Zingiber officinale [ginger]
gb|EMT19472.1|  NADPH--cytochrome P450 reductase                        107   2e-23   
gb|EMS53484.1|  NADPH--cytochrome P450 reductase                        107   2e-23   Triticum urartu
ref|XP_008451695.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    104   2e-22   
ref|XP_002986144.1|  hypothetical protein SELMODRAFT_157822             103   4e-22   
ref|XP_002984958.1|  hypothetical protein SELMODRAFT_181373             100   6e-21   
gb|KDO81196.1|  hypothetical protein CISIN_1g005496mg                 96.7    1e-19   Citrus sinensis [apfelsine]
ref|XP_004960246.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  93.6    2e-18   
ref|XP_004501653.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  92.0    6e-18   
gb|KJB14708.1|  hypothetical protein B456_002G138900                  91.7    6e-18   
ref|XP_005846436.1|  hypothetical protein CHLNCDRAFT_36035            91.7    7e-18   
ref|XP_002534464.1|  cytochrome P450, putative                        90.5    2e-17   
ref|XP_004507857.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  90.1    3e-17   
gb|KCW80968.1|  hypothetical protein EUGRSUZ_C02330                   89.4    4e-17   
ref|XP_008808352.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  84.0    1e-16   
gb|KJB22141.1|  hypothetical protein B456_004G0316002                 85.5    2e-16   
gb|EFA83496.1|  NADPH-cytochrome-P450 oxidoreductase                  86.7    3e-16   
ref|XP_008680517.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  81.6    6e-16   
gb|EPY30731.1|  NADPH-ferrihemoprotein reductase                      85.9    7e-16   
ref|XP_002953937.1|  hypothetical protein VOLCADRAFT_76078            85.5    9e-16   
gb|EPY26135.1|  NADPH-ferrihemoprotein reductase                      85.1    1e-15   
ref|XP_003673078.1|  hypothetical protein NCAS_0A01270                84.7    2e-15   
ref|XP_828830.1|  NADPH--cytochrome P450 reductase                    84.0    3e-15   
ref|XP_808628.1|  P450 reductase                                      80.5    4e-15   
ref|XP_828912.1|  NADPH--cytochrome P450 reductase                    83.2    6e-15   
gb|KIZ02441.1|  NADPH-cytochrome P450 reductase                       82.8    6e-15   
ref|XP_003849625.1|  hypothetical protein MYCGRDRAFT_75805            82.8    7e-15   
emb|CBH17742.1|  NADPH--cytochrome p450 reductase, putative           82.4    9e-15   
ref|XP_009051974.1|  hypothetical protein LOTGIDRAFT_187717           82.4    9e-15   
ref|XP_001690130.1|  NADPH-cytochrome P450 reductase                  82.4    1e-14   
gb|AFW62956.1|  hypothetical protein ZEAMMB73_744602                  81.6    1e-14   
gb|KDD72489.1|  hypothetical protein H632_c3282p1                     77.4    1e-14   
ref|XP_004343008.1|  NADPH-cytochrome P450 reductase                  81.6    2e-14   
emb|CBH17836.1|  NADPH--cytochrome p450 reductase, putative           81.6    2e-14   
gb|AAP37031.1|  P450 reductase                                        81.3    2e-14   
ref|XP_964443.1|  NADPH-cytochrome P450 reductase                     81.3    2e-14   
ref|XP_009849280.1|  NADPH-cytochrome P450 reductase                  81.3    2e-14   
ref|XP_007680859.1|  hypothetical protein BAUCODRAFT_28100            81.3    2e-14   
gb|EKG06329.1|  P450 reductase, putative                              81.3    2e-14   
gb|KJE97834.1|  NADPH-cytochrome P450 reductase, variant              80.9    3e-14   
gb|ACF35282.1|  cytochrome P450 reductase-like protein                80.9    3e-14   
emb|CCD15772.1|  unnamed protein product                              78.2    3e-14   
ref|XP_809820.1|  P450 reductase                                      80.9    3e-14   
gb|ABJ09679.1|  cytochrome P450 reductase C                           80.9    3e-14   
ref|XP_003646578.1|  hypothetical protein Ecym_4744                   80.9    3e-14   
ref|XP_011427038.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  80.9    4e-14   
gb|EPY33847.1|  NADPH-ferrihemoprotein reductase                      80.5    4e-14   
gb|KIN00315.1|  hypothetical protein OIDMADRAFT_123965                80.5    5e-14   
emb|CCD14870.1|  unnamed protein product                              80.1    5e-14   
dbj|GAN06318.1|  cytochrome P450 oxidoreductase                       80.1    5e-14   
gb|EPB88240.1|  hypothetical protein HMPREF1544_04948                 80.1    6e-14   
emb|CCC11787.1|  unnamed protein product                              80.1    6e-14   
ref|XP_007931123.1|  hypothetical protein MYCFIDRAFT_157570           80.1    6e-14   
ref|XP_001910174.1|  hypothetical protein                             80.1    6e-14   
ref|XP_009658187.1|  NADPH-cytochrome P450 reductase                  80.1    6e-14   
ref|XP_002960044.1|  hypothetical protein SELMODRAFT_401997           79.7    7e-14   
gb|EEX38010.1|  sulfite reductase [NADPH] flavoprotein alpha-comp...  79.7    8e-14   
ref|WP_040904718.1|  sulfite reductase subunit alpha                  79.7    8e-14   
gb|EMF09667.1|  NADPH cytochrome P450 oxidoreductase                  79.7    9e-14   
ref|XP_011327904.1|  NADPH-cytochrome P450 reductase                  79.7    9e-14   
ref|XP_009252252.1|  hypothetical protein FPSE_00857                  79.7    9e-14   
ref|XP_003715306.1|  NADPH-cytochrome P450 reductase, variant         79.7    9e-14   
gb|EHK43307.1|  hypothetical protein TRIATDRAFT_33220                 79.3    1e-13   
gb|EKF38488.1|  p450 reductase, putative                              79.3    1e-13   
gb|KIL92537.1|  nadph-cytochrome p450 reductase                       79.3    1e-13   
gb|ACE86176.1|  Molybdopterin oxidoreductase Fe4S4 domain family      79.3    1e-13   
ref|XP_002555324.1|  KLTH0G06600p                                     79.0    1e-13   
ref|WP_041552449.1|  reductase                                        79.3    1e-13   
gb|EPY24868.1|  NADPH-ferrihemoprotein reductase                      77.4    2e-13   
ref|XP_006693773.1|  NADPH-cytochrome P450 reductase-like protein     79.0    2e-13   
ref|WP_041356566.1|  sulfite reductase [NADPH] flavoprotein alpha...  78.6    2e-13   
emb|CAD84764.1|  Sulfite reductase flavoprotein subunit               78.6    2e-13   
ref|XP_006962366.1|  NADPH cytochrome P450 oxidoreductase             79.0    2e-13   
emb|CCD52117.1|  hypothetical protein BofuT4_P082760.1                74.7    2e-13   
ref|WP_043986383.1|  FAD-binding protein                              78.2    2e-13   
ref|WP_043391935.1|  FAD-binding protein                              78.2    2e-13   
emb|CCC53435.1|  putative p450 reductase                              78.6    2e-13   
gb|EUA71951.1|  oxidoreductase NAD-binding domain protein             74.3    2e-13   
ref|XP_007733055.1|  NADPH-ferrihemoprotein reductase                 78.6    2e-13   
ref|WP_012800660.1|  FAD-binding domain-containing protein            78.6    2e-13   
emb|CDW58665.1|  NAD binding 1 domain containing protein              74.7    2e-13   
ref|XP_009022160.1|  hypothetical protein HELRODRAFT_113572           78.6    2e-13   
gb|KHN94212.1|  cytochrome P450 oxidoreductase                        78.6    2e-13   
ref|WP_026608753.1|  sulfite reductase [NADPH] flavoprotein alpha...  78.2    2e-13   
ref|WP_021023513.1|  sulfite reductase subunit alpha                  78.2    2e-13   
gb|ENH85424.1|  nadph-cytochrome p450 reductase                       78.2    2e-13   
emb|CDO93668.1|  unnamed protein product                              78.2    2e-13   
gb|EQB57087.1|  hypothetical protein CGLO_02825                       78.2    3e-13   
gb|KID92122.1|  cytochrome P450 oxidoreductase                        78.2    3e-13   
ref|XP_007807687.1|  cytochrome P450 oxidoreductase                   78.2    3e-13   
emb|CEP08857.1|  hypothetical protein                                 78.2    3e-13   
gb|KFA72831.1|  hypothetical protein S40288_08553                     78.2    3e-13   
gb|KEY74237.1|  hypothetical protein S7711_00395                      78.2    3e-13   
ref|WP_036491473.1|  sulfite reductase subunit alpha                  77.8    3e-13   
gb|KEZ41267.1|  NADPH--cytochrome P450 reductase                      78.2    3e-13   
gb|KFG88153.1|  cytochrome P450 oxidoreductase                        78.2    3e-13   
ref|XP_007278117.1|  cytochrome p450 oxidoreductase                   78.2    3e-13   
ref|XP_007822561.1|  Cytochrome P450 CYP505D6                         78.2    3e-13   
ref|WP_017023910.1|  sulfite reductase subunit alpha                  77.8    3e-13   
gb|KIY99765.1|  hypothetical protein MNEG_8195                        77.8    3e-13   
gb|KID79197.1|  cytochrome P450 oxidoreductase                        77.8    3e-13   
emb|CEI90083.1|  Putative NADPH--cytochrome P450 reductase            77.8    3e-13   
ref|WP_006896602.1|  putative nitrate/sulfite reductase               78.6    3e-13   
gb|KIE02214.1|  cytochrome P450 oxidoreductase                        77.8    3e-13   
emb|CEG74525.1|  Putative NADPH--cytochrome P450 reductase            77.8    3e-13   
emb|CDK26973.1|  unnamed protein product                              77.8    3e-13   
ref|XP_001590862.1|  hypothetical protein SS1G_08602                  77.8    3e-13   
gb|AAG23833.1|AF290425_1  NADPH cytochrome P450 oxidoreductase is...  77.8    4e-13   
gb|EKM34013.1|  oxidoreductase NAD-binding domain protein             74.7    4e-13   
gb|KFA61935.1|  hypothetical protein S40285_02840                     77.8    4e-13   
ref|WP_011634260.1|  sulfite reductase subunit alpha                  77.4    4e-13   
ref|WP_004520007.1|  sulfite reductase subunit alpha                  77.4    4e-13   
gb|KDB15590.1|  cytochrome P450 oxidoreductase                        77.4    5e-13   
gb|KIH90124.1|  NADPH-ferrihemoprotein reductase                      77.4    5e-13   
gb|EXL87323.1|  NADPH-cytochrome P450 reductase                       77.4    5e-13   
emb|CCT64101.1|  probable NCP1-NADPH-cytochrome P450 reductase        77.4    5e-13   
gb|EME40620.1|  hypothetical protein DOTSEDRAFT_74237                 77.4    5e-13   
gb|ERS97729.1|  hypothetical protein HMPREF1624_05900                 77.4    5e-13   
gb|EWG45709.1|  NADPH-cytochrome P450 reductase                       77.4    5e-13   
ref|XP_003046613.1|  predicted protein                                77.4    5e-13   
ref|XP_009218896.1|  NADPH-cytochrome P450 reductase                  77.4    5e-13   
ref|XP_003384121.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  76.6    5e-13   
ref|XP_005109645.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  77.0    5e-13   
emb|CCE28101.1|  probable NCP1-NADPH-cytochrome P450 reductase        77.0    6e-13   
emb|CCF32060.1|  NADPH-cytochrome P450 reductase                      77.0    6e-13   
gb|EHK22188.1|  hypothetical protein TRIVIDRAFT_71556                 77.0    6e-13   
emb|CEI85592.1|  Putative NADPH--cytochrome P450 reductase            77.0    6e-13   
ref|XP_007433824.1|  PREDICTED: NADPH--cytochrome P450 reductase      77.0    7e-13   
ref|WP_010119105.1|  oxidoreductase                                   71.2    7e-13   
ref|WP_040518010.1|  reductase                                        77.4    7e-13   
gb|EGD55572.1|  molybdopterin oxidoreductase                          77.4    7e-13   
emb|CEG78819.1|  Putative NADPH--cytochrome P450 reductase            76.6    8e-13   
gb|EIE89541.1|  hypothetical protein RO3G_14252                       76.6    8e-13   
ref|WP_005088242.1|  MULTISPECIES: FAD-binding protein                76.3    9e-13   
ref|WP_005079611.1|  MULTISPECIES: FAD-binding protein                76.3    9e-13   
ref|WP_025239425.1|  FAD-binding protein                              76.3    9e-13   
ref|WP_017207328.1|  FAD-binding protein                              76.3    9e-13   
ref|WP_005093337.1|  FAD-binding protein                              76.3    9e-13   
ref|XP_009177146.1|  hypothetical protein T265_12004                  76.6    9e-13   
ref|WP_005058322.1|  FAD-binding protein                              76.3    9e-13   
ref|XP_001631497.1|  predicted protein                                76.6    9e-13   
ref|WP_016342621.1|  putative NADPH--sulfite reductase flavoprote...  76.3    9e-13   
gb|KEQ88142.1|  cytochrome P450 reductase 1                           76.6    9e-13   
gb|KEQ60063.1|  cytochrome P450 reductase 1                           76.6    9e-13   
ref|XP_002108516.1|  hypothetical protein TRIADDRAFT_63169            76.6    9e-13   
gb|ESZ97734.1|  NADPH-cytochrome P450 reductase                       76.6    1e-12   
ref|XP_007590680.1|  NADPH-cytochrome P450 reductase                  76.6    1e-12   
ref|WP_004410347.1|  sulfite reductase subunit alpha                  76.3    1e-12   
ref|XP_007791948.1|  putative nadph-cytochrome p450 reductase pro...  76.3    1e-12   
gb|KEQ71821.1|  cytochrome P450 reductase 1                           76.3    1e-12   
ref|WP_020475376.1|  hypothetical protein                             75.9    1e-12   
emb|CEJ03087.1|  Putative NADPH--cytochrome P450 reductase            76.3    1e-12   
gb|EKC21191.1|  NADPH--cytochrome P450 reductase                      76.6    1e-12   
gb|EFA80409.1|  NADPH-cytochrome-P450 oxidoreductase                  76.3    1e-12   
ref|WP_003746273.1|  sulfite reductase subunit alpha                  75.9    1e-12   
ref|WP_035205180.1|  sulfite reductase [NADPH] flavoprotein alpha...  75.9    1e-12   
ref|WP_011245473.1|  sulfite reductase subunit alpha                  75.9    1e-12   
ref|XP_003669297.1|  hypothetical protein NDAI_0C03940                76.3    1e-12   
ref|XP_001558194.1|  hypothetical protein BC1G_03226                  76.3    1e-12   
dbj|BAN82201.1|  hypothetical protein                                 75.9    1e-12   
gb|ESA02196.1|  hypothetical protein GLOINDRAFT_337546                76.3    1e-12   
gb|KER00200.1|  hypothetical protein AUEXF2481DRAFT_34398             75.9    1e-12   
ref|WP_003742687.1|  sulfite reductase subunit alpha                  75.9    1e-12   
emb|CEG78818.1|  Putative NADPH--cytochrome P450 reductase            75.9    1e-12   
ref|WP_041018315.1|  hypothetical protein                             74.7    1e-12   
ref|XP_001223868.1|  conserved hypothetical protein                   75.9    1e-12   
gb|EXX70271.1|  Ncp1p                                                 75.9    1e-12   
ref|XP_003660497.1|  hypothetical protein MYCTH_2314176               75.9    2e-12   
ref|XP_004350080.1|  NADPH-cytochrome-P450 oxidoreductase             75.9    2e-12   
ref|WP_024802014.1|  molybdopterin oxidoreductase                     76.3    2e-12   
ref|XP_003677085.1|  hypothetical protein NCAS_0F02460                75.9    2e-12   
ref|XP_002836851.1|  hypothetical protein                             75.9    2e-12   
ref|XP_002612108.1|  hypothetical protein BRAFLDRAFT_288748           75.9    2e-12   
ref|XP_004200529.1|  Piso0_003119                                     75.9    2e-12   
ref|XP_002130153.1|  PREDICTED: NADPH--cytochrome P450 reductase      75.5    2e-12   
dbj|BAF49701.1|  NADPH-P450 reductase                                 75.5    2e-12   
ref|NP_001078953.1|  P450 (cytochrome) oxidoreductase                 75.5    2e-12   
gb|KIV99574.1|  NADPH-cytochrome P450 reductase                       75.5    2e-12   
emb|CDH48577.1|  nadph-cytochrome p450 reductase                      75.5    2e-12   
gb|AAW24759.1|  SJCHGC07242 protein                                   71.2    2e-12   
ref|WP_005597060.1|  sulfite reductase subunit alpha                  75.5    2e-12   
ref|WP_009386357.1|  sulfite reductase subunit alpha                  75.1    2e-12   
ref|WP_016886874.1|  FAD-binding protein                              75.1    2e-12   
gb|AGN32968.1|  P450 reductase                                        75.5    2e-12   
ref|WP_017444920.1|  hypothetical protein                             75.1    2e-12   
ref|XP_007776209.1|  NADPH-cytochrome P450 reductase                  75.5    2e-12   
ref|WP_027695414.1|  sulfite reductase subunit alpha                  75.1    2e-12   
ref|WP_038898120.1|  sulfite reductase subunit alpha                  75.1    2e-12   
ref|WP_033008496.1|  sulfite reductase subunit alpha                  75.1    2e-12   
ref|WP_032802566.1|  sulfite reductase subunit alpha                  75.1    2e-12   
gb|EKM16029.1|  sulfite reductase [NADPH] flavoprotein, alpha-com...  75.1    3e-12   
ref|XP_002507692.1|  predicted protein                                75.1    3e-12   
ref|WP_003803006.1|  NADP oxidoreductase                              75.1    3e-12   
dbj|GAN10969.1|  NADPh-cytochrome p450 reductase protein              75.1    3e-12   
gb|AEX20413.1|  NADPH cytochrome P450 reductase                       75.1    3e-12   
gb|EKM25804.1|  sulfite reductase [NADPH] flavoprotein, alpha-com...  75.1    3e-12   
gb|AIV07111.1|  sulfite reductase subunit alpha                       75.1    3e-12   
ref|WP_033002604.1|  sulfite reductase subunit alpha                  75.1    3e-12   
ref|XP_628906.1|  NADPH-cytochrome-P450 oxidoreductase                75.1    3e-12   
gb|AGN32879.1|  P450 reductase                                        75.1    3e-12   
emb|CBY19304.1|  unnamed protein product                              73.9    3e-12   
ref|XP_008120878.1|  PREDICTED: NADPH--cytochrome P450 reductase      75.1    3e-12   
gb|ABO09628.1|  NADPH cytochrome P450 reductase                       75.1    3e-12   
gb|AEY94530.1|  FAAL121Cp                                             75.1    3e-12   
emb|CDS03498.1|  hypothetical protein LRAMOSA00900                    75.1    3e-12   
dbj|GAE92075.1|  sulfite reductase                                    69.7    3e-12   
ref|NP_982421.1|  AAL121Cp                                            75.1    3e-12   
ref|WP_005068206.1|  FAD-binding protein                              74.7    3e-12   
gb|KDN70201.1|  putative FAD binding domain-containing protein        75.1    3e-12   
gb|AGO09869.1|  AaceriAAL121Cp                                        74.7    3e-12   
gb|EPB87224.1|  hypothetical protein HMPREF1544_05946                 75.1    3e-12   
ref|WP_005099611.1|  FAD-binding protein                              74.7    3e-12   
ref|WP_038209142.1|  sulfite reductase subunit alpha                  74.7    3e-12   
ref|WP_038889595.1|  sulfite reductase subunit alpha                  74.7    4e-12   
ref|WP_033000663.1|  sulfite reductase subunit alpha                  74.7    4e-12   
ref|WP_043991725.1|  sulfite reductase subunit alpha                  74.7    4e-12   
ref|WP_042985037.1|  sulfite reductase subunit alpha                  74.7    4e-12   
gb|EEZ84982.1|  Sulfite reductase [NADPH] flavoprotein alpha-comp...  71.6    4e-12   
emb|CED72425.1|  sulfite reductase [NADPH] flavoprotein alpha-com...  74.7    4e-12   
ref|WP_016891937.1|  FAD-binding protein                              74.3    4e-12   
ref|WP_017011224.1|  sulfite reductase subunit alpha                  74.3    4e-12   
gb|EIE77771.1|  hypothetical protein RO3G_02475                       74.7    4e-12   
ref|XP_007288669.1|  cytochrome P450 oxidoreductase                   74.7    4e-12   
dbj|GAK24691.1|  LOW QUALITY PROTEIN: sulfite reductase               74.3    4e-12   
ref|WP_010443870.1|  sulfite reductase subunit alpha                  74.3    4e-12   
gb|KGR32812.1|  sulfite reductase (NADPH) flavoprotein subunit alpha  74.3    4e-12   
ref|WP_038885622.1|  sulfite reductase subunit alpha                  74.3    4e-12   
gb|ELU49545.1|  sulfite reductase (NADPH) flavoprotein alpha-comp...  74.3    4e-12   
gb|EDP57951.1|  sulfite reductase (NADPH) flavoprotein alpha-comp...  74.3    4e-12   
ref|WP_038896749.1|  sulfite reductase subunit alpha                  74.3    4e-12   



>ref|XP_009786522.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=686

 Score =   149 bits (375),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS VWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQ+KVDS+KAEAI
Sbjct  612  KEYVQHKMLEKASHVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQDKVDSTKAEAI  671

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  672  VKKLQMDGRYLRDVW  686



>gb|AAZ39648.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=687

 Score =   148 bits (374),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 67/75 (89%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS VWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEK DSSKAEA 
Sbjct  613  KEYVQHKMMEKASHVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKADSSKAEAT  672

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  673  VKKLQMDGRYLRDVW  687



>ref|XP_009630023.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=686

 Score =   148 bits (374),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS VWSLISQEGYLYVCGDAKGMARDVHRTLHTI+QEQ+KVDS+KAEAI
Sbjct  612  KEYVQHKMLEKASHVWSLISQEGYLYVCGDAKGMARDVHRTLHTIIQEQDKVDSTKAEAI  671

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  672  VKKLQMDGRYLRDVW  686



>ref|XP_006338052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Solanum tuberosum]
Length=686

 Score =   147 bits (370),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS VWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQE  DSSKAEA+
Sbjct  612  KEYVQHKMMEKASHVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQENADSSKAEAV  671

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  672  VKKLQMDGRYLRDVW  686



>ref|XP_004238001.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=686

 Score =   147 bits (370),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS VWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQE  DSSKAEA+
Sbjct  612  KEYVQHKMMEKASDVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQENADSSKAEAV  671

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  672  VKKLQMDGRYLRDVW  686



>dbj|BAC41516.1| NADPH-cytochrome P-450 reductase [Ophiorrhiza pumila]
Length=690

 Score =   145 bits (367),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 66/75 (88%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+TE+A+Q WSLISQ GYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAEAI
Sbjct  616  KEYVQHKMTEKAAQFWSLISQVGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAEAI  675

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ +GRYLRDVW
Sbjct  676  VKKLQTDGRYLRDVW  690



>gb|ACF17649.1| putative cytochrome reductase [Capsicum annuum]
 gb|AFV95075.1| cytochrome P450 reductase [Capsicum annuum]
Length=686

 Score =   145 bits (365),  Expect = 8e-37, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS+VWSLISQ+GYLYVCGDAKGMARDVHRTLHTIVQEQE  +SSKAEAI
Sbjct  612  KEYVQHKMMEKASEVWSLISQDGYLYVCGDAKGMARDVHRTLHTIVQEQENANSSKAEAI  671

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  672  VKKLQMDGRYLRDVW  686



>gb|ADI49691.1| cytochrome P450 reductase [Withania somnifera]
Length=686

 Score =   144 bits (363),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 65/75 (87%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS VWSLISQEGYLYVCGDAKGMARDVHR LHTIVQEQE  DSSKAEA 
Sbjct  612  KEYVQHKMMEKASHVWSLISQEGYLYVCGDAKGMARDVHRALHTIVQEQENADSSKAEAT  671

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  672  VKKLQMDGRYLRDVW  686



>gb|AAS92623.1| NADPH:cytochrome P450-reductase [Centaurium erythraea]
Length=692

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+++WSL+SQEGYLYVCGDAKGMARDVHR LHTIVQEQEK DSSKAEAI
Sbjct  618  KEYVQHKMMEKAAEIWSLLSQEGYLYVCGDAKGMARDVHRALHTIVQEQEKTDSSKAEAI  677

Query  396  VKKLQMNGRYLRDVW  352
            VK+LQMNGRYLRDVW
Sbjct  678  VKQLQMNGRYLRDVW  692



>ref|XP_006433816.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
 gb|ESR47056.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
Length=694

 Score =   143 bits (361),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+Q+WSL+S+EGYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE+I
Sbjct  620  KEYVQHKMMDKAAQLWSLLSKEGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAESI  679

Query  396  VKKLQMNGRYLRDVW  352
            VKK QM GRYLRDVW
Sbjct  680  VKKFQMEGRYLRDVW  694



>gb|KDO81193.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=694

 Score =   143 bits (360),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+Q+WSL+S+EGYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE+I
Sbjct  620  KEYVQHKMMDKAAQLWSLLSKEGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAESI  679

Query  396  VKKLQMNGRYLRDVW  352
            VKK QM GRYLRDVW
Sbjct  680  VKKFQMEGRYLRDVW  694



>ref|XP_006472452.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Citrus sinensis]
Length=694

 Score =   143 bits (360),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+Q+WSL+S+EGYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE+I
Sbjct  620  KEYVQHKMMDKAAQLWSLLSKEGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAESI  679

Query  396  VKKLQMNGRYLRDVW  352
            VKK QM GRYLRDVW
Sbjct  680  VKKFQMEGRYLRDVW  694



>emb|CDP11509.1| unnamed protein product [Coffea canephora]
Length=691

 Score =   143 bits (360),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            KDYVQHK+ E+A++ WSLISQ+G+LYVCGDAKGMARDVHRTLHTIVQEQEKVDS++AEA+
Sbjct  617  KDYVQHKMIEKAAEFWSLISQKGHLYVCGDAKGMARDVHRTLHTIVQEQEKVDSTEAEAM  676

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  677  VKKLQMDGRYLRDVW  691



>ref|XP_009791726.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nicotiana sylvestris]
Length=686

 Score =   142 bits (359),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 64/75 (85%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS VWSLISQEGYLYVCGDAK MARDVHRTLHTIVQEQ+KVDS+KAEAI
Sbjct  612  KEYVQHKMLEKASHVWSLISQEGYLYVCGDAKEMARDVHRTLHTIVQEQDKVDSTKAEAI  671

Query  396  VKKLQMNGRYLRDVW  352
            +KKLQM+GRYLRD+W
Sbjct  672  MKKLQMDGRYLRDMW  686



>gb|KDO81195.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=429

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+Q+WSL+S+EGYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE+I
Sbjct  355  KEYVQHKMMDKAAQLWSLLSKEGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAESI  414

Query  396  VKKLQMNGRYLRDVW  352
            VKK QM GRYLRDVW
Sbjct  415  VKKFQMEGRYLRDVW  429



>ref|XP_003526551.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Glycine max]
 gb|KHN08988.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score =   142 bits (358),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+Q+WSLISQ GYLYVCGDAKGMARDVHRTLHTIVQ+QE VDS+KAEAI
Sbjct  617  KEYVQHKMMDQAAQLWSLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQENVDSTKAEAI  676

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  677  VKKLQMDGRYLRDVW  691



>ref|XP_008219251.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Prunus 
mume]
Length=728

 Score =   141 bits (356),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ +RA+ +W LISQ GY YVCGDAKGMARDVHRTLHTIVQEQEKVDS+KAEAI
Sbjct  654  KEYVQHKMMDRAAHMWDLISQGGYFYVCGDAKGMARDVHRTLHTIVQEQEKVDSTKAEAI  713

Query  396  VKKLQMNGRYLRDVW  352
            VK+LQM+GRYLRDVW
Sbjct  714  VKQLQMDGRYLRDVW  728



>emb|CAC27143.1| NADPH-cytochrome P450 reductase [Picea abies]
Length=196

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHKITE+AS +W+LISQ GYLYVCGDAKGMARDVHRTLH IVQEQE VDS+ AEA 
Sbjct  122  KEYVQHKITEKASYIWNLISQGGYLYVCGDAKGMARDVHRTLHNIVQEQESVDSTSAEAT  181

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  182  VKKLQTEGRYLRDVW  196



>ref|XP_010277516.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Nelumbo 
nucifera]
Length=651

 Score =   140 bits (352),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A++VW+LIS+ GYLYVCGDAKGMARDVHRTLH+IVQEQE  DSSKAEAI
Sbjct  577  KEYVQHKMMDKATEVWNLISRNGYLYVCGDAKGMARDVHRTLHSIVQEQESTDSSKAEAI  636

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM GRYLRDVW
Sbjct  637  VKKLQMEGRYLRDVW  651



>gb|KDO81194.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=558

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+Q+WSL+S+EGYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE+I
Sbjct  484  KEYVQHKMMDKAAQLWSLLSKEGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAESI  543

Query  396  VKKLQMNGRYLRDVW  352
            VKK QM GRYLRDVW
Sbjct  544  VKKFQMEGRYLRDVW  558



>ref|XP_007226979.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
 gb|EMJ28178.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
Length=692

 Score =   140 bits (352),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ +RA+ +W LISQ GY YVCGDAKGMARDVHRTLHTIVQEQEKVDS+KAEAI
Sbjct  618  KEYVQHKMMDRAAHMWDLISQGGYFYVCGDAKGMARDVHRTLHTIVQEQEKVDSTKAEAI  677

Query  396  VKKLQMNGRYLRDVW  352
            VK+LQM+GRYLRDVW
Sbjct  678  VKQLQMDGRYLRDVW  692



>ref|XP_008219252.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Prunus 
mume]
Length=692

 Score =   140 bits (352),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ +RA+ +W LISQ GY YVCGDAKGMARDVHRTLHTIVQEQEKVDS+KAEAI
Sbjct  618  KEYVQHKMMDRAAHMWDLISQGGYFYVCGDAKGMARDVHRTLHTIVQEQEKVDSTKAEAI  677

Query  396  VKKLQMNGRYLRDVW  352
            VK+LQM+GRYLRDVW
Sbjct  678  VKQLQMDGRYLRDVW  692



>ref|NP_001236742.1| NADPH:P450 reductase [Glycine max]
 gb|AAN85869.1| NADPH:P450 reductase [Glycine max]
Length=689

 Score =   139 bits (351),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +W+LISQ GYLYVCGDAKGMARDVHRTLHTIVQ+QE VDSSKAEAI
Sbjct  615  KEYVQHKMMDKAANLWNLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQENVDSSKAEAI  674

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  675  VKKLQMDGRYLRDVW  689



>gb|KHN39959.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=689

 Score =   139 bits (351),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +W+LISQ GYLYVCGDAKGMARDVHRTLHTIVQ+QE VDSSKAEAI
Sbjct  615  KEYVQHKMMDKAANLWNLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQENVDSSKAEAI  674

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  675  VKKLQMDGRYLRDVW  689



>ref|XP_010439016.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score =   139 bits (351),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHKITE+A+QVW+LI +EGYLYVCGDAKGMA+DVHRTLHTIVQEQE V SS+AEAI
Sbjct  617  KEYVQHKITEKAAQVWNLIKEEGYLYVCGDAKGMAKDVHRTLHTIVQEQEGVSSSEAEAI  676

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  677  VKKLQTEGRYLRDVW  691



>ref|XP_007141274.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
 gb|ESW13268.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
Length=685

 Score =   139 bits (351),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +W+LISQ GYLYVCGDAKGMARDVHRTLHTIVQ+QEKVDSSKAEAI
Sbjct  611  KEYVQHKMIDKAANLWNLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQEKVDSSKAEAI  670

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  671  VKKLQMDGRYLRDVW  685



>ref|XP_010433757.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Camelina 
sativa]
 ref|XP_010433758.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X2 [Camelina 
sativa]
 ref|XP_010433759.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X3 [Camelina 
sativa]
Length=691

 Score =   139 bits (351),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHKITE+A+QVW+LI +EGYLYVCGDAKGMA+DVHRTLHTIVQEQE V SS+AEAI
Sbjct  617  KEYVQHKITEKAAQVWNLIKEEGYLYVCGDAKGMAKDVHRTLHTIVQEQEGVSSSEAEAI  676

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  677  VKKLQTEGRYLRDVW  691



>ref|XP_010086660.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB22547.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=687

 Score =   139 bits (351),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +WSLISQ GY YVCGDAKGMARDVHRTLHTIVQ+QE VDSSKAE+I
Sbjct  613  KEYVQHKMMDKASCIWSLISQGGYFYVCGDAKGMARDVHRTLHTIVQQQENVDSSKAESI  672

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  673  VKKLQMDGRYLRDVW  687



>sp|P37116.1|NCPR_VIGRR RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Vigna radiata var. radiata]
 gb|AAA34240.1| NADPH cytochrome P450 [Vigna radiata]
Length=690

 Score =   139 bits (350),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +WSLISQ GYLYVCGDAKGMARDVHRTLH+IVQEQE VDS+KAEAI
Sbjct  616  KEYVQHKMMDKAAHLWSLISQGGYLYVCGDAKGMARDVHRTLHSIVQEQENVDSTKAEAI  675

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  676  VKKLQMDGRYLRDVW  690



>pir||A47298 NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung bean
Length=690

 Score =   139 bits (350),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +WSLISQ GYLYVCGDAKGMARDVHRTLH+IVQEQE VDS+KAEAI
Sbjct  616  KEYVQHKMMDKAAHLWSLISQGGYLYVCGDAKGMARDVHRTLHSIVQEQENVDSTKAEAI  675

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  676  VKKLQMDGRYLRDVW  690



>ref|XP_009138145.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=695

 Score =   139 bits (350),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHKI E+A+QVW+LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  621  KEYVQHKIIEKATQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  680

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  681  VKKLQTEGRYLRDVW  695



>emb|CDY34288.1| BnaA01g13910D [Brassica napus]
Length=695

 Score =   139 bits (350),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHKI E+A+QVW+LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  621  KEYVQHKIIEKATQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  680

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  681  VKKLQTEGRYLRDVW  695



>gb|EYU36460.1| hypothetical protein MIMGU_mgv1a002296mg [Erythranthe guttata]
Length=690

 Score =   139 bits (350),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            KDYVQHK+ E+A+QVWSLIS  GYLYVCGDAKGMARDVHR+LHTIVQ QE VDS+KAEA 
Sbjct  616  KDYVQHKMMEKAAQVWSLISGGGYLYVCGDAKGMARDVHRSLHTIVQTQENVDSTKAEAT  675

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  676  VKKLQMDGRYLRDVW  690



>emb|CDY03447.1| BnaC01g16350D [Brassica napus]
Length=695

 Score =   139 bits (350),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHKI E+A+QVW+LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  621  KEYVQHKIVEKAAQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  680

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  681  VKKLQTEGRYLRDVW  695



>ref|XP_010277515.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Nelumbo 
nucifera]
Length=691

 Score =   139 bits (350),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A++VW+LIS+ GYLYVCGDAKGMARDVHRTLH+IVQEQE  DSSKAEAI
Sbjct  617  KEYVQHKMMDKATEVWNLISRNGYLYVCGDAKGMARDVHRTLHSIVQEQESTDSSKAEAI  676

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM GRYLRDVW
Sbjct  677  VKKLQMEGRYLRDVW  691



>gb|AAT76449.1| NADPH:cytochrome P450 reductase [Taxus cuspidata]
Length=717

 Score =   139 bits (350),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS  WSLI+Q GYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE +
Sbjct  643  KEYVQHKMLEKASDTWSLIAQGGYLYVCGDAKGMARDVHRTLHTIVQEQESVDSSKAEFL  702

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRD+W
Sbjct  703  VKKLQMDGRYLRDIW  717



>gb|AAX59902.1| cytochrome P450 reductase [Taxus wallichiana var. chinensis]
Length=717

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS  WSLI+Q GYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE +
Sbjct  643  KEYVQHKMLEKASDTWSLIAQGGYLYVCGDAKGMARDVHRTLHTIVQEQESVDSSKAEFL  702

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRD+W
Sbjct  703  VKKLQMDGRYLRDIW  717



>ref|XP_009137450.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Brassica 
rapa]
Length=695

 Score =   139 bits (349),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+ASQVW+LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  621  KEYVQHKMIEKASQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  680

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  681  VKKLQTEGRYLRDVW  695



>ref|XP_010448554.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score =   139 bits (349),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHKITE+A+QVW+LI  EGYLYVCGDAKGMA+DVHRTLHTIVQEQE V SS+AEAI
Sbjct  617  KEYVQHKITEKAAQVWNLIKDEGYLYVCGDAKGMAKDVHRTLHTIVQEQEGVSSSEAEAI  676

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  677  VKKLQTEGRYLRDVW  691



>ref|XP_003602898.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES73149.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=692

 Score =   138 bits (347),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS  WSLISQ GYLYVCGDAKGMARDVHRTLHTIVQ+QE  DSSKAEA 
Sbjct  618  KEYVQHKMMDKASYFWSLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQENADSSKAEAT  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  678  VKKLQMDGRYLRDVW  692



>ref|XP_010692385.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=693

 Score =   138 bits (347),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W+LIS  GYLYVCGDAKGMARDVHRTLH IVQEQEKV+SSKAEAI
Sbjct  619  KEYVQHKMVDKASYLWNLISSGGYLYVCGDAKGMARDVHRTLHNIVQEQEKVESSKAEAI  678

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  679  VKKLQMDGRYLRDVW  693



>ref|XP_009137451.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X2 [Brassica 
rapa]
Length=556

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+ASQVW+LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  482  KEYVQHKMIEKASQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  541

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  542  VKKLQTEGRYLRDVW  556



>gb|AIG15452.1| NADPH-cytochrome P450 reductase 2 [Azadirachta indica]
Length=715

 Score =   138 bits (347),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W++ISQ GYLYVCGDAKGMARDVHRTLHTIVQEQ  VDSSKAE+I
Sbjct  641  KEYVQHKMMEKASDIWNMISQGGYLYVCGDAKGMARDVHRTLHTIVQEQGSVDSSKAESI  700

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  701  VKNLQMTGRYLRDVW  715



>ref|XP_003522768.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
 gb|KHN08276.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score =   137 bits (346),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +WSLISQ GYLYVCGDAKGMARDVHR LHTIVQ+QE VDS+KAEAI
Sbjct  617  KEYVQHKMMDQAAHLWSLISQGGYLYVCGDAKGMARDVHRILHTIVQQQENVDSTKAEAI  676

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  677  VKKLQMDGRYLRDVW  691



>ref|XP_006413419.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
 gb|ESQ54872.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
Length=694

 Score =   137 bits (346),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+QVW+LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEA+
Sbjct  620  KEYVQHKMIEKAAQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAV  679

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  680  VKKLQTEGRYLRDVW  694



>emb|CDY11017.1| BnaA03g46760D [Brassica napus]
Length=695

 Score =   137 bits (346),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+QVW+LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  621  KEYVQHKMIEKAAQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  680

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  681  VKKLQTEGRYLRDVW  695



>ref|XP_007136327.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
 gb|ESW08321.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
Length=692

 Score =   137 bits (345),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHKI ++A+ VWSLISQ GYLYVCGDAK MARDVHRTLH+IVQ+QE VDS+KAEAI
Sbjct  618  KEYVQHKIMDQAAHVWSLISQGGYLYVCGDAKCMARDVHRTLHSIVQQQENVDSTKAEAI  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  678  VKKLQMDGRYLRDVW  692



>gb|KHG05124.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=693

 Score =   137 bits (344),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +W+LIS+ GYLYVCGDAKGMARDVHRTLHTI+QEQE VDSSKAE++
Sbjct  619  KEYVQHKMMDKAADIWNLISKGGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSKAESM  678

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  679  VKKLQMDGRYLRDVW  693



>ref|XP_002867662.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43921.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
Length=692

 Score =   137 bits (344),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+QVW+LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  618  KEYVQHKMMEKAAQVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  678  VKKLQTEGRYLRDVW  692



>gb|ACN54323.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=693

 Score =   136 bits (343),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +W+LIS+ GYLYVCGDAKGMARDVHRTLHTI+QEQE VDSSKAE++
Sbjct  619  KEYVQHKMMDKAADIWNLISKGGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSKAESM  678

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  679  VKKLQMDGRYLRDVW  693



>ref|XP_004299743.1| PREDICTED: NADPH--cytochrome P450 reductase [Fragaria vesca subsp. 
vesca]
Length=689

 Score =   136 bits (343),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+ +W+LISQ GY YVCGDAKGMARDVHRTLHTIVQ+++KVDS+KAEAI
Sbjct  615  KEYVQHKMMEKAAYMWNLISQGGYFYVCGDAKGMARDVHRTLHTIVQQEDKVDSTKAEAI  674

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  675  VKKLQMDGRYLRDVW  689



>gb|KJB58863.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=693

 Score =   136 bits (343),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +W+LIS+ GYLYVCGDAKGMARDVHRTLHTI+QEQE VDSSKAE++
Sbjct  619  KEYVQHKMMDKAADIWNLISKGGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSKAESM  678

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  679  VKKLQMDGRYLRDVW  693



>emb|CDX92639.1| BnaC07g38970D [Brassica napus]
Length=695

 Score =   136 bits (343),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+QVW+LI ++GYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  621  KEYVQHKMIEKAAQVWNLIKEKGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  680

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  681  VKKLQTEGRYLRDVW  695



>gb|KJB58865.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=694

 Score =   136 bits (343),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +W+LIS+ GYLYVCGDAKGMARDVHRTLHTI+QEQE VDSSKAE++
Sbjct  620  KEYVQHKMMDKAADIWNLISKGGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSKAESM  679

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  680  VKKLQMDGRYLRDVW  694



>gb|ABK92896.1| unknown [Populus trichocarpa]
Length=183

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ GYLYVCGDAKGMA+DVHRTLHTIVQEQ  +D+SK E+ 
Sbjct  109  KEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDNSKTESF  168

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  169  VKGLQMNGRYLRDVW  183



>emb|CDY34287.1| BnaA01g13900D [Brassica napus]
Length=694

 Score =   136 bits (342),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHKI ++A+Q W+LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  620  KEYVQHKIVQKAAQFWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  679

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  680  VKKLQTEGRYLRDVW  694



>ref|NP_001190823.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AEE84920.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
Length=688

 Score =   136 bits (342),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+QVW LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  614  KEYVQHKMMEKAAQVWDLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  673

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  674  VKKLQTEGRYLRDVW  688



>ref|NP_194183.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 sp|Q9SB48.1|NCPR1_ARATH RecName: Full=NADPH--cytochrome P450 reductase 1 [Arabidopsis 
thaliana]
 emb|CAA23011.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 emb|CAB79362.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAK96879.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAP37785.1| At4g24520 [Arabidopsis thaliana]
 gb|AEE84919.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AGA15807.1| CPR1 [Expression vector pUDE172]
Length=692

 Score =   136 bits (342),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+QVW LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  618  KEYVQHKMMEKAAQVWDLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  678  VKKLQTEGRYLRDVW  692



>gb|AHB33949.1| cytochrome P450 reductase [Santalum album]
Length=692

 Score =   136 bits (342),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +WSLISQ  YLYVCGDAKGMARDVHRTLHT+VQ+QE VDSSKAE+I
Sbjct  618  KEYVQHKMMDKAAYIWSLISQGAYLYVCGDAKGMARDVHRTLHTLVQQQESVDSSKAESI  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  678  VKKLQMDGRYLRDVW  692



>gb|AIG15451.1| NADPH-cytochrome P450 reductase 1 [Azadirachta indica]
Length=695

 Score =   136 bits (342),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +WSL+S++GYLYVCGDAKGMARDVHRTLHTI+QEQE VDSS AEA 
Sbjct  621  KEYVQHKMMDKAAYLWSLLSKDGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSTAEAT  680

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM GRYLRDVW
Sbjct  681  VKKLQMEGRYLRDVW  695



>gb|ACF35281.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=692

 Score =   136 bits (342),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A Q+W+LIS+EGY+YVCGDAKGMARDVHRTLHTIVQEQE V SS+AEA+
Sbjct  618  KEYVQHKMMEKAVQLWNLISKEGYIYVCGDAKGMARDVHRTLHTIVQEQENVRSSEAEAV  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  678  VKKLQTEGRYLRDVW  692



>gb|AIL29328.1| cytochrome P450 reductase [Pinus contorta]
Length=718

 Score =   136 bits (342),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHKI E+AS +W+LISQ GYLYVCGDAKGMARDVHRTLH I+QEQE VDS+ AEA 
Sbjct  644  KEYVQHKIAEKASYIWNLISQGGYLYVCGDAKGMARDVHRTLHNIIQEQESVDSTSAEAT  703

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  704  VKKLQTEGRYLRDVW  718



>ref|XP_009138137.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=694

 Score =   135 bits (341),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHKI ++A+Q W+LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  620  KEYVQHKIVQKAAQFWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  679

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  680  VKKLQTEGRYLRDVW  694



>ref|XP_004501654.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=692

 Score =   135 bits (341),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +WSLISQ GYLYVCGDAKGMARDVHRTLHTIVQ+QE  DS+KAEA 
Sbjct  618  KEYVQHKMMDKAAYLWSLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQENADSTKAEAT  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  678  VKKLQMDGRYLRDVW  692



>ref|XP_002265859.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
 emb|CBI19275.3| unnamed protein product [Vitis vinifera]
Length=688

 Score =   135 bits (341),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ +RAS +W++ISQ GYLYVCGDAKGMA+DVHRTLHTIVQEQE V+SSKAEAI
Sbjct  614  KEYVQHKMMDRASYIWNIISQGGYLYVCGDAKGMAKDVHRTLHTIVQEQENVESSKAEAI  673

Query  396  VKKLQMNGRYLRDVW  352
            VKKL   GRYLRDVW
Sbjct  674  VKKLHTEGRYLRDVW  688



>emb|CAA46814.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=692

 Score =   135 bits (341),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+QVW LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  618  KEYVQHKMMEKAAQVWDLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  678  VKKLQTEGRYLRDVW  692



>ref|XP_008338958.1| PREDICTED: NADPH--cytochrome P450 reductase [Malus domestica]
Length=692

 Score =   135 bits (341),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ VW L+SQ GY YVCGDAKGMARDVHRTLHTIVQ+QEKVDS+KAEA 
Sbjct  618  KEYVQHKLMDKAAYVWDLVSQGGYFYVCGDAKGMARDVHRTLHTIVQQQEKVDSTKAEAT  677

Query  396  VKKLQMNGRYLRDVW  352
            VK+LQM+GRYLRDVW
Sbjct  678  VKRLQMDGRYLRDVW  692



>ref|XP_002514049.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF48632.1| cytochrome P450, putative [Ricinus communis]
Length=692

 Score =   135 bits (340),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+Q+WSLIS+ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E++
Sbjct  618  KEYVQHKMMDKAAQIWSLISERGYIYVCGDAKGMARDVHRTLHTIVQEQGNLDSSKTESM  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  678  VKKLQMDGRYLRDVW  692



>emb|CAA89837.3| NADPH-cytochrome P450 reductase [Pseudotsuga menziesii]
Length=719

 Score =   135 bits (340),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHKITE+ S +W+LI+Q GYLYVCGDAKGMARDVHRTLH+IVQEQE VDS+ AEA 
Sbjct  645  KEYVQHKITEKGSYIWNLIAQGGYLYVCGDAKGMARDVHRTLHSIVQEQESVDSTSAEAT  704

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  705  VKKLQTEGRYLRDVW  719



>emb|CAA81211.1| NADPH-ferrihemoprotein reductase [Vicia sativa]
Length=692

 Score =   134 bits (338),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A  +WSLISQ GYLYVCGDAKGMARDVHR+LHTIVQ+QE  DSSKAEA 
Sbjct  618  KEYVQHKMMDKAEYLWSLISQGGYLYVCGDAKGMARDVHRSLHTIVQQQENADSSKAEAT  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  678  VKKLQMDGRYLRDVW  692



>ref|XP_009376208.1| PREDICTED: NADPH--cytochrome P450 reductase [Pyrus x bretschneideri]
Length=692

 Score =   134 bits (338),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+  W L+SQ GY YVCGDAKGMARDVHRTLHTIVQEQE+VDS+KAEA 
Sbjct  618  KEYVQHKLMEKAAYTWDLVSQGGYFYVCGDAKGMARDVHRTLHTIVQEQERVDSTKAEAR  677

Query  396  VKKLQMNGRYLRDVW  352
            VK+LQM+GRYLRDVW
Sbjct  678  VKQLQMDGRYLRDVW  692



>ref|XP_010254555.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=692

 Score =   134 bits (337),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K YVQHK+ ++A+ +W++IS+ GYLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAEA 
Sbjct  618  KQYVQHKMMDKAADIWNIISKNGYLYVCGDAKGMARDVHRTLHTIVQEQGSMDSSKAEAT  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  678  VKKLQMDGRYLRDVW  692



>ref|XP_011069915.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum]
Length=712

 Score =   134 bits (337),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS+VW++IS+ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  638  KEYVQHKMAQKASEVWNMISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESM  697

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  698  VKNLQMSGRYLRDVW  712



>ref|XP_009414761.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=700

 Score =   134 bits (337),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+TE+AS VW++ISQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E++
Sbjct  626  KEYVQHKMTEKASSVWNIISQGGYVYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKTESL  685

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  686  VKSLQMEGRYLRDVW  700



>ref|XP_008391625.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Malus domestica]
Length=712

 Score =   134 bits (336),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS VW++ISQ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE +
Sbjct  638  KEYVQHKMMQKASDVWNMISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGCMDSSKAEGL  697

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  698  VKNLQMNGRYLRDVW  712



>emb|CCO62220.1| putative cytochrome P450 reductase [Actaea racemosa]
Length=699

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K YVQHK+TERAS +W++ISQ GYLYVCGDAKGMA+DVHRTLHTIVQEQ  +D+SK E +
Sbjct  625  KQYVQHKMTERASDIWNMISQGGYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDNSKTEMM  684

Query  396  VKKLQMNGRYLRDVW  352
            VK +QM+GRYLRDVW
Sbjct  685  VKNMQMDGRYLRDVW  699



>ref|XP_007018236.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
 gb|EOY15461.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
Length=736

 Score =   134 bits (336),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +WSL+S+ GYLYVCGDAKGMARDVHRTLHTIV EQE VDSSKAE++
Sbjct  662  KEYVQHKMMDKAAYMWSLLSKGGYLYVCGDAKGMARDVHRTLHTIVLEQESVDSSKAESM  721

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM GRYLRDVW
Sbjct  722  VKKLQMEGRYLRDVW  736



>ref|XP_002307336.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
 gb|AAK15259.1|AF302496_1 NADPH-cytochrome P450 oxydoreductase isoform 1 [Populus trichocarpa 
x Populus deltoides]
 gb|EEE94332.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
Length=692

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ +RA+++W++ISQ GY YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E++
Sbjct  618  KEYVQHKMVDRAAEIWTIISQGGYFYVCGDAKGMARDVHRTLHTIVQEQGGLDSSKTESM  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM GRYLRDVW
Sbjct  678  VKKLQMEGRYLRDVW  692



>ref|XP_007018235.1| P450 reductase 1 isoform 2 [Theobroma cacao]
 gb|EOY15460.1| P450 reductase 1 isoform 2 [Theobroma cacao]
Length=495

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +WSL+S+ GYLYVCGDAKGMARDVHRTLHTIV EQE VDSSKAE++
Sbjct  421  KEYVQHKMMDKAAYMWSLLSKGGYLYVCGDAKGMARDVHRTLHTIVLEQESVDSSKAESM  480

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM GRYLRDVW
Sbjct  481  VKKLQMEGRYLRDVW  495



>ref|XP_004165700.1| PREDICTED: NADPH--cytochrome P450 reductase-like, partial [Cucumis 
sativus]
Length=503

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+TE+AS +W+LISQ  YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  429  KEYVQHKMTEKASDIWNLISQGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESM  488

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ +GRYLRDVW
Sbjct  489  VKNLQTSGRYLRDVW  503



>ref|XP_009385909.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=703

 Score =   133 bits (335),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+TE+AS VW++ISQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ 
Sbjct  629  KEYVQHKMTEKASDVWNIISQGGYVYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKTESF  688

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  689  VKSLQMEGRYLRDVW  703



>ref|XP_008453604.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Cucumis melo]
Length=708

 Score =   133 bits (334),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+TE+AS +W+LISQ  YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  634  KEYVQHKMTEKASDIWNLISQGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESM  693

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ +GRYLRDVW
Sbjct  694  VKSLQTSGRYLRDVW  708



>ref|XP_004507858.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=705

 Score =   133 bits (334),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEG-YLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEA  400
            K+YVQHK+ E+AS +W++ISQEG Y+YVCGDAKGMARDVHRTLHTI+QEQ  +DSSKAE+
Sbjct  630  KEYVQHKMMEKASDIWNMISQEGAYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAES  689

Query  399  IVKKLQMNGRYLRDVW  352
            +VK LQMNGRYLRDVW
Sbjct  690  MVKNLQMNGRYLRDVW  705



>ref|XP_010520739.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score =   133 bits (334),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 1/75 (1%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+TE+A++VW LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAI
Sbjct  621  KEYVQHKMTEKAAEVWKLI-KEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAI  679

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  680  VKKLQNEGRYLRDVW  694



>ref|XP_006386427.1| hypothetical protein POPTR_0002s10680g [Populus trichocarpa]
 gb|ERP64224.1| hypothetical protein POPTR_0002s10680g [Populus trichocarpa]
Length=521

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+++WS+ISQ GYLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E++
Sbjct  447  KEYVQHKMVDKAAEIWSIISQGGYLYVCGDAKGMARDVHRTLHTIVQEQGGLDSSKTESM  506

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM GRYLRDVW
Sbjct  507  VKKLQMEGRYLRDVW  521



>ref|XP_004146317.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Cucumis sativus]
 gb|AIT72028.1| cytochrome P450 reductase [Cucumis sativus]
 gb|KGN65457.1| hypothetical protein Csa_1G423150 [Cucumis sativus]
Length=708

 Score =   133 bits (334),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+TE+AS +W+LISQ  YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  634  KEYVQHKMTEKASDIWNLISQGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESM  693

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ +GRYLRDVW
Sbjct  694  VKNLQTSGRYLRDVW  708



>gb|KDP41487.1| hypothetical protein JCGZ_15894 [Jatropha curcas]
Length=689

 Score =   132 bits (333),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+Q+W++ISQ GYLYVCGDAKGMARDVHRTLH IVQEQ  +D+SK E++
Sbjct  615  KEYVQHKMVQKAAQIWAIISQGGYLYVCGDAKGMARDVHRTLHNIVQEQGNLDASKTESM  674

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  675  VKKLQMDGRYLRDVW  689



>ref|XP_010530279.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score =   132 bits (333),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 69/75 (92%), Gaps = 1/75 (1%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A++VW LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEA+
Sbjct  621  KEYVQHKMMEKAAEVWKLI-KEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAV  679

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM GRYLRDVW
Sbjct  680  VKKLQMEGRYLRDVW  694



>ref|XP_007018234.1| P450 reductase 1 isoform 1 [Theobroma cacao]
 gb|EOY15459.1| P450 reductase 1 isoform 1 [Theobroma cacao]
Length=693

 Score =   132 bits (333),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +WSL+S+ GYLYVCGDAKGMARDVHRTLHTIV EQE VDSSKAE++
Sbjct  619  KEYVQHKMMDKAAYMWSLLSKGGYLYVCGDAKGMARDVHRTLHTIVLEQESVDSSKAESM  678

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM GRYLRDVW
Sbjct  679  VKKLQMEGRYLRDVW  693



>ref|XP_010928663.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=706

 Score =   132 bits (333),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +WS+ISQ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E++
Sbjct  632  KEYVQHKMAEKASDIWSVISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTESM  691

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  692  VKSLQMEGRYLRDVW  706



>emb|CAN77401.1| hypothetical protein VITISV_027794 [Vitis vinifera]
Length=745

 Score =   133 bits (334),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W++ISQ GY+YVCGDAKGMARDVHRTLHTI+QEQ  +DSSKAE++
Sbjct  671  KEYVQHKMMEKASDIWNVISQGGYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAESM  730

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  731  VKNLQMTGRYLRDVW  745



>ref|NP_001131393.1| uncharacterized protein LOC100192720 [Zea mays]
 gb|ACF79787.1| unknown [Zea mays]
Length=248

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS++W +ISQ  Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ 
Sbjct  174  KEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESF  233

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  234  VKNLQMEGRYLRDVW  248



>ref|NP_001136741.1| uncharacterized protein LOC100216882 [Zea mays]
 gb|ACF82516.1| unknown [Zea mays]
 gb|ACR38551.1| unknown [Zea mays]
Length=247

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS++W +ISQ  Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ 
Sbjct  173  KEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESF  232

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  233  VKNLQMEGRYLRDVW  247



>ref|XP_010046982.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Eucalyptus 
grandis]
 gb|KCW78706.1| hypothetical protein EUGRSUZ_C00154 [Eucalyptus grandis]
Length=683

 Score =   132 bits (332),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W +IS+ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E++
Sbjct  609  KEYVQHKMLEKASDIWKIISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTESL  668

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  669  VKNLQMNGRYLRDVW  683



>gb|AEW43314.1| NADPH cytochrome P450 reductase [Picrorhiza kurrooa]
Length=710

 Score =   132 bits (332),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++IS+ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK EA+
Sbjct  636  KEYVQHKMAQKASDIWNMISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTEAL  695

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  696  VKNLQMTGRYLRDVW  710



>ref|XP_008789667.1| PREDICTED: NADPH--cytochrome P450 reductase [Phoenix dactylifera]
Length=706

 Score =   132 bits (332),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W++ISQ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E++
Sbjct  632  KEYVQHKMAEKASDIWNIISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTESM  691

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  692  VKSLQMEGRYLRDVW  706



>ref|XP_008383106.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Malus 
domestica]
Length=708

 Score =   132 bits (332),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS VW++ISQ GY+YVCGDAKGMARDVHRTLHTIVQEQ  + SSKAE++
Sbjct  634  KEYVQHKMIQKASDVWNMISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGCMGSSKAESL  693

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  694  VKNLQMNGRYLRDVW  708



>ref|XP_006661531.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Oryza brachyantha]
Length=642

 Score =   131 bits (330),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+TE+A ++WS+ISQ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+S  E+ 
Sbjct  568  KEYVQHKMTEKAPEIWSIISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTESY  627

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  628  VKSLQMEGRYLRDVW  642



>ref|XP_008383105.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Malus 
domestica]
Length=709

 Score =   132 bits (332),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS VW++ISQ GY+YVCGDAKGMARDVHRTLHTIVQEQ  + SSKAE++
Sbjct  635  KEYVQHKMIQKASDVWNMISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGCMGSSKAESL  694

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  695  VKNLQMNGRYLRDVW  709



>ref|XP_008781895.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Phoenix dactylifera]
Length=706

 Score =   132 bits (331),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+TE+AS +W++ISQ GY+YVCGDAKGMARDVHRTLH IVQEQ  +DSSK E++
Sbjct  632  KEYVQHKMTEKASDIWNIISQGGYIYVCGDAKGMARDVHRTLHAIVQEQGSLDSSKTESM  691

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  692  VKSLQMDGRYLRDVW  706



>ref|XP_007227446.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
 gb|EMJ28645.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
Length=710

 Score =   132 bits (331),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+T++AS +W+++SQ  Y+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  636  KEYVQHKMTQKASDIWNMLSQGAYIYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESM  695

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  696  VKNLQMSGRYLRDVW  710



>emb|CBI17838.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   131 bits (330),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W++ISQ GY+YVCGDAKGMARDVHRTLHTI+QEQ  +DSSKAE++
Sbjct  586  KEYVQHKMMEKASDIWNVISQGGYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAESM  645

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  646  VKNLQMTGRYLRDVW  660



>ref|XP_008223694.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Prunus mume]
Length=710

 Score =   132 bits (331),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+T++AS +W+++SQ  Y+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  636  KEYVQHKMTQKASDIWNMLSQGAYIYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESM  695

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  696  VKNLQMSGRYLRDVW  710



>gb|KJB14707.1| hypothetical protein B456_002G138900 [Gossypium raimondii]
Length=693

 Score =   131 bits (330),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +WSLIS+ GYLYVCGDAKGMARDVHRTLHTIVQEQ  ++SSKAE++
Sbjct  619  KEYVQHKMMDKAAHIWSLISKGGYLYVCGDAKGMARDVHRTLHTIVQEQGNMESSKAESM  678

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM GRYLRDVW
Sbjct  679  VKKLQMEGRYLRDVW  693



>ref|XP_006381796.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
 gb|AAK15260.1|AF302497_1 NADPH-cytochrome P450 oxydoreductase isoform 2 [Populus trichocarpa 
x Populus deltoides]
 gb|ERP59593.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
Length=712

 Score =   131 bits (330),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ GYLYVCGDAKGMA+DVHRTLHTIVQEQ  +D+SK E+ 
Sbjct  638  KEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDNSKTESF  697

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  698  VKGLQMNGRYLRDVW  712



>ref|XP_002270732.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
Length=705

 Score =   131 bits (330),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W++ISQ GY+YVCGDAKGMARDVHRTLHTI+QEQ  +DSSKAE++
Sbjct  631  KEYVQHKMMEKASDIWNVISQGGYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAESM  690

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  691  VKNLQMTGRYLRDVW  705



>gb|AGX85599.1| NADPH:cytochrome P450 reductase [Scoparia dulcis]
Length=713

 Score =   131 bits (329),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W++IS+ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+SKAE +
Sbjct  639  KEYVQHKMAEKASDLWNMISEGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSKAELM  698

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  699  VKNLQMSGRYLRDVW  713



>emb|CAC83301.1| cytochrome P450 reductase [Triticum aestivum]
Length=703

 Score =   131 bits (329),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+++WS++SQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE  
Sbjct  629  KEYVQHKMAEKAAELWSIVSQGGYVYVCGDAKGMARDVHRALHTIVQEQGSLDSSKAEGY  688

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  689  VKNLQMEGRYLRDVW  703



>ref|XP_004296434.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Fragaria vesca 
subsp. vesca]
Length=709

 Score =   130 bits (328),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ GY+YVCGDAKGMA+DVHRTLHTI+QEQ  +DSSKAE++
Sbjct  635  KEYVQHKMMQKASDIWNMISQGGYIYVCGDAKGMAKDVHRTLHTILQEQGSLDSSKAESM  694

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ NGRYLRDVW
Sbjct  695  VKNLQTNGRYLRDVW  709



>ref|XP_010265447.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=704

 Score =   130 bits (328),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS VW++IS  GY+YVCGDAKGMARDVHRTLHTIVQ+Q  +DSSKAE++
Sbjct  630  KEYVQHKMMEKASDVWNMISNGGYIYVCGDAKGMARDVHRTLHTIVQQQGSLDSSKAESM  689

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  690  VKNLQMEGRYLRDVW  704



>ref|XP_006285937.1| hypothetical protein CARUB_v10007449mg [Capsella rubella]
 gb|EOA18835.1| hypothetical protein CARUB_v10007449mg [Capsella rubella]
Length=692

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+QVW+LI + GYLYVCGDAKGMA+DVHRTLHTIV EQE V SS+AEAI
Sbjct  618  KEYVQHKMMEKAAQVWNLIQEGGYLYVCGDAKGMAKDVHRTLHTIVIEQEGVSSSEAEAI  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ  GRYLRDVW
Sbjct  678  VKKLQTEGRYLRDVW  692



>gb|ACF35280.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=709

 Score =   130 bits (328),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS  WS+ISQ  Y+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  635  KEYVQHKMAEKASDFWSMISQGAYIYVCGDAKGMARDVHRTLHTIVQEQGCLDSSKAESM  694

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  695  VKNLQMTGRYLRDVW  709



>gb|EEE61817.1| hypothetical protein OsJ_16444 [Oryza sativa Japonica Group]
Length=646

 Score =   130 bits (326),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+TE+A+++W+++SQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ 
Sbjct  572  KEYVQHKMTEKATEIWNIVSQGGYIYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTESY  631

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  632  VKSLQMDGRYLRDVW  646



>gb|AGL46979.1| cytochrome P450 reductase [Salvia miltiorrhiza]
Length=712

 Score =   130 bits (328),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS++W++IS+ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E+ 
Sbjct  638  KEYVQHKMAQKASELWNMISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTESF  697

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  698  VKNLQMTGRYLRDVW  712



>ref|XP_011015338.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
 ref|XP_011015339.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=692

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ +RA+++W++ISQ GY YVCGDAKGMARDVHRTLH IVQEQ  +D+SK E++
Sbjct  618  KEYVQHKMVDRAAEIWTIISQGGYFYVCGDAKGMARDVHRTLHAIVQEQGGLDASKTESM  677

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM GRYLRDVW
Sbjct  678  VKKLQMEGRYLRDVW  692



>ref|XP_011043963.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=712

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ GYLYVCGDAKGMA+DVHR LHTIVQEQ  +D+SK E+ 
Sbjct  638  KEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRALHTIVQEQGSLDNSKTESF  697

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  698  VKSLQMNGRYLRDVW  712



>ref|XP_004960247.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Setaria 
italica]
Length=694

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+++W++ISQ GYLYVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ 
Sbjct  620  KEYVQHKMVEKATEIWNIISQGGYLYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKTESY  679

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  680  VKSLQMEGRYLRDVW  694



>emb|CDP02981.1| unnamed protein product [Coffea canephora]
Length=662

 Score =   130 bits (326),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K YVQHK+ E+AS +WS++S+  Y+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE+ 
Sbjct  588  KQYVQHKMAEKASDIWSMLSEGAYVYVCGDAKGMARDVHRTLHTIVQEQGSMDSSKAESF  647

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  648  VKNLQMSGRYLRDVW  662



>ref|XP_010048643.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Eucalyptus 
grandis]
 gb|KCW80967.1| hypothetical protein EUGRSUZ_C02330 [Eucalyptus grandis]
Length=711

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W+++SQ  Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE++
Sbjct  637  KEYVQHKMMEKASDIWNMLSQGAYIYVCGDAKGMARDVHRALHTIVQEQGSLDSSKAESM  696

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  697  VKNLQMSGRYLRDVW  711



>gb|KJB53794.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=710

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A  +W +ISQ GYLYVCGDAKGMARDVHR LHTI+QEQ  +DSSKAE++
Sbjct  636  KEYVQHKMMEKAKDIWDMISQGGYLYVCGDAKGMARDVHRALHTILQEQGSLDSSKAESM  695

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  696  VKNLQMSGRYLRDVW  710



>ref|XP_002462826.1| hypothetical protein SORBIDRAFT_02g032640 [Sorghum bicolor]
 gb|EER99347.1| hypothetical protein SORBIDRAFT_02g032640 [Sorghum bicolor]
Length=706

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+++WS+ISQ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+SK E+ 
Sbjct  632  KEYVQHKMAQKAAELWSIISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSMDNSKTESY  691

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  692  VKSLQMEGRYLRDVW  706



>dbj|BAG68945.1| cytochrome P450 reductase [Lotus japonicus]
Length=706

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W++ISQ  Y+YVCGDAKGMARDVHRTLHTI+QEQ  +DSSKAE +
Sbjct  632  KEYVQHKMMEKASDIWNMISQGAYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAEGM  691

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ+NGRYLRDVW
Sbjct  692  VKNLQLNGRYLRDVW  706



>gb|KJB53797.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=711

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A  +W +ISQ GYLYVCGDAKGMARDVHR LHTI+QEQ  +DSSKAE++
Sbjct  637  KEYVQHKMMEKAKDIWDMISQGGYLYVCGDAKGMARDVHRALHTILQEQGSLDSSKAESM  696

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  697  VKNLQMSGRYLRDVW  711



>ref|XP_007014268.1| P450 reductase 2 [Theobroma cacao]
 gb|EOY31887.1| P450 reductase 2 [Theobroma cacao]
Length=710

 Score =   130 bits (326),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ GYLYVCGDAKGMA+DVHRTLHTI+QEQ  +DSSKAE++
Sbjct  636  KEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRTLHTILQEQGCLDSSKAESM  695

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  696  VKNLQMTGRYLRDVW  710



>gb|AAK15261.1|AF302498_1 NADPH-cytochrome P450 oxydoreductase isoform 3 [Populus trichocarpa 
x Populus deltoides]
Length=712

 Score =   130 bits (326),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ GYLYVCGDAKGMA+DVHR LHTIVQEQ  +D+SK E+ 
Sbjct  638  KEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRALHTIVQEQGSLDNSKTESF  697

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  698  VKSLQMNGRYLRDVW  712



>emb|CAE01547.2| OSJNBb0022F16.2 [Oryza sativa Japonica Group]
 emb|CAE03554.2| OSJNBa0060D06.20 [Oryza sativa Japonica Group]
Length=695

 Score =   130 bits (326),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+TE+A+++W+++SQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ 
Sbjct  621  KEYVQHKMTEKATEIWNIVSQGGYIYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTESY  680

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  681  VKSLQMDGRYLRDVW  695



>gb|ACP43317.1| NADPH cytochrome P450 reductase [Citrus maxima]
Length=209

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E++S +W++ S+  YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  135  KEYVQHKMMEKSSDIWNMFSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESM  194

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  195  VKNLQMTGRYLRDVW  209



>ref|NP_001063914.1| Os09g0558900 [Oryza sativa Japonica Group]
 dbj|BAD45947.1| putative NADPH-cytochrome P450 oxydoreductase isoform 3 [Oryza 
sativa Japonica Group]
 dbj|BAF25828.1| Os09g0558900 [Oryza sativa Japonica Group]
Length=714

 Score =   129 bits (325),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A ++WS+ISQ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+S  E+ 
Sbjct  640  KEYVQHKMAEKAPEIWSIISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTESY  699

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  700  VKSLQMEGRYLRDVW  714



>gb|ADC94831.1| cytochrome P450 reductase [Perilla frutescens]
Length=709

 Score =   129 bits (324),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A  +W++IS+ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E+ 
Sbjct  635  KEYVQHKMAQKALDLWNMISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTESF  694

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  695  VKNLQMNGRYLRDVW  709



>gb|KHG09184.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=710

 Score =   129 bits (324),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A  +W +ISQ GYLYVCGDAKGMARDVHR LHTI QEQ  +DSSKAE++
Sbjct  636  KEYVQHKMMEKAKDIWDMISQGGYLYVCGDAKGMARDVHRALHTIFQEQGSLDSSKAESM  695

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  696  VKNLQMSGRYLRDVW  710



>ref|XP_010259920.1| PREDICTED: NADPH--cytochrome P450 reductase [Nelumbo nucifera]
Length=705

 Score =   129 bits (324),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS VW++IS+ GY+YVCGDAKGMARDVHRTLH IVQEQ  +DSS+AE++
Sbjct  631  KEYVQHKMMEKASNVWNIISKGGYIYVCGDAKGMARDVHRTLHAIVQEQGSLDSSQAESM  690

Query  396  VKKLQMNGRYLRDVW  352
            +K LQM GRYLRDVW
Sbjct  691  IKNLQMEGRYLRDVW  705



>ref|XP_011010331.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=712

 Score =   129 bits (324),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ GYLYVCGDAKGMA+DVHRTLH IVQEQ  +D+SK E+ 
Sbjct  638  KEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRTLHAIVQEQGSLDNSKTESF  697

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  698  VKGLQMNGRYLRDVW  712



>ref|XP_009795589.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=713

 Score =   129 bits (324),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK++E+A+ +W++ISQ GY+YVCGDAKGMARDVHR LHTI Q+Q  +DSSKAEA+
Sbjct  639  KEYVQHKMSEKAADIWNMISQGGYVYVCGDAKGMARDVHRALHTIAQDQGSLDSSKAEAL  698

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ+ GRYLRDVW
Sbjct  699  VKNLQITGRYLRDVW  713



>ref|XP_010525727.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Tarenaya hassleriana]
Length=713

 Score =   129 bits (324),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS++W  ISQ GYLYVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ 
Sbjct  639  KEYVQHKMMDKASEMWKTISQGGYLYVCGDAKGMARDVHRALHTIVQEQGSMDSSKAESF  698

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  699  VKNLQMSGRYLRDVW  713



>gb|AEA86315.1| NADPH-cytochrome P450 reductase [Solanum nigrum]
Length=141

 Score =   121 bits (303),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+TE+A+ +W++ISQ GY+YVCGDAKG+ARDVHRTLHTI Q+Q  +D+SK E+ 
Sbjct  67   KEYVQHKMTEKAADIWNMISQGGYVYVCGDAKGVARDVHRTLHTIAQDQGSLDNSKTESF  126

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  127  VKNLQTTGRYLRDVW  141



>gb|AHA50098.1| CYP450 reductase [Panax ginseng]
Length=709

 Score =   129 bits (324),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK++++AS++W++IS+  Y+YVCGDAKGMARDVHRTLHTI QEQ  +DSSKAE++
Sbjct  635  KEYVQHKMSQKASEIWNMISEGAYIYVCGDAKGMARDVHRTLHTIAQEQGALDSSKAESL  694

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  695  VKNLQMTGRYLRDVW  709



>gb|ACN54324.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=710

 Score =   129 bits (324),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A  +W +ISQ GYLYVCGDAKGMARDVHR LHTI QEQ  +DSSKAE++
Sbjct  636  KEYVQHKMMEKAKDIWDMISQGGYLYVCGDAKGMARDVHRALHTIFQEQGSLDSSKAESM  695

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  696  VKNLQMSGRYLRDVW  710



>gb|EMT14573.1| NADPH--cytochrome P450 reductase [Aegilops tauschii]
Length=696

 Score =   129 bits (323),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+++WS++SQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E  
Sbjct  622  KEYVQHKMAEKAAELWSIVSQGGYVYVCGDAKGMARDVHRMLHTIVQEQGSLDSSKTEGY  681

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  682  VKNLQMEGRYLRDVW  696



>gb|ABR25415.1| NADPH-cytochrome p450 reductase [Oryza sativa Indica Group]
Length=72

 Score =   119 bits (297),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  567  VQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKK  388
            VQHK+ E+A ++WS+ISQ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+S  E+ VK 
Sbjct  1    VQHKMAEKAPEIWSIISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTESYVKS  60

Query  387  LQMNGRYLRDVW  352
            LQM GRYLRDVW
Sbjct  61   LQMEGRYLRDVW  72



>ref|XP_009607226.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=713

 Score =   129 bits (323),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK++E+A+ +W++ISQ GY+YVCGDAKGMARDVHRTLHTI Q+Q  +DSSKAE +
Sbjct  639  KEYVQHKMSEKAADIWNMISQGGYVYVCGDAKGMARDVHRTLHTIAQDQGSLDSSKAEGL  698

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  699  VKNLQTTGRYLRDVW  713



>ref|XP_003541616.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
Length=707

 Score =   129 bits (323),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS++WS+ISQ  Y+YVCGDAKGMARDVHR LHTI+QEQ  +DSSKAE++
Sbjct  633  KEYVQHKMMEKASEIWSMISQGAYIYVCGDAKGMARDVHRALHTILQEQGSLDSSKAESM  692

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  693  VKNLQTTGRYLRDVW  707



>gb|EYU42400.1| hypothetical protein MIMGU_mgv1a002170mg [Erythranthe guttata]
Length=705

 Score =   129 bits (323),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ VW++IS+ GY+YVCGDAKGMARDVHRTLH IVQEQ  +D+SK E+ 
Sbjct  631  KEYVQHKMAQKAADVWNMISEGGYVYVCGDAKGMARDVHRTLHAIVQEQGSLDNSKTESF  690

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  691  VKNLQMNGRYLRDVW  705



>ref|XP_002444097.1| hypothetical protein SORBIDRAFT_07g007640 [Sorghum bicolor]
 gb|EES13592.1| hypothetical protein SORBIDRAFT_07g007640 [Sorghum bicolor]
Length=706

 Score =   129 bits (323),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS++W +ISQ  Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ 
Sbjct  632  KEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESF  691

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  692  VKNLQMEGRYLRDVW  706



>ref|XP_006372089.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
 gb|ERP49886.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
Length=471

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ GYLYVCGDAKGMA+DVHR LHTIVQEQ   D+S+ E+ 
Sbjct  397  KEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRALHTIVQEQGSFDNSRTESF  456

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  457  VKSLQMNGRYLRDVW  471



>gb|EPS73891.1| hypothetical protein M569_00858 [Genlisea aurea]
Length=706

 Score =   128 bits (322),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ERA+ +W LIS  GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+SK E+ 
Sbjct  632  KEYVQHKMGERAADLWKLISDGGYVYVCGDAKGMARDVHRTLHTIVQEQGSMDNSKTESF  691

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  692  VKNLQMTGRYLRDVW  706



>ref|XP_002324469.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
 gb|EEF03034.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
Length=712

 Score =   128 bits (322),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ GYLYVCGDAKGMA+DVHR LHTIVQEQ   D+S+ E+ 
Sbjct  638  KEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDVHRALHTIVQEQGSFDNSRTESF  697

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  698  VKSLQMNGRYLRDVW  712



>gb|KHN22700.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=707

 Score =   128 bits (322),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS++WS+ISQ  Y+YVCGDAKGMARDVHR LHTI+QEQ  +DSSKAE++
Sbjct  633  KEYVQHKMMEKASEIWSMISQGAYIYVCGDAKGMARDVHRALHTILQEQGALDSSKAESM  692

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  693  VKNLQTTGRYLRDVW  707



>ref|XP_004148333.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis sativus]
 gb|KGN61141.1| hypothetical protein Csa_2G059720 [Cucumis sativus]
Length=708

 Score =   128 bits (322),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W+L+SQ  Y+YVCGDAKGMARDVHRTLH IVQEQ  +DSSKAE++
Sbjct  634  KEYVQHKMVEKASDIWNLLSQGAYIYVCGDAKGMARDVHRTLHNIVQEQGSLDSSKAESM  693

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  694  VKNLQMSGRYLRDVW  708



>gb|KHN17598.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=715

 Score =   128 bits (322),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS++WS+ISQ  Y+YVCGDAKGMARDVHR LHTI+QEQ  +DSSKAE++
Sbjct  641  KEYVQHKMMEKASEIWSMISQGAYIYVCGDAKGMARDVHRALHTILQEQGSLDSSKAESM  700

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  701  VKNLQTTGRYLRDVW  715



>ref|XP_011079296.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum]
Length=705

 Score =   128 bits (322),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+T++AS +W++IS+ GY+YVCGDAKGMARDVHRTLHTIVQEQ    SS+AE +
Sbjct  631  KEYVQHKMTQKASDIWNIISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSRSSSEAEGM  690

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  691  VKNLQMTGRYLRDVW  705



>ref|XP_004168364.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis sativus]
Length=708

 Score =   128 bits (322),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W+L+SQ  Y+YVCGDAKGMARDVHRTLH IVQEQ  +DSSKAE++
Sbjct  634  KEYVQHKMVEKASDIWNLLSQGAYIYVCGDAKGMARDVHRTLHNIVQEQGSLDSSKAESM  693

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  694  VKNLQMSGRYLRDVW  708



>ref|NP_001159331.1| uncharacterized protein LOC100304425 [Zea mays]
 gb|ACN25819.1| unknown [Zea mays]
 gb|ACN28051.1| unknown [Zea mays]
 gb|AFW59698.1| hypothetical protein ZEAMMB73_961001 [Zea mays]
Length=694

 Score =   128 bits (322),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+++W++IS  GYLYVCGDAKGMARDVHR LHT+VQEQ  +DSSK E+ 
Sbjct  620  KEYVQHKMVEKATEIWNIISHGGYLYVCGDAKGMARDVHRMLHTVVQEQGSLDSSKTESY  679

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  680  VKSLQMEGRYLRDVW  694



>ref|XP_002447240.1| hypothetical protein SORBIDRAFT_06g031110 [Sorghum bicolor]
 gb|EES11568.1| hypothetical protein SORBIDRAFT_06g031110 [Sorghum bicolor]
Length=694

 Score =   128 bits (321),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+++W++IS  GYLYVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ 
Sbjct  620  KEYVQHKMVEKATEIWNIISHGGYLYVCGDAKGMARDVHRMLHTIVQEQGSLDSSKTESY  679

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  680  VKSLQMEGRYLRDVW  694



>ref|XP_003549436.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
Length=707

 Score =   128 bits (322),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS++WS+ISQ  Y+YVCGDAKGMARDVHR LHTI+QEQ  +DSSKAE++
Sbjct  633  KEYVQHKMMEKASEIWSMISQGAYIYVCGDAKGMARDVHRALHTILQEQGSLDSSKAESM  692

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  693  VKNLQTTGRYLRDVW  707



>gb|ACG27711.1| NADPH--cytochrome P450 reductase [Zea mays]
Length=703

 Score =   128 bits (321),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS++W +ISQ  Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ 
Sbjct  629  KEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESF  688

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  689  VKNLQMEGRYLRDVW  703



>gb|AAZ39649.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=715

 Score =   128 bits (321),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K YVQHK+TE+A+ +W++ISQ GY+YVCGDAKGMARDVHRTLHTI Q+Q  +DS+KAE +
Sbjct  641  KQYVQHKMTEKAADIWNMISQGGYVYVCGDAKGMARDVHRTLHTIAQDQGSLDSTKAEGM  700

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  701  VKNLQTTGRYLRDVW  715



>ref|XP_008661364.1| PREDICTED: uncharacterized protein LOC100192720 isoform X1 [Zea 
mays]
 gb|AFW57103.1| NADPH--cytochrome P450 reductase [Zea mays]
Length=699

 Score =   128 bits (321),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS++W +ISQ  Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ 
Sbjct  625  KEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESF  684

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  685  VKNLQMEGRYLRDVW  699



>ref|XP_010093854.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB54742.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=715

 Score =   128 bits (321),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+ +W +ISQ  Y+YVCGDAKGMA+DVHRTLHTI QEQ  +DSSKAE++
Sbjct  641  KEYVQHKMMQKAADIWDMISQGAYIYVCGDAKGMAKDVHRTLHTIAQEQGSLDSSKAESM  700

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  701  VKNLQMNGRYLRDVW  715



>ref|XP_004242931.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=715

 Score =   128 bits (321),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+T++A  +W++ISQ GY+YVCGDAKGMARDVHRTLHTI Q+Q  +DSSKAE+ 
Sbjct  641  KEYVQHKMTQKADDIWNMISQGGYVYVCGDAKGMARDVHRTLHTIAQDQGSLDSSKAESF  700

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  701  VKNLQTTGRYLRDVW  715



>ref|XP_008676669.1| PREDICTED: uncharacterized protein LOC100216882 isoform X1 [Zea 
mays]
 gb|AFW62053.1| hypothetical protein ZEAMMB73_790468 [Zea mays]
Length=702

 Score =   128 bits (321),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS++W +ISQ  Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ 
Sbjct  628  KEYVQHKMAQKASEIWDMISQGAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESF  687

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  688  VKNLQMEGRYLRDVW  702



>ref|XP_006653834.1| PREDICTED: NADPH--cytochrome P450 reductase-like, partial [Oryza 
brachyantha]
Length=628

 Score =   127 bits (319),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+++W+++SQ GYLYVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ 
Sbjct  554  KEYVQHKMVDKATEIWNILSQGGYLYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTESY  613

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  614  VKSLQMDGRYLRDVW  628



>dbj|BAD05443.1| putative cytochrome P450 reductase [Oryza sativa Japonica Group]
 dbj|BAD05639.1| putative cytochrome P450 reductase [Oryza sativa Japonica Group]
Length=568

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK++++AS++W +ISQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ 
Sbjct  494  KEYVQHKMSQKASEIWDMISQGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESF  553

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  554  VKSLQTEGRYLRDVW  568



>ref|XP_003579401.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=692

 Score =   127 bits (320),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+++W++ISQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +D+SK E+ 
Sbjct  618  KEYVQHKMVEKATEIWNIISQGGYVYVCGDAKGMARDVHRVLHTIVQEQGSLDNSKTESY  677

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  678  VKSLQMEGRYLRDVW  692



>gb|AAC09468.2| putative NADPH-cytochrome P450 reductase [Pisum sativum]
Length=704

 Score =   127 bits (320),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W++ISQ  Y+YVCGDAKGMARDVHRTLHTI+QEQ  +DSSK E++
Sbjct  630  KEYVQHKMMEKASDIWNMISQGAYVYVCGDAKGMARDVHRTLHTILQEQGSLDSSKTESM  689

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  690  VKNLQMTGRYLRDVW  704



>ref|NP_001061346.1| Os08g0243500, partial [Oryza sativa Japonica Group]
 dbj|BAF23260.1| Os08g0243500, partial [Oryza sativa Japonica Group]
Length=651

 Score =   127 bits (319),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK++++AS++W +ISQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ 
Sbjct  577  KEYVQHKMSQKASEIWDMISQGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESF  636

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  637  VKSLQTEGRYLRDVW  651



>ref|XP_010914150.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=701

 Score =   127 bits (320),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A  +W +IS+ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE++
Sbjct  627  KEYVQHKMAEKAVDIWDIISKGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESM  686

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  687  VKNLQMEGRYLRDVW  701



>emb|CAA81209.1| NADPH-ferrihemoprotein reductase [Helianthus tuberosus]
Length=588

 Score =   127 bits (318),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK++++AS +W+++S+  YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  
Sbjct  514  KEYVQHKMSQKASDIWNMLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGNLDSSKAELY  573

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  574  VKNLQMSGRYLRDVW  588



>dbj|BAJ41269.1| NADPH-P450 reductase 2 [Zingiber officinale]
Length=701

 Score =   127 bits (320),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K YVQHK+TE+A+++W++ISQ GY+YVCGDAKGMARDVHR LHTI QEQ  +DSSK E+ 
Sbjct  627  KQYVQHKMTEKATELWNIISQGGYVYVCGDAKGMARDVHRVLHTIAQEQGGMDSSKTESF  686

Query  396  VKKLQMNGRYLRDVW  352
            +K LQM GRYLRDVW
Sbjct  687  IKSLQMEGRYLRDVW  701



>gb|EEE68301.1| hypothetical protein OsJ_26563 [Oryza sativa Japonica Group]
Length=711

 Score =   127 bits (320),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK++++AS++W +ISQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ 
Sbjct  637  KEYVQHKMSQKASEIWDMISQGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESF  696

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  697  VKSLQTEGRYLRDVW  711



>dbj|BAJ97446.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+ +WS++SQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E  
Sbjct  181  KEYVQHKMAEKAADLWSIVSQGGYVYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTEGY  240

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  241  VKNLQTEGRYLRDVW  255



>ref|XP_008653023.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Zea mays]
 tpg|DAA62574.1| TPA: hypothetical protein ZEAMMB73_030302 [Zea mays]
Length=709

 Score =   127 bits (319),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVD-SSKAEA  400
            K+YVQHK+ ++A+++WS+ISQ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D +SKAE+
Sbjct  634  KEYVQHKMAQKAAELWSIISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSMDNNSKAES  693

Query  399  IVKKLQMNGRYLRDVW  352
             VK LQM GRYLRDVW
Sbjct  694  YVKSLQMEGRYLRDVW  709



>ref|XP_009382841.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score =   127 bits (319),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A  +W++I Q GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E++
Sbjct  620  KEYVQHKMAEKALDIWNIIEQGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKTESM  679

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  680  VKSLQMDGRYLRDVW  694



>ref|XP_006453369.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
 gb|ESR66609.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
Length=763

 Score =   127 bits (319),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E++  +W+++S+  YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  689  KEYVQHKMMEKSWDIWNMLSEGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESM  748

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  749  VKNLQMTGRYLRDVW  763



>gb|KDO43871.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=714

 Score =   127 bits (319),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E++S +W+++S+  YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  640  KEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESM  699

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  700  VKNLQMTGRYLRDVW  714



>gb|KDO43870.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=687

 Score =   127 bits (318),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E++S +W+++S+  YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  613  KEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESM  672

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  673  VKNLQMTGRYLRDVW  687



>gb|KDO43876.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=509

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E++S +W+++S+  YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  435  KEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESM  494

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  495  VKNLQMTGRYLRDVW  509



>gb|AIC73829.1| cytochrome P450 reductase [Panax ginseng]
Length=678

 Score =   127 bits (318),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK++++AS+VW++IS+  Y+YVCGDAKGMARDVHR LHTI QEQ  +DSSKAE++
Sbjct  604  KEYVQHKMSQKASEVWNMISEGAYIYVCGDAKGMARDVHRMLHTIAQEQGALDSSKAESL  663

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  664  VKNLQMTGRYLRDVW  678



>ref|XP_006453370.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
 gb|ESR66610.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
Length=764

 Score =   127 bits (319),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E++  +W+++S+  YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  690  KEYVQHKMMEKSWDIWNMLSEGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESM  749

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  750  VKNLQMTGRYLRDVW  764



>gb|KDO43868.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=715

 Score =   127 bits (318),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E++S +W+++S+  YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  641  KEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESM  700

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  701  VKNLQMTGRYLRDVW  715



>emb|CDY28169.1| BnaA01g06800D [Brassica napus]
Length=696

 Score =   127 bits (318),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +WS+ISQ  Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ 
Sbjct  622  KEYVQHKMMDKASDIWSMISQGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESF  681

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  682  VKNLQMSGRYLRDVW  696



>ref|XP_010913661.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Elaeis guineensis]
Length=706

 Score =   127 bits (318),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W++ISQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +D S+ E++
Sbjct  632  KEYVQHKMAEKASDIWNVISQGGYIYVCGDAKGMARDVHRALHTIVQEQGSLDGSRTESM  691

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  692  VKSLQMEGRYLRDVW  706



>gb|KDO43869.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=710

 Score =   127 bits (318),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E++S +W+++S+  YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  636  KEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESM  695

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  696  VKNLQMTGRYLRDVW  710



>gb|EAZ10065.1| hypothetical protein OsI_32371 [Oryza sativa Indica Group]
Length=717

 Score =   127 bits (318),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A ++WS+IS  GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+S  E+ 
Sbjct  643  KEYVQHKMAEKAPEIWSIISPGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTESY  702

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  703  VKSLQMEGRYLRDVW  717



>ref|XP_006474186.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Citrus 
sinensis]
Length=714

 Score =   127 bits (318),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E++  +W+++S+  YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  640  KEYVQHKMMEKSWDIWNMLSEGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESM  699

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  700  VKNLQMTGRYLRDVW  714



>gb|AAC05022.1| NADPH:ferrihemoprotein oxidoreductase [Eschscholzia californica]
Length=705

 Score =   126 bits (317),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W +ISQ  YLYVCGDAKGMARDVHRTLHTI QEQ  +D+SK E++
Sbjct  631  KEYVQHKMAEKASYIWEMISQGAYLYVCGDAKGMARDVHRTLHTIAQEQGSLDNSKTESL  690

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  691  VKNLQMDGRYLRDVW  705



>gb|ABC47946.1| cytochrome P450 reductase [Artemisia annua]
 gb|AEQ63685.1| cytochrome P450 reductase [synthetic construct]
Length=704

 Score =   126 bits (317),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+T++AS +W+L+S+  YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  
Sbjct  630  KEYVQHKMTQKASDIWNLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELY  689

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  690  VKNLQMAGRYLRDVW  704



>ref|XP_006474185.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Citrus 
sinensis]
Length=715

 Score =   126 bits (317),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E++  +W+++S+  YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  641  KEYVQHKMMEKSWDIWNMLSEGAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESM  700

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  701  VKNLQMTGRYLRDVW  715



>ref|XP_007154761.1| hypothetical protein PHAVU_003G145400g [Phaseolus vulgaris]
 gb|ESW26755.1| hypothetical protein PHAVU_003G145400g [Phaseolus vulgaris]
Length=707

 Score =   126 bits (317),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K YVQH++ E+AS++WS+ISQ  Y+YVCGDAKGMARDVHR LHTI+QEQ  +DS+KAE++
Sbjct  633  KKYVQHEMLEKASEIWSMISQGAYIYVCGDAKGMARDVHRALHTILQEQGSMDSTKAESM  692

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ NGRYLRDVW
Sbjct  693  VKSLQTNGRYLRDVW  707



>ref|XP_006659239.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Oryza brachyantha]
Length=568

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS++W +ISQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ 
Sbjct  494  KEYVQHKMAQKASEIWDVISQGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESF  553

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  554  VKSLQTEGRYLRDVW  568



>ref|XP_009108997.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Brassica rapa]
Length=707

 Score =   126 bits (317),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A  +WS+ISQ GY+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ 
Sbjct  633  KEYVQHKMMDKACDIWSMISQGGYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESF  692

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  693  VKNLQMSGRYLRDVW  707



>gb|ABI98819.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   126 bits (317),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+T++AS +W+L+S+  YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  
Sbjct  630  KEYVQHKMTQKASDIWNLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELY  689

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  690  VKNLQMAGRYLRDVW  704



>gb|ABM88789.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   126 bits (317),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+T++AS +W+L+S+  YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  
Sbjct  630  KEYVQHKMTQKASDIWNLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELY  689

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  690  VKNLQMAGRYLRDVW  704



>gb|AAK56276.1|AF367288_1 AT4g30210/F9N11_60 [Arabidopsis thaliana]
 gb|AAL15387.1| AT4g30210/F9N11_60 [Arabidopsis thaliana]
Length=340

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ  YLYVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  
Sbjct  266  KEYVQHKMMDKASDIWNMISQGAYLYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGF  325

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ +GRYLRDVW
Sbjct  326  VKNLQTSGRYLRDVW  340



>emb|CDY14183.1| BnaA08g13140D [Brassica napus]
Length=696

 Score =   126 bits (317),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A  +WS+ISQ GY+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ 
Sbjct  622  KEYVQHKMMDKACDIWSMISQGGYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESF  681

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  682  VKNLQMSGRYLRDVW  696



>gb|AHB33950.1| cytochrome P450 reductase [Santalum album]
Length=704

 Score =   126 bits (317),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K YVQHK+ E+AS++W++IS  GY+YVCGDAKGMA+DVHR LHTIV EQ  +D+SK E++
Sbjct  630  KQYVQHKMMEKASEIWNMISDGGYVYVCGDAKGMAKDVHRALHTIVHEQGSLDNSKTESM  689

Query  396  VKKLQMNGRYLRDVW  352
            VK LQMNGRYLRDVW
Sbjct  690  VKNLQMNGRYLRDVW  704



>ref|XP_010447753.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=414

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ  Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  
Sbjct  340  KEYVQHKMMDKASDIWNMISQGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGF  399

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  400  VKNLQMSGRYLRDVW  414



>gb|AFW59699.1| hypothetical protein ZEAMMB73_961001 [Zea mays]
Length=509

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+++W++IS  GYLYVCGDAKGMARDVHR LHT+VQEQ  +DSSK E+ 
Sbjct  435  KEYVQHKMVEKATEIWNIISHGGYLYVCGDAKGMARDVHRMLHTVVQEQGSLDSSKTESY  494

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  495  VKSLQMEGRYLRDVW  509



>gb|AGC92176.1| cytochrome P450 oxidoreductase [Ocimum basilicum]
Length=707

 Score =   126 bits (316),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+T+RAS VW +IS  GY+YVCGDAKGMARDVHRTLHTI QEQ  + SS+AE +
Sbjct  633  KEYVQHKMTQRASDVWKIISDGGYVYVCGDAKGMARDVHRTLHTIAQEQGSLSSSEAEGM  692

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  693  VKNLQTTGRYLRDVW  707



>gb|ABL09938.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   126 bits (316),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+T++AS +W+L+S+  YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  
Sbjct  630  KEYVQHKMTQKASDIWNLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELY  689

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  690  VKNLQMAGRYLRDVW  704



>gb|EMS66177.1| NADPH--cytochrome P450 reductase [Triticum urartu]
Length=676

 Score =   125 bits (315),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+++WS++SQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ 
Sbjct  572  KEYVQHKMAEKAAELWSIVSQGGYVYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTESY  631

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  632  VKNLQTEGRYLRDVW  646



>gb|ABB88839.2| NADPH cytochrome P450 reductase [Stevia rebaudiana]
Length=710

 Score =   125 bits (315),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK++++AS +W L+S+  YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  
Sbjct  636  KEYVQHKMSQKASDIWKLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELY  695

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  696  VKNLQMSGRYLRDVW  710



>gb|AHM95445.1| cytochrome P450 reductase [Matricaria chamomilla var. recutita]
Length=701

 Score =   125 bits (315),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS++W+L+S+  YLYVCGDAKGMARDVHRTLHTI QEQ  +DSSKAE  
Sbjct  627  KEYVQHKMNQKASEIWNLLSEGAYLYVCGDAKGMARDVHRTLHTIAQEQGSLDSSKAELF  686

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  687  VKNLQMAGRYLRDVW  701



>ref|XP_003610109.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES92306.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=701

 Score =   125 bits (315),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W++ISQ  Y+YVCGDAKGMA+DVHRTLHTI+QEQ  +D+SK E++
Sbjct  627  KEYVQHKMIEKASDIWNMISQGAYIYVCGDAKGMAKDVHRTLHTILQEQGSLDNSKTESM  686

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  687  VKNLQMTGRYLRDVW  701



>ref|XP_006283224.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
 gb|EOA16122.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
Length=710

 Score =   125 bits (315),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ +RAS +W++ISQ  Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  
Sbjct  636  KEYVQHKMMDRASDIWNMISQGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGF  695

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  696  VKNLQMSGRYLRDVW  710



>gb|AGO03799.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=709

 Score =   125 bits (315),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK++++AS++W+L+S+  YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  
Sbjct  635  KEYVQHKMSQKASEIWNLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELY  694

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  695  VKNLQMAGRYLRDVW  709



>ref|XP_009408053.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=705

 Score =   125 bits (314),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+TE+AS +W++ISQ GY+YVCGDAKGMARDVH+ LHTI QEQ  +D SK E++
Sbjct  631  KEYVQHKMTEKASDIWNIISQGGYVYVCGDAKGMARDVHKVLHTICQEQGSLDGSKTESL  690

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  691  VKSLQTEGRYLRDVW  705



>gb|KDO43874.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=555

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E++S +W+++S+  YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  481  KEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESM  540

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  541  VKNLQMTGRYLRDVW  555



>gb|KDO43875.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=554

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E++S +W+++S+  YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++
Sbjct  480  KEYVQHKMMEKSSDIWNMLSEGAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESM  539

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  540  VKNLQMTGRYLRDVW  554



>ref|XP_010234513.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=700

 Score =   125 bits (314),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W +I Q GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ 
Sbjct  626  KEYVQHKMAQKASDIWDVIFQGGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESF  685

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  686  VKNLQTEGRYLRDVW  700



>ref|XP_003610110.1| NADPH cytochrome P450 reductase [Medicago truncatula]
Length=490

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W++ISQ  Y+YVCGDAKGMA+DVHRTLHTI+QEQ  +D+SK E++
Sbjct  416  KEYVQHKMIEKASDIWNMISQGAYIYVCGDAKGMAKDVHRTLHTILQEQGSLDNSKTESM  475

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  476  VKNLQMTGRYLRDVW  490



>ref|XP_009130253.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Brassica 
rapa]
Length=681

 Score =   125 bits (314),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +WS+ISQ  Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ 
Sbjct  607  KEYVQHKMMDKASDIWSMISQGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESF  666

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRY+RDVW
Sbjct  667  VKNLQMSGRYIRDVW  681



>ref|XP_009384791.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score =   125 bits (314),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W++ISQ GY+YVCGD+KGMA+DVHR LHTI+Q Q  +DSSK E++
Sbjct  620  KEYVQHKMAEKASDIWNIISQGGYIYVCGDSKGMAKDVHRALHTIIQGQGSLDSSKTESM  679

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  680  VKGLQMDGRYLRDVW  694



>emb|CDY03543.1| BnaC03g68020D [Brassica napus]
Length=710

 Score =   125 bits (314),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A  +WS+ISQ GY+YVCGDAKGMARDVHR LHTI QEQ  +DS+KAE+ 
Sbjct  636  KEYVQHKMMDKACDIWSMISQGGYVYVCGDAKGMARDVHRYLHTIAQEQGSMDSTKAESF  695

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  696  VKNLQMSGRYLRDVW  710



>emb|CDX68634.1| BnaC01g08190D [Brassica napus]
Length=712

 Score =   125 bits (314),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS++W++IS+  Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ 
Sbjct  638  KEYVQHKMMDKASEIWNMISEGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESF  697

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  698  VKNLQMSGRYLRDVW  712



>ref|XP_008667833.1| PREDICTED: uncharacterized protein LOC100279923 isoform X1 [Zea 
mays]
 tpg|DAA35631.1| TPA: hypothetical protein ZEAMMB73_666259 [Zea mays]
Length=695

 Score =   125 bits (313),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+ +W++IS  GYLYVCGDAKGMARDVH+ LHTIVQEQ  +D+SK E+ 
Sbjct  621  KEYVQHKMVEKATDIWNIISNGGYLYVCGDAKGMARDVHKMLHTIVQEQGSLDNSKTESY  680

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  681  VKSLQMEGRYLRDVW  695



>emb|CBX24555.1| NADPH:cytochrome P450 reductase [Salvia miltiorrhiza]
Length=705

 Score =   125 bits (313),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+++RAS +W +IS  GY+YVCGDAKGMARDVHRTLHTI QEQ  + SS+AE +
Sbjct  631  KEYVQHKMSQRASDIWKMISDGGYMYVCGDAKGMARDVHRTLHTIAQEQGSLSSSEAEGM  690

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  691  VKNLQTTGRYLRDVW  705



>ref|XP_008667834.1| PREDICTED: uncharacterized protein LOC100279923 isoform X2 [Zea 
mays]
 tpg|DAA35632.1| TPA: hypothetical protein ZEAMMB73_666259 [Zea mays]
Length=694

 Score =   125 bits (313),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+ +W++IS  GYLYVCGDAKGMARDVH+ LHTIVQEQ  +D+SK E+ 
Sbjct  620  KEYVQHKMVEKATDIWNIISNGGYLYVCGDAKGMARDVHKMLHTIVQEQGSLDNSKTESY  679

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  680  VKSLQMEGRYLRDVW  694



>gb|KDP36395.1| hypothetical protein JCGZ_08664 [Jatropha curcas]
Length=711

 Score =   125 bits (313),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W+LISQ  Y+YVCGDAKGMARDVHRTLHTI QEQ  + +S+AE++
Sbjct  637  KEYVQHKMMEKASDIWNLISQGAYIYVCGDAKGMARDVHRTLHTIAQEQGSLSNSRAESM  696

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ +GRYLRDVW
Sbjct  697  VKNLQTSGRYLRDVW  711



>gb|AFO64618.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   125 bits (313),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+T++ S +W+L+S+  YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  
Sbjct  630  KEYVQHKMTQKTSDIWNLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELY  689

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  690  VKNLQMAGRYLRDVW  704



>ref|XP_004957625.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Setaria italica]
Length=705

 Score =   124 bits (312),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A  +WS+ISQ GY+YVCGDAKGMARDVHRTLHTI+QEQ  +D+SK E+ 
Sbjct  631  KEYVQHKMAQKAGVLWSIISQGGYIYVCGDAKGMARDVHRTLHTIIQEQGSLDNSKTESY  690

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  691  VKSLQTEGRYLRDVW  705



>gb|EPS66345.1| hypothetical protein M569_08425 [Genlisea aurea]
Length=683

 Score =   124 bits (312),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E A+ +W LIS+  Y+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E+ 
Sbjct  609  KEYVQHKMAEGAADLWKLISEGAYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTESF  668

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  669  VKNLQMTGRYLRDVW  683



>ref|XP_010548619.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Tarenaya 
hassleriana]
Length=714

 Score =   124 bits (312),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ  YLYVCGDAKGMARDVHR LHTIVQEQ  +D SKAE+ 
Sbjct  640  KEYVQHKMIDKASDIWNMISQGAYLYVCGDAKGMARDVHRALHTIVQEQGSMDGSKAESF  699

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ +GRYLRDVW
Sbjct  700  VKNLQTSGRYLRDVW  714



>gb|AAC05021.1| NADPH:ferrihemoprotein oxidoreductase [Papaver somniferum]
 gb|AHF27398.1| NADPH:ferrihemoprotein oxidoreductase [synthetic construct]
Length=683

 Score =   124 bits (311),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A+ VW++IS +GYLYVCGDAKGMARDVHRTLHTI QEQ  ++SS AEA 
Sbjct  609  KEYVQHKMMEKATDVWNVISGDGYLYVCGDAKGMARDVHRTLHTIAQEQGPMESSAAEAA  668

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQ+  RYLRDVW
Sbjct  669  VKKLQVEERYLRDVW  683



>ref|XP_006412733.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
 gb|ESQ54186.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
Length=711

 Score =   124 bits (312),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +WS+IS+  Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ 
Sbjct  637  KEYVQHKMMDKASDIWSMISEGAYVYVCGDAKGMARDVHRSLHTIAQEQGPMDSTKAESF  696

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  697  VKNLQMSGRYLRDVW  711



>dbj|BAJ33878.1| unnamed protein product [Thellungiella halophila]
Length=711

 Score =   124 bits (312),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +WS+IS+  Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ 
Sbjct  637  KEYVQHKMMDKASDIWSMISEGAYVYVCGDAKGMARDVHRSLHTIAQEQGPMDSTKAESF  696

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  697  VKNLQMSGRYLRDVW  711



>emb|CDX72222.1| BnaC07g42440D [Brassica napus]
Length=708

 Score =   124 bits (311),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++IS+  Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ 
Sbjct  634  KEYVQHKMMDKASDIWNMISEGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESF  693

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  694  VKNLQMSGRYLRDVW  708



>emb|CAA81210.1| NADPH-ferrihemoprotein reductase [Helianthus tuberosus]
Length=506

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W L+S+  YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  
Sbjct  432  KEYVQHKMNEKASDLWKLLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELF  491

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  492  VKNLQCRGRYLRDVW  506



>emb|CDY51656.1| BnaAnng10960D [Brassica napus]
Length=706

 Score =   124 bits (311),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++IS+  Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ 
Sbjct  632  KEYVQHKMMDKASDIWNMISEGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESF  691

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  692  VKNLQMSGRYLRDVW  706



>gb|AAS00459.1| NADPH:cytochrome P450-reductase [Hypericum androsaemum]
Length=685

 Score =   124 bits (311),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            KDYVQHK+ ++A+ +W ++SQ  ++YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E  
Sbjct  611  KDYVQHKMMDKAAYIWEVLSQGAHIYVCGDAKGMARDVHRTLHTIVQEQGNLDSSKTELF  670

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLR+VW
Sbjct  671  VKKLQMDGRYLRNVW  685



>sp|Q05001.1|NCPR_CATRO RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Catharanthus roseus]
 emb|CAA49446.1| NADPH--ferrihemoprotein reductase [Catharanthus roseus]
Length=714

 Score =   124 bits (311),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K YVQHK+ E+AS +W +IS   Y+YVCGDAKGMARDVHRTLHTI QEQ  +DS++AE  
Sbjct  640  KQYVQHKMAEKASDIWRMISDGAYVYVCGDAKGMARDVHRTLHTIAQEQGSMDSTQAEGF  699

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  700  VKNLQMTGRYLRDVW  714



>ref|XP_010929254.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=704

 Score =   124 bits (310),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A  +W +IS+ G++YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE++
Sbjct  630  KEYVQHKMAEKAVVIWDIISKGGHIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESM  689

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  690  VKNLQMEGRYLRDVW  704



>ref|XP_010447751.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=710

 Score =   124 bits (310),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ  Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  
Sbjct  636  KEYVQHKMMDKASDIWNMISQGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGF  695

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  696  VKNLQMSGRYLRDVW  710



>ref|XP_010438203.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Camelina sativa]
Length=709

 Score =   124 bits (310),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ  Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  
Sbjct  635  KEYVQHKMMDKASDIWNMISQGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGF  694

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  695  VKNLQMSGRYLRDVW  709



>gb|AAS90127.1| NADPH cytochrome P450 reductase [Ammi majus]
Length=681

 Score =   123 bits (308),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS++W+L+S+  Y+YVCGDAKGMARDVHR LHTI QEQ  +DSSKAE+ 
Sbjct  607  KEYVQHKMLQKASEIWNLMSEGAYIYVCGDAKGMARDVHRMLHTIAQEQGALDSSKAESW  666

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  667  VKNLQMTGRYLRDVW  681



>gb|AAB97736.1| NADPH cytochrome P450 reductase [Petroselinum crispum]
Length=681

 Score =   123 bits (308),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS++W+LIS+  Y+YVCGDAKGMARDVHR LHTI QEQ  +DSSKAE+ 
Sbjct  607  KEYVQHKMLQKASEIWNLISEGAYIYVCGDAKGMARDVHRMLHTIAQEQGALDSSKAESW  666

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  667  VKNLQMTGRYLRDVW  681



>gb|EEE70211.1| hypothetical protein OsJ_30318 [Oryza sativa Japonica Group]
Length=795

 Score =   123 bits (309),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 53/73 (73%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+A ++WS+ISQ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+S  E+ 
Sbjct  665  KEYVQHKMAEKAPEIWSIISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTESY  724

Query  396  VKKLQMNGRYLRD  358
            VK LQM GRYLRD
Sbjct  725  VKSLQMEGRYLRD  737



>emb|CAA46815.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=712

 Score =   123 bits (308),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ  YLYVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  
Sbjct  638  KEYVQHKMMDKASDIWNMISQGAYLYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGF  697

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ +GRYLRDVW
Sbjct  698  VKNLQTSGRYLRDVW  712



>ref|NP_194750.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 sp|Q9SUM3.1|NCPR2_ARATH RecName: Full=NADPH--cytochrome P450 reductase 2 [Arabidopsis 
thaliana]
 gb|AAK17169.1|AF325101_1 NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB52465.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB81014.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 gb|AEE85738.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=711

 Score =   122 bits (307),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ  YLYVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  
Sbjct  637  KEYVQHKMMDKASDIWNMISQGAYLYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGF  696

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ +GRYLRDVW
Sbjct  697  VKNLQTSGRYLRDVW  711



>ref|NP_849472.2| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 gb|AEE85737.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=712

 Score =   122 bits (307),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++ISQ  YLYVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  
Sbjct  638  KEYVQHKMMDKASDIWNMISQGAYLYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGF  697

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ +GRYLRDVW
Sbjct  698  VKNLQTSGRYLRDVW  712



>gb|ADG29353.1| cytochrome P450 reductase [Withania somnifera]
Length=713

 Score =   122 bits (307),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K YVQHK+T++A+ +W++ISQ G++YVCGDAKGMARDVHRTLHTI Q+Q  +DSS AE++
Sbjct  639  KQYVQHKMTQKAADIWNMISQGGHVYVCGDAKGMARDVHRTLHTIAQDQGSLDSSNAESL  698

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  699  VKNLQTTGRYLRDVW  713



>gb|EYU20907.1| hypothetical protein MIMGU_mgv1a002097mg [Erythranthe guttata]
Length=715

 Score =   122 bits (307),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS VW++IS  GY YVCGDAKGMARDVHRTLHTIVQEQ  + SS+AE +
Sbjct  641  KEYVQHKMAQKASDVWNMISDGGYAYVCGDAKGMARDVHRTLHTIVQEQGSLSSSEAEGM  700

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  701  VKNLQTTGRYLRDVW  715



>ref|XP_002984697.1| hypothetical protein SELMODRAFT_234596 [Selaginella moellendorffii]
 gb|EFJ14342.1| hypothetical protein SELMODRAFT_234596 [Selaginella moellendorffii]
Length=627

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQ  + ++A+Q+W +IS +GY+YVCGDAKGMA+DVHRTLHTIVQEQ  +DSSK EA 
Sbjct  553  KEYVQDIMMKKANQLWDIISSDGYIYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKTEAF  612

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  613  VKKLQMDGRYLRDVW  627



>dbj|BAJ99370.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   122 bits (306),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+++W++ISQ GY+YVCGDAKGMA+DVHR LHTIVQ+Q  +D+SK E  
Sbjct  568  KEYVQHKMIDKATEIWNVISQGGYIYVCGDAKGMAKDVHRVLHTIVQKQGSLDNSKTELY  627

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  628  VKNLQMEGRYLRDVW  642



>gb|KJB22140.1| hypothetical protein B456_004G0316002, partial [Gossypium raimondii]
Length=398

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ E+AS +W++IS+ GYLYVCGDAKGMARDVHRTL TI+ EQ  +DSSKAE++
Sbjct  324  KEYVQHKMMEKASDIWNMISEGGYLYVCGDAKGMARDVHRTLLTILHEQGCLDSSKAESM  383

Query  396  VKKLQMNGRYLRDVW  352
            VK L   GRYLRDVW
Sbjct  384  VKNLHTTGRYLRDVW  398



>gb|AAG17471.1|AF123610_10 NADPH-cytochrome P450 reductase [Triticum aestivum]
Length=656

 Score =   122 bits (305),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A+++W++ISQ GY+YVCGDAKGMA+DVHR LHTIVQ+Q  +D+SK E  
Sbjct  582  KEYVQHKMVDKATEIWNVISQGGYIYVCGDAKGMAKDVHRVLHTIVQKQGSLDNSKTELY  641

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM GRYLRDVW
Sbjct  642  VKNLQMEGRYLRDVW  656



>ref|XP_003578634.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=697

 Score =   122 bits (306),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+  +A ++WS+ISQ GY+YVCGDAKGMARDVHR LHTIVQ Q  +D+SK E+ 
Sbjct  623  KEYVQHKMAAKAPELWSIISQGGYIYVCGDAKGMARDVHRVLHTIVQGQGSLDNSKTESY  682

Query  396  VKKLQMNGRYLRDVW  352
            +K LQM GRYLRDVW
Sbjct  683  MKNLQMEGRYLRDVW  697



>ref|XP_010433014.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=709

 Score =   122 bits (306),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++AS +W++IS+  Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  
Sbjct  635  KEYVQHKMMDKASDIWNMISRGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGF  694

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM+GRYLRDVW
Sbjct  695  VKNLQMSGRYLRDVW  709



>gb|KFK29577.1| nadph-ferrihemoprotein reductase [Arabis alpina]
Length=715

 Score =   122 bits (306),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K YVQHK+ ++AS++WS+IS+  Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  
Sbjct  641  KQYVQHKMMDKASEIWSMISEGAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGF  700

Query  396  VKKLQMNGRYLRDVW  352
            VK LQ  GRYLRDVW
Sbjct  701  VKNLQTTGRYLRDVW  715



>ref|XP_002978784.1| hypothetical protein SELMODRAFT_152770 [Selaginella moellendorffii]
 gb|EFJ20231.1| hypothetical protein SELMODRAFT_152770 [Selaginella moellendorffii]
Length=627

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQ  + ++A+Q+W +IS +GY+YVCGDAKGMA+DVHRTLHTIVQEQ  +DSSK EA 
Sbjct  553  KEYVQDIMMKKANQLWDIISGDGYIYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKTEAF  612

Query  396  VKKLQMNGRYLRDVW  352
            VKKLQM+GRYLRDVW
Sbjct  613  VKKLQMDGRYLRDVW  627



>emb|CAQ37789.1| NADPH:cytochrome P450 reductase [Solenostemon scutellarioides]
Length=711

 Score =   122 bits (305),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  576  KDYVQHKITERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAI  397
            K+YVQHK+ ++A  VW++IS+ GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E+ 
Sbjct  637  KEYVQHKMAQKAWDVWNMISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTESF  696

Query  396  VKKLQMNGRYLRDVW  352
            VK LQM G  LRDVW
Sbjct  697  VKNLQMTGAVLRDVW  711



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985